Psyllid ID: psy3386
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 76 | ||||||
| 328783696 | 635 | PREDICTED: cubilin-like [Apis mellifera] | 0.513 | 0.061 | 0.775 | 7e-10 | |
| 443694215 | 332 | hypothetical protein CAPTEDRAFT_226257 [ | 0.513 | 0.117 | 0.743 | 9e-10 | |
| 357606909 | 684 | hypothetical protein KGM_16882 [Danaus p | 0.447 | 0.049 | 0.65 | 9e-10 | |
| 443694214 | 126 | hypothetical protein CAPTEDRAFT_27776, p | 0.513 | 0.309 | 0.743 | 1e-09 | |
| 322780192 | 191 | hypothetical protein SINV_01179 [Solenop | 0.618 | 0.246 | 0.645 | 3e-09 | |
| 383860913 | 312 | PREDICTED: suppressor of lurcher protein | 0.513 | 0.125 | 0.725 | 3e-09 | |
| 340725396 | 650 | PREDICTED: cubilin-like [Bombus terrestr | 0.447 | 0.052 | 0.725 | 4e-09 | |
| 350403715 | 624 | PREDICTED: cubilin-like [Bombus impatien | 0.473 | 0.057 | 0.725 | 4e-09 | |
| 391343436 | 531 | PREDICTED: suppressor of lurcher protein | 0.513 | 0.073 | 0.666 | 4e-09 | |
| 242008984 | 328 | conserved hypothetical protein [Pediculu | 0.618 | 0.143 | 0.625 | 9e-09 |
| >gi|328783696|ref|XP_001122665.2| PREDICTED: cubilin-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Score = 68.2 bits (165), Expect = 7e-10, Method: Compositional matrix adjust.
Identities = 31/40 (77%), Positives = 34/40 (85%)
Query: 9 RNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFD 48
RNGTFTSPN+PGLYPRDTECHYFF G+ +ERI L F FD
Sbjct: 476 RNGTFTSPNYPGLYPRDTECHYFFNGQPNERIHLHFHFFD 515
|
Source: Apis mellifera Species: Apis mellifera Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|443694215|gb|ELT95408.1| hypothetical protein CAPTEDRAFT_226257 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|357606909|gb|EHJ65280.1| hypothetical protein KGM_16882 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|443694214|gb|ELT95407.1| hypothetical protein CAPTEDRAFT_27776, partial [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|322780192|gb|EFZ09831.1| hypothetical protein SINV_01179 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383860913|ref|XP_003705932.1| PREDICTED: suppressor of lurcher protein 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340725396|ref|XP_003401056.1| PREDICTED: cubilin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350403715|ref|XP_003486882.1| PREDICTED: cubilin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|391343436|ref|XP_003746016.1| PREDICTED: suppressor of lurcher protein 1-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|242008984|ref|XP_002425273.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509038|gb|EEB12535.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 76 | ||||||
| WB|WBGene00004944 | 594 | sol-1 [Caenorhabditis elegans | 0.605 | 0.077 | 0.531 | 3.5e-08 | |
| FB|FBgn0261262 | 1146 | CG42613 [Drosophila melanogast | 0.539 | 0.035 | 0.414 | 3.8e-05 | |
