Psyllid ID: psy3386


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70------
MFNSTGGHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCLSSG
ccccccccccEEEEccccccccccccccEEEEEEccccEEEEEEEEEEEcccccccccccccccEEEEEEEEcccc
cccccccccccEEccccccccccccEEEEEEEEEccccEEEEEEEcHHHHHHHHHcccccccccEEEEEEEEcccc
mfnstgghrngtftspnfpglyprdtechyffygrnDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCLSSG
mfnstgghrngtftspnfpglypRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCLSSG
MFNSTGGHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCLSSG
*****************FPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCL***
*FN****HRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCL***
********RNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCLSSG
**********GTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCLS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNSTGGHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCLSSG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query76 2.2.26 [Sep-21-2011]
Q93212594 Suppressor of lurcher pro yes N/A 0.605 0.077 0.531 9e-07
>sp|Q93212|SOL1_CAEEL Suppressor of lurcher protein 1 OS=Caenorhabditis elegans GN=sol-1 PE=1 SV=3 Back     alignment and function desciption
 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 2   FNSTGGHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFD 48
           FNS+  H NG   S N+PGLYPR+  C Y F+GRND+ + + FE FD
Sbjct: 439 FNSSE-HTNGKLWSANYPGLYPRNLYCEYIFHGRNDQVVHIHFEYFD 484




Accessory protein required for glutamate-gated currents. May participate in the gating of non-NMDA (N-methyl-D-aspartate) ionotropic glutamate receptors such as glr-1.
Caenorhabditis elegans (taxid: 6239)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
328783696 635 PREDICTED: cubilin-like [Apis mellifera] 0.513 0.061 0.775 7e-10
443694215 332 hypothetical protein CAPTEDRAFT_226257 [ 0.513 0.117 0.743 9e-10
357606909 684 hypothetical protein KGM_16882 [Danaus p 0.447 0.049 0.65 9e-10
443694214126 hypothetical protein CAPTEDRAFT_27776, p 0.513 0.309 0.743 1e-09
322780192 191 hypothetical protein SINV_01179 [Solenop 0.618 0.246 0.645 3e-09
383860913 312 PREDICTED: suppressor of lurcher protein 0.513 0.125 0.725 3e-09
340725396 650 PREDICTED: cubilin-like [Bombus terrestr 0.447 0.052 0.725 4e-09
350403715 624 PREDICTED: cubilin-like [Bombus impatien 0.473 0.057 0.725 4e-09
391343436 531 PREDICTED: suppressor of lurcher protein 0.513 0.073 0.666 4e-09
242008984 328 conserved hypothetical protein [Pediculu 0.618 0.143 0.625 9e-09
>gi|328783696|ref|XP_001122665.2| PREDICTED: cubilin-like [Apis mellifera] Back     alignment and taxonomy information
 Score = 68.2 bits (165), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/40 (77%), Positives = 34/40 (85%)

Query: 9   RNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFD 48
           RNGTFTSPN+PGLYPRDTECHYFF G+ +ERI L F  FD
Sbjct: 476 RNGTFTSPNYPGLYPRDTECHYFFNGQPNERIHLHFHFFD 515




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|443694215|gb|ELT95408.1| hypothetical protein CAPTEDRAFT_226257 [Capitella teleta] Back     alignment and taxonomy information
>gi|357606909|gb|EHJ65280.1| hypothetical protein KGM_16882 [Danaus plexippus] Back     alignment and taxonomy information
>gi|443694214|gb|ELT95407.1| hypothetical protein CAPTEDRAFT_27776, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|322780192|gb|EFZ09831.1| hypothetical protein SINV_01179 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383860913|ref|XP_003705932.1| PREDICTED: suppressor of lurcher protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340725396|ref|XP_003401056.1| PREDICTED: cubilin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350403715|ref|XP_003486882.1| PREDICTED: cubilin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|391343436|ref|XP_003746016.1| PREDICTED: suppressor of lurcher protein 1-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|242008984|ref|XP_002425273.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509038|gb|EEB12535.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
WB|WBGene00004944594 sol-1 [Caenorhabditis elegans 0.605 0.077 0.531 3.5e-08
FB|FBgn0261262 1146 CG42613 [Drosophila melanogast 0.539 0.035 0.414 3.8e-05
MGI|MGI:3045328 427 Cdcp2 "CUB domain containing p 0.513 0.091 0.435 0.00027
UNIPROTKB|Q5VXM1 449 CDCP2 "CUB domain-containing p 0.513 0.086 0.435 0.00047
UNIPROTKB|F1MKV7 3620 CUBN "Uncharacterized protein" 0.5 0.010 0.5 0.00094
WB|WBGene00004944 sol-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 136 (52.9 bits), Expect = 3.5e-08, P = 3.5e-08
 Identities = 25/47 (53%), Positives = 32/47 (68%)

Query:     2 FNSTGGHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFD 48
             FNS+  H NG   S N+PGLYPR+  C Y F+GRND+ + + FE FD
Sbjct:   439 FNSSE-HTNGKLWSANYPGLYPRNLYCEYIFHGRNDQVVHIHFEYFD 484




GO:0019915 "lipid storage" evidence=IMP
GO:0045202 "synapse" evidence=IDA
GO:0051968 "positive regulation of synaptic transmission, glutamatergic" evidence=IGI;IDA;IMP
GO:0040012 "regulation of locomotion" evidence=IGI
GO:0016247 "channel regulator activity" evidence=IDA;IMP
GO:0006972 "hyperosmotic response" evidence=IMP
GO:0001966 "thigmotaxis" evidence=IMP
GO:0032589 "neuron projection membrane" evidence=IDA
GO:0008328 "ionotropic glutamate receptor complex" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
FB|FBgn0261262 CG42613 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:3045328 Cdcp2 "CUB domain containing protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VXM1 CDCP2 "CUB domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MKV7 CUBN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93212SOL1_CAEELNo assigned EC number0.53190.60520.0774yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
smart00042102 smart00042, CUB, Domain first found in C1r, C1s, u 4e-09
cd00041113 cd00041, CUB, CUB domain; extracellular domain; pr 6e-09
pfam00431110 pfam00431, CUB, CUB domain 5e-07
>gnl|CDD|214483 smart00042, CUB, Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein Back     alignment and domain information
 Score = 48.2 bits (115), Expect = 4e-09
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 11 GTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFD 48
          GT TSPN+P  YP + +C +        RI+L F  FD
Sbjct: 1  GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFD 38


This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain. Length = 102

>gnl|CDD|238001 cd00041, CUB, CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast Back     alignment and domain information
>gnl|CDD|215916 pfam00431, CUB, CUB domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 76
smart00042102 CUB Domain first found in C1r, C1s, uEGF, and bone 99.5
PF00431110 CUB: CUB domain CUB domain entry Spermadhesins fam 99.49
cd00041113 CUB CUB domain; extracellular domain; present in p 99.48
KOG4292|consensus454 98.75
KOG4586|consensus156 98.06
KOG4292|consensus 454 97.73
PF02408120 CUB_2: CUB-like domain; InterPro: IPR003366 This d 94.63
>smart00042 CUB Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein Back     alignment and domain information
Probab=99.50  E-value=1.3e-13  Score=80.72  Aligned_cols=56  Identities=30%  Similarity=0.513  Sum_probs=46.7

Q ss_pred             eEEECCCCCCCCCCCceeEEEEEeCCCceEEEEEeEEEeCccccCCCcCCCCcceEEEeEEec
Q psy3386          11 GTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCL   73 (76)
Q Consensus        11 G~i~SP~yP~~Yp~~~~C~W~I~~~~g~~I~L~F~~f~le~~~~~~~~C~~c~~~~i~~~~~~   73 (76)
                      |.|.||+||..||++..|.|.|+++++.+|.|+|+.|+|+.    ..   .|..+.+...++.
T Consensus         1 G~i~Sp~yP~~y~~~~~C~w~i~~~~g~~i~l~f~~~~l~~----~~---~C~~d~l~i~~g~   56 (102)
T smart00042        1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLES----SD---NCEYDYVEIYDGP   56 (102)
T ss_pred             CEEeCCCCCcCCCCCCcEEEEEECCCCeEEEEEEEEEeccC----CC---CeeEeEEEEEeCC
Confidence            78999999999999999999999999999999999999997    22   3554555554443



This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.