| MGI|MGI:3045328 | 427 | Cdcp2 "CUB domain containing p | 0.513 | 0.091 | 0.435 | 0.00027 | |
| UNIPROTKB|Q5VXM1 | 449 | CDCP2 "CUB domain-containing p | 0.513 | 0.086 | 0.435 | 0.00047 | |
| UNIPROTKB|F1MKV7 | 3620 | CUBN "Uncharacterized protein" | 0.5 | 0.010 | 0.5 | 0.00094 |
| WB|WBGene00004944 sol-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 136 (52.9 bits), Expect = 3.5e-08, P = 3.5e-08
Identities = 25/47 (53%), Positives = 32/47 (68%)
Query: 2 FNSTGGHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFD 48
FNS+ H NG S N+PGLYPR+ C Y F+GRND+ + + FE FD
Sbjct: 439 FNSSE-HTNGKLWSANYPGLYPRNLYCEYIFHGRNDQVVHIHFEYFD 484
|
|
| FB|FBgn0261262 CG42613 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:3045328 Cdcp2 "CUB domain containing protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5VXM1 CDCP2 "CUB domain-containing protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MKV7 CUBN "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 76 | |||
| smart00042 | 102 | smart00042, CUB, Domain first found in C1r, C1s, u | 4e-09 | |
| cd00041 | 113 | cd00041, CUB, CUB domain; extracellular domain; pr | 6e-09 | |
| pfam00431 | 110 | pfam00431, CUB, CUB domain | 5e-07 |
| >gnl|CDD|214483 smart00042, CUB, Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein | Back alignment and domain information |
|---|
Score = 48.2 bits (115), Expect = 4e-09
Identities = 16/38 (42%), Positives = 21/38 (55%)
Query: 11 GTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFD 48
GT TSPN+P YP + +C + RI+L F FD
Sbjct: 1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFD 38
|
This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain. Length = 102 |
| >gnl|CDD|238001 cd00041, CUB, CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast | Back alignment and domain information |
|---|
| >gnl|CDD|215916 pfam00431, CUB, CUB domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 76 | |||
| smart00042 | 102 | CUB Domain first found in C1r, C1s, uEGF, and bone | 99.5 | |
| PF00431 | 110 | CUB: CUB domain CUB domain entry Spermadhesins fam | 99.49 | |
| cd00041 | 113 | CUB CUB domain; extracellular domain; present in p | 99.48 | |
| KOG4292|consensus | 454 | 98.75 | ||
| KOG4586|consensus | 156 | 98.06 | ||
| KOG4292|consensus | 454 | 97.73 | ||
| PF02408 | 120 | CUB_2: CUB-like domain; InterPro: IPR003366 This d | 94.63 |
| >smart00042 CUB Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein | Back alignment and domain information |
|---|
Probab=99.50 E-value=1.3e-13 Score=80.72 Aligned_cols=56 Identities=30% Similarity=0.513 Sum_probs=46.7
Q ss_pred eEEECCCCCCCCCCCceeEEEEEeCCCceEEEEEeEEEeCccccCCCcCCCCcceEEEeEEec
Q psy3386 11 GTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCL 73 (76)
Q Consensus 11 G~i~SP~yP~~Yp~~~~C~W~I~~~~g~~I~L~F~~f~le~~~~~~~~C~~c~~~~i~~~~~~ 73 (76)
|.|.||+||..||++..|.|.|+++++.+|.|+|+.|+|+. .. .|..+.+...++.
T Consensus 1 G~i~Sp~yP~~y~~~~~C~w~i~~~~g~~i~l~f~~~~l~~----~~---~C~~d~l~i~~g~ 56 (102)
T smart00042 1 GTITSPNYPQSYPNNLDCVWTIRAPPGYRIELQFTDFDLES----SD---NCEYDYVEIYDGP 56 (102)
T ss_pred CEEeCCCCCcCCCCCCcEEEEEECCCCeEEEEEEEEEeccC----CC---CeeEeEEEEEeCC
Confidence 78999999999999999999999999999999999999997 22 3554555554443
|
This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain. |
| >PF00431 CUB: CUB domain CUB domain entry Spermadhesins family entry Link to schematic domain picture by Peer Bork | Back alignment and domain information |
|---|
| >cd00041 CUB CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast | Back alignment and domain information |
|---|
| >KOG4292|consensus | Back alignment and domain information |
|---|
| >KOG4586|consensus | Back alignment and domain information |
|---|
| >KOG4292|consensus | Back alignment and domain information |
|---|
| >PF02408 CUB_2: CUB-like domain; InterPro: IPR003366 This domain is found in a family of hypothetical Caenorhabditis elegans proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 76 | |||
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 8e-10 | |
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 5e-08 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 1e-09 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 3e-09 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 4e-07 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 2e-06 | |
| 2wno_A | 149 | Tumor necrosis factor-inducible gene 6 protein; gl | 2e-09 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 2e-09 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 2e-08 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 3e-09 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 3e-09 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 3e-08 | |
| 3poj_A | 115 | Mannan-binding lectin serine protease 1; CUB domai | 6e-09 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 1e-08 | |
| 2qqm_A | 450 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 1e-08 | |
| 2qqo_A | 460 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 2e-08 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 4e-08 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 3e-07 | |
| 1spp_A | 109 | Major seminal plasma glycoprotein PSP-I; seminal p | 4e-05 | |
| 1sfp_A | 114 | ASFP; spermadhesin, bovine seminal plasma protein, | 3e-04 | |
| 1spp_B | 116 | Major seminal plasma glycoprotein PSP-II; seminal | 4e-04 |
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
Score = 51.9 bits (124), Expect = 8e-10
Identities = 14/40 (35%), Positives = 19/40 (47%)
Query: 9 RNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFD 48
G SP +P YP D+E + + RIKL F F+
Sbjct: 8 MFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFN 47
|
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 | Back alignment and structure |
|---|
| >2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 | Back alignment and structure |
|---|
| >3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A Length = 115 | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 | Back alignment and structure |
|---|
| >2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Length = 450 | Back alignment and structure |
|---|
| >2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Length = 460 | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 | Back alignment and structure |
|---|
| >1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 109 | Back alignment and structure |
|---|
| >1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 Length = 114 | Back alignment and structure |
|---|
| >1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 116 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 76 | |||
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 99.65 | |
| 2wno_A | 149 | Tumor necrosis factor-inducible gene 6 protein; gl | 99.65 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 99.64 | |
| 3poj_A | 115 | Mannan-binding lectin serine protease 1; CUB domai | 99.62 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 99.58 | |
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 99.55 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 99.54 | |
| 2qqo_A | 460 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 99.48 | |
| 2qqm_A | 450 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 99.48 | |
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 99.48 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 99.43 | |
| 4gz9_A | 577 | Neuropilin-1, A5 protein; multi-domain, cell-CELL | 99.4 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 99.39 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 99.36 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 99.35 | |
| 4gz9_A | 577 | Neuropilin-1, A5 protein; multi-domain, cell-CELL | 99.35 | |
| 1spp_A | 109 | Major seminal plasma glycoprotein PSP-I; seminal p | 99.28 | |
| 1spp_B | 116 | Major seminal plasma glycoprotein PSP-II; seminal | 99.28 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 99.24 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 99.23 | |
| 1sfp_A | 114 | ASFP; spermadhesin, bovine seminal plasma protein, | 99.22 |
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
Probab=99.65 E-value=4.2e-16 Score=97.43 Aligned_cols=58 Identities=24% Similarity=0.339 Sum_probs=49.0
Q ss_pred cccceEEECCCCCCCCCCCceeEEEEEeCCCceEEEEEeEEEeCccccCCCcCCCCcceEEEeEE
Q psy3386 7 GHRNGTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIK 71 (76)
Q Consensus 7 ~~~~G~i~SP~yP~~Yp~~~~C~W~I~~~~g~~I~L~F~~f~le~~~~~~~~C~~c~~~~i~~~~ 71 (76)
++..|.|+||+||..||++..|.|.|+++++++|+|+|.+|+||. .. .|..+.+..++
T Consensus 2 ~~~~G~i~SP~yP~~Yp~~~~C~w~I~~~~g~~I~l~f~~f~le~----~~---~C~~D~l~i~d 59 (159)
T 1nzi_A 2 PTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIEL----SE---NCAYDSVQIIS 59 (159)
T ss_dssp CCSEEEEECTTTTSCCCSSEEEEEEEECCTTEEEEEEEEEEECCC----CG---GGCSSEEEEEC
T ss_pred CCCCEEEECCCCccCCCCCCCEEEEEEeCCCCEEEEEEeEEEecC----CC---CCCCCEEEEEe
Confidence 467899999999999999999999999999999999999999997 23 45545554444
|
| >2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 | Back alignment and structure |
|---|
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A | Back alignment and structure |
|---|
| >4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H | Back alignment and structure |
|---|
| >1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 76 | ||||
| d1nzia1 | 117 | b.23.1.1 (A:1-117) Complement C1S component {Human | 9e-07 | |
| d1szba1 | 121 | b.23.1.1 (A:3-123) Mannose-binding protein associa | 2e-05 | |
| d2qqma3 | 108 | b.23.1.1 (A:156-263) Mannose-binding protein assoc | 7e-05 | |
| d1nt0a2 | 114 | b.23.1.1 (A:165-278) Mannose-binding protein assoc | 3e-04 |
| >d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
class: All beta proteins fold: CUB-like superfamily: Spermadhesin, CUB domain family: Spermadhesin, CUB domain domain: Complement C1S component species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.0 bits (95), Expect = 9e-07
Identities = 12/50 (24%), Positives = 16/50 (32%)
Query: 11 GTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCL 60
G SPN+P YP + E + I L F D +
Sbjct: 6 GEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSV 55
|
| >d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
| >d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 76 | |||
| d2qqma3 | 108 | Mannose-binding protein associated serine protease | 99.69 | |
| d1szba1 | 121 | Mannose-binding protein associated serine protease | 99.67 | |
| d1nzia1 | 117 | Complement C1S component {Human (Homo sapiens) [Ta | 99.67 | |
| d1nt0a2 | 114 | Mannose-binding protein associated serine protease | 99.55 | |
| d1sppb_ | 112 | Major seminal plasma glycoprotein PSP-II {Pig (Sus | 99.28 | |
| d1sppa_ | 109 | Major seminal plasma glycoprotein PSP-I {Pig (Sus | 99.21 | |
| d1sfpa_ | 111 | Acidic seminal fluid protein (ASFP) {Cow (Bos taur | 99.09 |
| >d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: CUB-like superfamily: Spermadhesin, CUB domain family: Spermadhesin, CUB domain domain: Mannose-binding protein associated serine protease 2, MASP2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69 E-value=4e-17 Score=94.54 Aligned_cols=62 Identities=29% Similarity=0.408 Sum_probs=49.5
Q ss_pred eEEECCCCCCCCCCCceeEEEEEeCCCceEEEEEeEEEeCccccCCCcCCCCcceEEEeEEec
Q psy3386 11 GTFTSPNFPGLYPRDTECHYFFYGRNDERIKLVFESFDDWWWIWLRQHCLGCKNFIIHSIKCL 73 (76)
Q Consensus 11 G~i~SP~yP~~Yp~~~~C~W~I~~~~g~~I~L~F~~f~le~~~~~~~~C~~c~~~~i~~~~~~ 73 (76)
|.|+||+||..||++..|.|.|+++++++|+|+|.+|+||... .......|..+.+..+.+.
T Consensus 1 G~i~SP~yP~~Y~~~~~C~w~I~~p~~~~I~l~f~~f~l~~~~-~~~~~~~C~~D~l~i~dg~ 62 (108)
T d2qqma3 1 GVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDS-NPPGGMFCRYDRLEIWDGF 62 (108)
T ss_dssp EEEECTTTTSCCCSSCEEEEEEECGGGCCEEEEEEEEECCCC-----CCCSSCSSEEEEESSS
T ss_pred CEEeCCCCCCCCCCCCeEEEEEEeCCCceeeeEEEEEEeeccc-ccccCCCccccEEEEEecc
Confidence 8999999999999999999999999999999999999998631 1223445776666665543
|
| >d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|