>PF00431 CUB: CUB domain CUB domain entry Spermadhesins family entry Link to schematic domain picture by Peer Bork Back     alignment and domain information
>cd00041 CUB CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast Back     alignment and domain information
>KOG4292|consensus Back     alignment and domain information
>KOG4586|consensus Back     alignment and domain information
>KOG4292|consensus Back     alignment and domain information
>PF02408 CUB_2: CUB-like domain; InterPro: IPR003366 This domain is found in a family of hypothetical Caenorhabditis elegans proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
3dem_A 278 Complement factor MAsp-3; complement system, innat 8e-10
3dem_A278 Complement factor MAsp-3; complement system, innat 5e-08
3kq4_B 457 Cubilin; protein-protein complex, cobalt, cobalt t 1e-09
3kq4_B 457 Cubilin; protein-protein complex, cobalt, cobalt t 3e-09
3kq4_B457 Cubilin; protein-protein complex, cobalt, cobalt t 4e-07
3kq4_B 457 Cubilin; protein-protein complex, cobalt, cobalt t 2e-06
2wno_A149 Tumor necrosis factor-inducible gene 6 protein; gl 2e-09
1nt0_A 286 MAsp2, mannose-binding protein associated serine p 2e-09
1nt0_A286 MAsp2, mannose-binding protein associated serine p 2e-08
1nzi_A159 Complement C1S component; calcium, innate immunity 3e-09
4aqb_A 361 Mannan-binding lectin serine protease 1; blood clo 3e-09
4aqb_A 361 Mannan-binding lectin serine protease 1; blood clo 3e-08
3poj_A115 Mannan-binding lectin serine protease 1; CUB domai 6e-09
1szb_A170 Mannose binding lectin-associated serine protease- 1e-08
2qqm_A 450 Neuropilin-1; VEGF receptor, semaphorin receptor, 1e-08
2qqo_A 460 Neuropilin-2; VEGF receptor, semaphorin receptor, 2e-08
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 4e-08
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 3e-07
1spp_A109 Major seminal plasma glycoprotein PSP-I; seminal p 4e-05
1sfp_A114 ASFP; spermadhesin, bovine seminal plasma protein, 3e-04
1spp_B116 Major seminal plasma glycoprotein PSP-II; seminal 4e-04
>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Length = 278 Back     alignment and structure
 Score = 51.9 bits (124), Expect = 8e-10
 Identities = 14/40 (35%), Positives = 19/40 (47%)

Query: 9  RNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFD 48
            G   SP +P  YP D+E  +     +  RIKL F  F+
Sbjct: 8  MFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFN 47


>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Length = 278 Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 Back     alignment and structure
>2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A Length = 115 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Length = 450 Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Length = 460 Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 Back     alignment and structure
>1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 109 Back     alignment and structure
>1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 Length = 114 Back     alignment and structure
>1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 116 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
1nzi_A159 Complement C1S component; calcium, innate immunity 99.65
2wno_A149 Tumor necrosis factor-inducible gene 6 protein; gl 99.65
1szb_A170 Mannose binding lectin-associated serine protease- 99.64
3poj_A115 Mannan-binding lectin serine protease 1; CUB domai 99.62
4aqb_A 361 Mannan-binding lectin serine protease 1; blood clo 99.58
3dem_A 278 Complement factor MAsp-3; complement system, innat 99.55
1nt0_A 286 MAsp2, mannose-binding protein associated serine p 99.54
2qqo_A 460 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.48
2qqm_A 450 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.48
3dem_A278 Complement factor MAsp-3; complement system, innat 99.48
1nt0_A286 MAsp2, mannose-binding protein associated serine p 99.43
4gz9_A 577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 99.4
3kq4_B457 Cubilin; protein-protein complex, cobalt, cobalt t 99.39
3kq4_B 457 Cubilin; protein-protein complex, cobalt, cobalt t 99.36
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.35
4gz9_A 577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 99.35
1spp_A109 Major seminal plasma glycoprotein PSP-I; seminal p 99.28
1spp_B116 Major seminal plasma glycoprotein PSP-II; seminal 99.28
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.24
4aqb_A 361 Mannan-binding lectin serine protease 1; blood clo 99.23
1sfp_A114 ASFP; spermadhesin, bovine seminal plasma protein, 99.22
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
Probab=99.65  E-value=4.2e-16  Score=97.43  Aligned_cols=58  Identities=24%  Similarity=0.339  Sum_probs=49.0

Q ss_pred             cccceEEECCCCCCCCCCCceeEEEEEeCCCceEEEEEeEEEeCccccCCCcCCCCcceEEEeEE
Q psy3386           7 GHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIK   71 (76)
Q Consensus         7 ~~~~G~i~SP~yP~~Yp~~~~C~W~I~~~~g~~I~L~F~~f~le~~~~~~~~C~~c~~~~i~~~~   71 (76)
                      ++..|.|+||+||..||++..|.|.|+++++++|+|+|.+|+||.    ..   .|..+.+..++
T Consensus         2 ~~~~G~i~SP~yP~~Yp~~~~C~w~I~~~~g~~I~l~f~~f~le~----~~---~C~~D~l~i~d   59 (159)
T 1nzi_A            2 PTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIEL----SE---NCAYDSVQIIS   59 (159)
T ss_dssp             CCSEEEEECTTTTSCCCSSEEEEEEEECCTTEEEEEEEEEEECCC----CG---GGCSSEEEEEC
T ss_pred             CCCCEEEECCCCccCCCCCCCEEEEEEeCCCCEEEEEEeEEEecC----CC---CCCCCEEEEEe
Confidence            467899999999999999999999999999999999999999997    23   45545554444



>2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Back     alignment and structure
>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Back     alignment and structure
>1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Back     alignment and structure
>1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 76
d1nzia1117 b.23.1.1 (A:1-117) Complement C1S component {Human 9e-07
d1szba1121 b.23.1.1 (A:3-123) Mannose-binding protein associa 2e-05
d2qqma3108 b.23.1.1 (A:156-263) Mannose-binding protein assoc 7e-05
d1nt0a2114 b.23.1.1 (A:165-278) Mannose-binding protein assoc 3e-04
>d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

class: All beta proteins
fold: CUB-like
superfamily: Spermadhesin, CUB domain
family: Spermadhesin, CUB domain
domain: Complement C1S component
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.0 bits (95), Expect = 9e-07
 Identities = 12/50 (24%), Positives = 16/50 (32%)

Query: 11 GTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCL 60
          G   SPN+P  YP + E  +         I L F   D           +
Sbjct: 6  GEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSV 55


>d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
d2qqma3108 Mannose-binding protein associated serine protease 99.69
d1szba1121 Mannose-binding protein associated serine protease 99.67
d1nzia1117 Complement C1S component {Human (Homo sapiens) [Ta 99.67
d1nt0a2114 Mannose-binding protein associated serine protease 99.55
d1sppb_112 Major seminal plasma glycoprotein PSP-II {Pig (Sus 99.28
d1sppa_109 Major seminal plasma glycoprotein PSP-I {Pig (Sus 99.21
d1sfpa_111 Acidic seminal fluid protein (ASFP) {Cow (Bos taur 99.09
>d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: CUB-like
superfamily: Spermadhesin, CUB domain
family: Spermadhesin, CUB domain
domain: Mannose-binding protein associated serine protease 2, MASP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69  E-value=4e-17  Score=94.54  Aligned_cols=62  Identities=29%  Similarity=0.408  Sum_probs=49.5

Q ss_pred             eEEECCCCCCCCCCCceeEEEEEeCCCceEEEEEeEEEeCccccCCCcCCCCcceEEEeEEec
Q psy3386          11 GTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCL   73 (76)
Q Consensus        11 G~i~SP~yP~~Yp~~~~C~W~I~~~~g~~I~L~F~~f~le~~~~~~~~C~~c~~~~i~~~~~~   73 (76)
                      |.|+||+||..||++..|.|.|+++++++|+|+|.+|+||... .......|..+.+..+.+.
T Consensus         1 G~i~SP~yP~~Y~~~~~C~w~I~~p~~~~I~l~f~~f~l~~~~-~~~~~~~C~~D~l~i~dg~   62 (108)
T d2qqma3           1 GVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDS-NPPGGMFCRYDRLEIWDGF   62 (108)
T ss_dssp             EEEECTTTTSCCCSSCEEEEEEECGGGCCEEEEEEEEECCCC-----CCCSSCSSEEEEESSS
T ss_pred             CEEeCCCCCCCCCCCCeEEEEEEeCCCceeeeEEEEEEeeccc-ccccCCCccccEEEEEecc
Confidence            8999999999999999999999999999999999999998631 1223445776666665543



>d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure