Psyllid ID: psy3400

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------
MATTTYLPASSVVASDLDGMNIVNTSIGYPSPRSVPDSGELKYQHHHHHHHHHQVPSSPSPNGHPVSLSAAHNPWVSLQPGAGADPWSSSMPGIHNHHHPHHHQQSPVDIKPPPDMHRTSHQHGGMGSPHSWHTPVVSSHYIPSGNSGAASPLQHHSAYHVNVMNGMLHHHQPSPQLHHSLRDIQAHSPSYSQSQHPDAPSGSEEDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVTVKGALETHFHKQPKPSAQEITTLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGPQDGMMEGQLGMHGYHHPDLHGSPMGPHSHSHSHSPPMLSPSHQSMQSHQLTAH
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHcccccHHHHHHHHHHcccccccHHHHHHHHHccccHHHHHHcHHHHHHHHHHHcccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHEccccHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccHHcccccccccccEHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHEEHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccc
matttylpassvvasdldgmnivntsigypsprsvpdsgelkyqhhhhhhhhhqvpsspspnghpvslsaahnpwvslqpgagadpwsssmpgihnhhhphhhqqspvdikpppdmhrtshqhggmgsphswhtpvvsshyipsgnsgaasplqhhSAYHVNVMngmlhhhqpspqlhhslrdiqahspsysqsqhpdapsgseedaptsdDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEeadsttgsptsIDKIAAQGRKRKKRTSIEVTVKGALEthfhkqpkpsaqEITTLADSLQLEKEVVRVWFCNrrqkekrmtppntlggpqdgmmegqlgmhgyhhpdlhgspmgphshshshsppmlspshqsmqshqltah
matttylpassvvasdldgMNIVNTSIGYPSPRSVPDSGELKYQHHHHHHHHHQVPSSPSPNGHPVSLSAAHNPWVSLQPGAGADPWSSSMPGIHNHHHPHHHQQSPVDIKPPPDMHRTSHQHGGMGSPHSWHTPVVSSHYIPSGNSGAASPLQHHSAYHVNVMNGMLHHHQPSPQLHHSLRDIQAHSPSYSQSQHPDAPSGSEEDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEeadsttgsptsidkiaaqgrkrkkrtsiEVTVKGalethfhkqpkpsaqEITTLADSLQLEKEVVRVWFCnrrqkekrmtppntlggpqDGMMEGQLGMHGYHHPDLHGSPMGPHSHSHSHSPPMLSPSHQSMQSHQLTAH
MATTTYLPASSVVASDLDGMNIVNTSIGYPSPRSVPDSGELKYQhhhhhhhhhQVPSSPSPNGHPVSLSAAHNPWVSLQPGAGADPWSSSMPGIhnhhhphhhQQSPVDIKPPPDMHRTSHQHGGMGSPHSWHTPVVSSHYIPSGNSGAASPLQHHSAYHVNVMNGMlhhhqpspqlhhslRDIQAHSPSYSQSQHPDAPSGSEEDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVTVKGALETHFHKQPKPSAQEITTLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGPQDGMMEGQLGMHGYHHPDlhgspmgphshshshsppmlspshqsmqshqlTAH
*********************IV***************************************************************************************************************************************YHVNV******************************************************KQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLE****************************************************TLADSLQLEKEVVRVWFCN**********************************************************************
***********************************************************************************************************************************************************************************************************************FAKQFKQRRIKLGFTQADVGLALGTL*********************NMCKLKPLLQKWLEEADSTT*********************IEVTVKGALETHFHKQPKPSAQEITTLADSLQLEKEVVRVWFCN**********************************************************************
********ASSVVASDLDGMNIVNTSIGYPSP*********************************VSLSAAHNPWVSLQPGAGADPWSSSMPGIHN*************IKPPP***************HSWHTPVVSSHYIPSGNSGAASPLQHHSAYHVNVMNGMLHHHQPSPQLHHSLRDIQ************************SDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLE*********TSIDKI***********SIEVTVKGALETHFHKQPKPSAQEITTLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGPQDGMMEGQLGMHGYHHPDLHGS*******************************
**************************************************************************************WSSSM**IHNHHHPH********IKPPPDMHRTSHQHGGMGSPHSWHTPVVSSHYIPSGNSGAASPLQHHSAYHVNVMNGMLHHHQPS**********************************TSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAD*********************RTSIEVTVKGALETHFHKQPKPSAQEITTLADSLQLEKEVVRVWFCNRRQKEK****************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATTTYLPASSVVASDLDGMNIVNTSIGYPSPRSVPDSGELKYQHHHHHHHHHQVPSSPSPNGHPVSLSAAHNPWVSLQPGAGADPWSSSMPGIHNHHHPHHHQQSPVDIKPPPDMHRTSHQHGGMGSPHSWHTPVVSSHYIPSGNSGAASPLQHHSAYHVNVMNGMLHHHQPSPQLHHSLRDIQAHSPSYSQSQHPDAPSGSEEDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVTVKGALETHFHKQPKPSAQEITTLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGPQDGMMEGQLGMHGYHHPDLHGSPMGPHSHSHSHSPPMLSPSHQSMQSHQLTAH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query417 2.2.26 [Sep-21-2011]
P16241427 POU domain protein CF1A O no N/A 0.940 0.918 0.610 1e-114
Q17237351 Silk gland factor 3 OS=Bo N/A N/A 0.829 0.985 0.590 1e-105
Q561L5375 POU domain, class 3, tran N/A N/A 0.681 0.757 0.609 9e-85
P56224438 POU domain, class 3, tran yes N/A 0.393 0.374 0.902 9e-85
Q4QQQ7375 POU domain, class 3, tran yes N/A 0.676 0.752 0.609 1e-84
P20264500 POU domain, class 3, tran yes N/A 0.376 0.314 0.929 6e-84
Q63262497 POU domain, class 3, tran yes N/A 0.376 0.315 0.929 7e-84
P31361497 POU domain, class 3, tran yes N/A 0.376 0.315 0.929 7e-84
P79745443 POU domain, class 3, tran no N/A 0.393 0.370 0.896 8e-84
P31360445 POU domain, class 3, tran no N/A 0.601 0.564 0.617 1e-83
>sp|P16241|CF1A_DROME POU domain protein CF1A OS=Drosophila melanogaster GN=vvl PE=2 SV=5 Back     alignment and function desciption
 Score =  412 bits (1059), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 276/452 (61%), Positives = 297/452 (65%), Gaps = 60/452 (13%)

Query: 1   MATTTYLPASSVVASDLDGMNIVNTSIGYPSPRSVPDSGELKYQHHHHHHHHH------- 53
           MA T+Y+   S    DLD M +        SPRS  D+GE+KY  HHHHHH         
Sbjct: 1   MAATSYMTPPS---GDLD-MALGGGGYHTSSPRSAADAGEMKYMQHHHHHHAAAAAAAHH 56

Query: 54  QVPSSPSPNGHPVSLSAAHNP------WVSLQPGAGADPWSSSMPGIHNHHHPHHHQQSP 107
           Q+PSSPSPNG                 W +L P    DPW   M   H HH P     + 
Sbjct: 57  QLPSSPSPNGQGNGGGLGLGSGSGLGSWSALHP----DPW---MQTHHTHHLPAAAAVAS 109

Query: 108 VDIKPPPDMHRTSHQ---HGGMGSPHS-WHTPVVSSHYIPSGNSGAASPLQHHSAYHVNV 163
                  +M   S Q     GM SPH+ WH P  + HY P+G     SPLQ+H A     
Sbjct: 110 AADTVKQEMSHLSQQTRIQQGMASPHAAWHAPH-AGHYAPTG----GSPLQYHHA----- 159

Query: 164 MNGMLHHH---------QPSPQLHHSLRDI--QAHSPSYSQSQHPDAPSGSEEDAPTSDD 212
           MNGMLHH          Q    LHH+LR    Q H   +      DA SG EED PTSDD
Sbjct: 160 MNGMLHHPAHAVAAAHHQSVAPLHHTLRGESPQLHIHHHMGGGDRDAISGGEEDTPTSDD 219

Query: 213 LEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQ 272
           LEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQ
Sbjct: 220 LEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQ 279

Query: 273 KWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVTVKGALETHFHKQPKPSAQEITTLAD 332
           KWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEV+VKGALE HFHKQPKPSAQEIT+LAD
Sbjct: 280 KWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLAD 339

Query: 333 SLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGP-QDGMMEGQLGMHGYH-HPDLHGSPMGP 390
           SLQLEKEVVRVWFCNRRQKEKRMTPPNTLGG   DGM  G +   GYH H D+HGSPMG 
Sbjct: 340 SLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMPPGHMHHGGYHPHHDMHGSPMG- 398

Query: 391 HSHSHSHSPPMLSPSHQSMQS-----HQLTAH 417
            +HSHSHSPPMLSP  Q+MQS     HQL AH
Sbjct: 399 -THSHSHSPPMLSP--QNMQSSAVAAHQLAAH 427
Binds to a DNA sequence element required for the expression of the dopa decarboxylase gene (Ddc) in specific dopaminergic neurons. Could also play an early role in specific ectodermal cells, and a subsequent role in the embryonic nervous system.
Drosophila melanogaster (taxid: 7227)
>sp|Q17237|SGF3_BOMMO Silk gland factor 3 OS=Bombyx mori GN=SGF3 PE=2 SV=1 Back     alignment and function description
>sp|Q561L5|P3F1B_XENLA POU domain, class 3, transcription factor 1-B OS=Xenopus laevis GN=pou3f1-b PE=2 SV=1 Back     alignment and function description
>sp|P56224|P3F3A_DANRE POU domain, class 3, transcription factor 3-A OS=Danio rerio GN=pou3f3a PE=2 SV=2 Back     alignment and function description
>sp|Q4QQQ7|PO3F1_XENTR POU domain, class 3, transcription factor 1 OS=Xenopus tropicalis GN=pou3f1 PE=2 SV=1 Back     alignment and function description
>sp|P20264|PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens GN=POU3F3 PE=2 SV=2 Back     alignment and function description
>sp|Q63262|PO3F3_RAT POU domain, class 3, transcription factor 3 OS=Rattus norvegicus GN=Pou3f3 PE=1 SV=2 Back     alignment and function description
>sp|P31361|PO3F3_MOUSE POU domain, class 3, transcription factor 3 OS=Mus musculus GN=Pou3f3 PE=2 SV=2 Back     alignment and function description
>sp|P79745|P3F3B_DANRE POU domain, class 3, transcription factor 3-B OS=Danio rerio GN=pou3f3b PE=1 SV=1 Back     alignment and function description
>sp|P31360|PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus GN=Pou3f2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
225543476400 ventral vein lacking [Tribolium castaneu 0.935 0.975 0.718 1e-138
224459192400 ventral vein lacking [Tribolium castaneu 0.935 0.975 0.709 1e-134
332022106451 POU domain protein CF1A [Acromyrmex echi 0.954 0.882 0.648 1e-131
322784933452 hypothetical protein SINV_04369 [Solenop 0.954 0.880 0.645 1e-131
307182763451 POU domain protein CF1A [Camponotus flor 0.954 0.882 0.648 1e-131
307203991454 POU domain protein CF1A [Harpegnathos sa 0.956 0.878 0.633 1e-130
340719390487 PREDICTED: POU domain protein CF1A-like 0.952 0.815 0.615 1e-122
66517328460 PREDICTED: POU domain protein CF1A-like 0.940 0.852 0.630 1e-121
328705527439 PREDICTED: POU domain protein CF1A-like 0.916 0.870 0.630 1e-119
28317002427 RE27192p [Drosophila melanogaster] 0.940 0.918 0.612 1e-115
>gi|225543476|ref|NP_001139385.1| ventral vein lacking [Tribolium castaneum] gi|270008227|gb|EFA04675.1| ventral veins lacking [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  497 bits (1279), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 307/427 (71%), Positives = 330/427 (77%), Gaps = 37/427 (8%)

Query: 1   MATTTYLPASSVVASDLD-GMNIVNTSIGYPSPRSVPDSGELKYQHHHHHHHHHQVPSSP 59
           MA TTYLPASS V++DLD GMNIV       SPRS  D+ E+KY   HHHHH+H + SSP
Sbjct: 1   MAATTYLPASSAVSADLDVGMNIVGGYHASASPRSAADANEMKYLPQHHHHHNHHMASSP 60

Query: 60  SPNGHP-VSLSAAHNPWVSLQPGAGADPWSSSMPGIHNHHHPHHHQQSPVDIKPPPD--M 116
           SP GH  VSLSAA NPWVSLQPGA  DPW++SM G+H+HHH  H      D+KP     M
Sbjct: 61  SPGGHAAVSLSAA-NPWVSLQPGA--DPWAASMAGMHHHHHHPHQ-----DVKPLQQDMM 112

Query: 117 HRTSHQHGGMGSPHSWHTPVVSSHYIPSGNSGAASPLQHHSAYHVNVMNGMLHHHQPSPQ 176
           H    Q   MGSPH WH PV S+HY P+G   A SPLQ    YH   MNGML HHQ +PQ
Sbjct: 113 HHRQQQQQSMGSPH-WHAPVSSAHYNPAG---AGSPLQQ---YHA-AMNGMLAHHQGAPQ 164

Query: 177 LHHSL-RDIQAHSPSYSQSQHPDAPSGSEEDAPTSDDLEAFAKQFKQRRIKLGFTQADVG 235
           LHH L RD+Q  SP + Q    D  SG E++ PTSDDLEAFAKQFKQRRIKLGFTQADVG
Sbjct: 165 LHHPLHRDMQ--SPHHPQHSDRDV-SGGEDETPTSDDLEAFAKQFKQRRIKLGFTQADVG 221

Query: 236 LALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQG 295
           LALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQG
Sbjct: 222 LALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQG 281

Query: 296 RKRKKRTSIEVTVKGALETHFHKQPKPSAQEITTLADSLQLEKEVVRVWFCNRRQKEKRM 355
           RKRKKRTSIEV+VKGALE HFHKQPKPSAQEI++LADSLQLEKEVVRVWFCNRRQKEKRM
Sbjct: 282 RKRKKRTSIEVSVKGALEQHFHKQPKPSAQEISSLADSLQLEKEVVRVWFCNRRQKEKRM 341

Query: 356 TPPNTLGGPQDGMMEGQ-LGMH---GY-HHPDLHGSPMGPHSHSHSHSPPMLSPSHQSMQ 410
           TPPNTLG   + MMEG   G H   GY HHPD+HGSPMG   HSHSHSPPMLSP  Q M 
Sbjct: 342 TPPNTLG---NEMMEGMPPGSHMHPGYGHHPDMHGSPMG--QHSHSHSPPMLSP--QGM- 393

Query: 411 SHQLTAH 417
            HQLTAH
Sbjct: 394 GHQLTAH 400

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|224459192|gb|ACN43331.1| ventral vein lacking [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332022106|gb|EGI62428.1| POU domain protein CF1A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322784933|gb|EFZ11704.1| hypothetical protein SINV_04369 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307182763|gb|EFN69886.1| POU domain protein CF1A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307203991|gb|EFN82895.1| POU domain protein CF1A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340719390|ref|XP_003398137.1| PREDICTED: POU domain protein CF1A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|66517328|ref|XP_393686.2| PREDICTED: POU domain protein CF1A-like [Apis mellifera] gi|380017793|ref|XP_003692829.1| PREDICTED: POU domain protein CF1A-like [Apis florea] Back     alignment and taxonomy information
>gi|328705527|ref|XP_003242837.1| PREDICTED: POU domain protein CF1A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|28317002|gb|AAO39521.1| RE27192p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
FB|FBgn0086680427 vvl "ventral veins lacking" [D 0.872 0.852 0.557 1.3e-98
UNIPROTKB|J9P094322 POU3F2 "Uncharacterized protei 0.426 0.552 0.845 1.9e-81
UNIPROTKB|P20265443 POU3F2 "POU domain, class 3, t 0.426 0.401 0.845 1.9e-81
UNIPROTKB|F1RXY6442 POU3F2 "Uncharacterized protei 0.426 0.402 0.845 1.9e-81
MGI|MGI:101895445 Pou3f2 "POU domain, class 3, t 0.426 0.4 0.845 1.9e-81
RGD|61946445 Pou3f2 "POU class 3 homeobox 2 0.426 0.4 0.839 4e-81
ZFIN|ZDB-GENE-980526-370378 pou3f2 "POU class 3 homeobox 2 0.726 0.801 0.573 6.6e-81
UNIPROTKB|F1P840456 POU3F1 "Uncharacterized protei 0.436 0.399 0.790 8.2e-81
ZFIN|ZDB-GENE-980526-139337 brn1.2 "brain POU domain gene 0.453 0.560 0.798 2.2e-78
ZFIN|ZDB-GENE-980526-220438 pou3f3a "POU class 3 homeobox 0.436 0.415 0.822 1.2e-77
FB|FBgn0086680 vvl "ventral veins lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 979 (349.7 bits), Expect = 1.3e-98, P = 1.3e-98
 Identities = 228/409 (55%), Positives = 252/409 (61%)

Query:     1 MATTTYLPASSVVASDLDGMNIVNTSIGYPSPRSVPDSGELKYQ-------XXXXXXXXX 53
             MA T+Y+   S    DLD M +        SPRS  D+GE+KY                 
Sbjct:     1 MAATSYMTPPS---GDLD-MALGGGGYHTSSPRSAADAGEMKYMQHHHHHHAAAAAAAHH 56

Query:    54 QVPSSPSPNGHP----VSLSAAHN--PWVSLQPGAGADPWSSSMPGIXXXXXXXXXQQSP 107
             Q+PSSPSPNG      + L +      W +L P    DPW  +               + 
Sbjct:    57 QLPSSPSPNGQGNGGGLGLGSGSGLGSWSALHP----DPWMQTHHTHHLPAAAAVASAAD 112

Query:   108 VDIKPPPDMHRTSHQHGGMGSPHS-WHTPVVSSHYIPSGNSGAASPLQHHSAYHVNVMNG 166
                +    + + +    GM SPH+ WH P  + HY P+G S    PLQ+H A     MNG
Sbjct:   113 TVKQEMSHLSQQTRIQQGMASPHAAWHAPH-AGHYAPTGGS----PLQYHHA-----MNG 162

Query:   167 M------XXXXXXXXXXXXXXRDIQAHSPSYSQSQHP-----DAPSGSEEDAPTSDDLEA 215
             M                      ++  SP      H      DA SG EED PTSDDLEA
Sbjct:   163 MLHHPAHAVAAAHHQSVAPLHHTLRGESPQLHIHHHMGGGDRDAISGGEEDTPTSDDLEA 222

Query:   216 FAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWL 275
             FAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWL
Sbjct:   223 FAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWL 282

Query:   276 EEADSTTGSPTSIDKIAAQGRKRKKRTSIEVTVKGALETHFHKQPKPSAQEITTLADSLQ 335
             EEADSTTGSPTSIDKIAAQGRKRKKRTSIEV+VKGALE HFHKQPKPSAQEIT+LADSLQ
Sbjct:   283 EEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQ 342

Query:   336 LEKEVVRVWFCNRRQKEKRMTPPNTLGGPQ-DGMMEGQLGMHGYH-HPD 382
             LEKEVVRVWFCNRRQKEKRMTPPNTLGG   DGM  G +   GYH H D
Sbjct:   343 LEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMPPGHMHHGGYHPHHD 391
GO:0007422 "peripheral nervous system development" evidence=IMP;TAS
GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA;IMP
GO:0005634 "nucleus" evidence=ISS;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=NAS
GO:0003677 "DNA binding" evidence=NAS
GO:0007425 "epithelial cell fate determination, open tracheal system" evidence=TAS
GO:0048813 "dendrite morphogenesis" evidence=TAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=TAS
GO:0008045 "motor neuron axon guidance" evidence=IMP
GO:0007420 "brain development" evidence=IMP
GO:0035284 "brain segmentation" evidence=IMP
GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IDA
GO:0000980 "RNA polymerase II distal enhancer sequence-specific DNA binding" evidence=IDA
GO:0048814 "regulation of dendrite morphogenesis" evidence=IMP
UNIPROTKB|J9P094 POU3F2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P20265 POU3F2 "POU domain, class 3, transcription factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RXY6 POU3F2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:101895 Pou3f2 "POU domain, class 3, transcription factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61946 Pou3f2 "POU class 3 homeobox 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-370 pou3f2 "POU class 3 homeobox 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P840 POU3F1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-139 brn1.2 "brain POU domain gene 1.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-220 pou3f3a "POU class 3 homeobox 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q29087PO3F3_PIGNo assigned EC number0.91600.31411.0noN/A
Q4QQQ7PO3F1_XENTRNo assigned EC number0.60910.67620.752yesN/A
Q812B1PO3F4_MESAUNo assigned EC number0.91020.37410.4321N/AN/A
Q17237SGF3_BOMMONo assigned EC number0.59000.82970.9857N/AN/A
P49335PO3F4_HUMANNo assigned EC number0.90380.37410.4321noN/A
P62515PO3F4_MOUSENo assigned EC number0.91020.37410.4321noN/A
P62516PO3F4_RATNo assigned EC number0.91020.37410.4321noN/A
P20268HM06_CAEELNo assigned EC number0.77160.37880.4157yesN/A
P16241CF1A_DROMENo assigned EC number0.61060.94000.9180noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
smart0035275 smart00352, POU, Found in Pit-Oct-Unc transcriptio 8e-53
pfam0015775 pfam00157, Pou, Pou domain - N-terminal to homeobo 4e-50
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-22
smart0038957 smart00389, HOX, Homeodomain 1e-18
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 6e-18
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-07
pfam1356063 pfam13560, HTH_31, Helix-turn-helix domain 0.004
>gnl|CDD|197673 smart00352, POU, Found in Pit-Oct-Unc transcription factors Back     alignment and domain information 
 Score =  170 bits (432), Expect = 8e-53
 Identities = 64/75 (85%), Positives = 67/75 (89%)

Query: 205 EDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 264
           +D     +LEAFAKQFKQRRIKLGFTQADVGLALG LYG  FSQTTICRFEALQLSFKNM
Sbjct: 1   DDDTDPRELEAFAKQFKQRRIKLGFTQADVGLALGALYGPAFSQTTICRFEALQLSFKNM 60

Query: 265 CKLKPLLQKWLEEAD 279
           CKLKPLLQKWLEEA+
Sbjct: 61  CKLKPLLQKWLEEAE 75

Length = 75
>gnl|CDD|189427 pfam00157, Pou, Pou domain - N-terminal to homeobox domain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|222221 pfam13560, HTH_31, Helix-turn-helix domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 417
KOG3802|consensus398 100.0
KOG1168|consensus385 100.0
PF0015775 Pou: Pou domain - N-terminal to homeobox domain; I 99.95
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 99.86
KOG2252|consensus558 99.77
KOG0489|consensus261 99.73
KOG0487|consensus308 99.69
KOG0848|consensus317 99.69
KOG0488|consensus309 99.67
KOG0842|consensus307 99.67
KOG0850|consensus245 99.66
KOG0484|consensus125 99.62
KOG2251|consensus228 99.61
KOG0843|consensus197 99.6
KOG0485|consensus268 99.6
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.57
KOG0492|consensus246 99.56
KOG0494|consensus332 99.54
KOG4577|consensus383 99.52
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.45
KOG0844|consensus 408 99.44
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.44
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.44
COG5576156 Homeodomain-containing transcription factor [Trans 99.44
KOG0491|consensus194 99.41
KOG0775|consensus304 99.41
KOG0493|consensus342 99.38
KOG0486|consensus 351 99.35
KOG0483|consensus198 99.26
KOG0847|consensus288 99.2
KOG0490|consensus235 99.14
KOG0849|consensus354 98.92
KOG0774|consensus334 98.51
KOG0490|consensus235 98.34
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.25
KOG1146|consensus 1406 97.88
KOG0773|consensus342 96.1
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.69
KOG3623|consensus 1007 95.29
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 94.16
COG3620187 Predicted transcriptional regulator with C-termina 93.57
PF1356064 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_ 92.53
KOG3623|consensus 1007 91.3
TIGR0307058 couple_hipB transcriptional regulator, y4mF family 90.13
PHA0197667 helix-turn-helix protein 88.46
TIGR00270154 conserved hypothetical protein TIGR00270. 85.6
PRK06424144 transcription factor; Provisional 85.16
PRK10856 331 cytoskeletal protein RodZ; Provisional 84.48
PRK0972688 antitoxin HipB; Provisional 82.19
TIGR03830127 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-he 82.09
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 80.16
PF1374480 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_ 80.02
>KOG3802|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.8e-58  Score=460.15  Aligned_cols=166  Identities=79%  Similarity=1.206  Sum_probs=156.8

Q ss_pred             CCCCCCCCCCChHHHHHHHHHHHhhhhhhccchhhhhhhhhcccccccccccccchhcccCChhhhhhcchhHHHHHHhh
Q psy3400         199 APSGSEEDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEA  278 (417)
Q Consensus       199 ~~s~~~~d~~~~~ele~Fak~fK~rRI~lG~TQ~dVg~aLg~l~g~~~SQtTI~RFE~lqLS~knm~kLkPlLqkWLeEa  278 (417)
                      ..+.++||..++||||+|||+||+|||+|||||+|||++||++||++||||||||||+|+|||||||||||+|+|||+|+
T Consensus       194 ~~~~~~ed~~~leELEqFAK~FKqRRIkLGfTQaDVGlALG~lyGn~FSQTTIcRFEALqLSFKNMCKLKPLL~KWLeEA  273 (398)
T KOG3802|consen  194 ATEPSDEDTPDLEELEQFAKTFKQRRIKLGFTQADVGLALGALYGNVFSQTTICRFEALQLSFKNMCKLKPLLEKWLEEA  273 (398)
T ss_pred             CCCCCcccccCHHHHHHHHHHHHhheeccccchhHHHHHHHhhhCcccchhhhhHhHhhccCHHHHhhhHHHHHHHHHHH
Confidence            45567899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hc--CCCCCCchhHHhhcCCCCCCCceechhhHHHHhhhccCCCCCCHHHHHHHHHHcCCCCCchhcccchhhhhhhccC
Q psy3400         279 DS--TTGSPTSIDKIAAQGRKRKKRTSIEVTVKGALETHFHKQPKPSAQEITTLADSLQLEKEVVRVWFCNRRQKEKRMT  356 (417)
Q Consensus       279 e~--~~~s~~s~~~~~~~~kkRRkRT~fT~~Ql~~LE~~F~~n~yPS~~er~eLA~~LgLs~~qVqVWFQNRR~K~KR~~  356 (417)
                      |.  +.+..++++++..+.|||||||+|+...+..||+.|.+|++|+.+||..||++|+|+++||||||||||+|+||.+
T Consensus       274 es~~~~~~~~~~e~i~a~~RkRKKRTSie~~vr~aLE~~F~~npKPt~qEIt~iA~~L~leKEVVRVWFCNRRQkeKR~~  353 (398)
T KOG3802|consen  274 ESRESTGSPNSIEKIGAQSRKRKKRTSIEVNVRGALEKHFLKNPKPTSQEITHIAESLQLEKEVVRVWFCNRRQKEKRIT  353 (398)
T ss_pred             hcccccCCCCCHHHhhccccccccccceeHHHHHHHHHHHHhCCCCCHHHHHHHHHHhccccceEEEEeeccccccccCC
Confidence            98  6677889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCC
Q psy3400         357 PPNTLGGP  364 (417)
Q Consensus       357 ~~~~~g~p  364 (417)
                      +....+.|
T Consensus       354 ~~~~~~~P  361 (398)
T KOG3802|consen  354 PFPSAGSP  361 (398)
T ss_pred             CCccCCCC
Confidence            84434433

>KOG1168|consensus Back     alignment and domain information
>PF00157 Pou: Pou domain - N-terminal to homeobox domain; InterPro: IPR000327 POU proteins are eukaryotic transcription factors containing a bipartite DNA binding domain referred to as the POU domain Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>PF13560 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>TIGR00270 conserved hypothetical protein TIGR00270 Back     alignment and domain information
>PRK06424 transcription factor; Provisional Back     alignment and domain information
>PRK10856 cytoskeletal protein RodZ; Provisional Back     alignment and domain information
>PRK09726 antitoxin HipB; Provisional Back     alignment and domain information
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PF13744 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
2xsd_C164 Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou 3e-80
1cqt_A163 Crystal Structure Of A Ternary Complex Containing A 1e-52
1oct_C156 Crystal Structure Of The Oct-1 Pou Domain Bound To 2e-51
1o4x_A167 Ternary Complex Of The Dna Binding Domains Of The O 5e-51
1hf0_A159 Crystal Structure Of The Dna-Binding Domain Of Oct- 1e-48
1e3o_C160 Crystal Structure Of Oct-1 Pou Dimer Bound To More 8e-48
1au7_A146 Pit-1 MutantDNA COMPLEX Length = 146 2e-47
3l1p_A155 Pou Protein:dna Complex Length = 155 4e-46
1pou_A71 The Solution Structure Of The Oct-1 Pou-Specific Do 6e-28
3d1n_I151 Structure Of Human Brn-5 Transcription Factor In Co 5e-26
1pog_A67 Solution Structure Of The Oct-1 Pou-Homeo Domain De 2e-18
1hdp_A63 Solution Structure Of A Pou-Specific Homeodomain: 3 2e-17
1ocp_A67 Solution Structure Of Oct3 Pou-Homeodomain Length = 4e-16
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 1e-04
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 3e-04
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 3e-04
>pdb|2XSD|C Chain C, Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou Domain Bound To Palindromic More Dna Length = 164 Back     alignment and structure 
Iteration: 1

 Score =  295 bits (755), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 148/160 (92%)
Query: 203 SEEDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFK 262
           S+EDAP+SDDLE FAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFK
Sbjct: 5   SDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFK 64
Query: 263 NMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVTVKGALETHFHKQPKP 322
           NMCKLKPLL KWLEE DS++GSPT++DKIAAQGRKRKKRTSIEV VKGALE+HF K PKP
Sbjct: 65  NMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKP 124
Query: 323 SAQEITTLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLG 362
           SA EIT LADSLQLEKEVVRVWFCNRRQKEKRMTP    G
Sbjct: 125 SAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAG 164
>pdb|1CQT|A Chain A, Crystal Structure Of A Ternary Complex Containing An Oca-B Peptide, The Oct-1 Pou Domain, And An Octamer Element Length = 163 Back     alignment and structure
>pdb|1OCT|C Chain C, Crystal Structure Of The Oct-1 Pou Domain Bound To An Octamer Site: Dna Recognition With Tethered Dna-Binding Modules Length = 156 Back     alignment and structure
>pdb|1O4X|A Chain A, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 167 Back     alignment and structure
>pdb|1HF0|A Chain A, Crystal Structure Of The Dna-Binding Domain Of Oct-1 Bound To Dna As A Dimer Length = 159 Back     alignment and structure
>pdb|1E3O|C Chain C, Crystal Structure Of Oct-1 Pou Dimer Bound To More Length = 160 Back     alignment and structure
>pdb|1AU7|A Chain A, Pit-1 MutantDNA COMPLEX Length = 146 Back     alignment and structure
>pdb|3L1P|A Chain A, Pou Protein:dna Complex Length = 155 Back     alignment and structure
>pdb|1POU|A Chain A, The Solution Structure Of The Oct-1 Pou-Specific Domain Reveals A Striking Similarity To The Bacteriophage Lambda Repressor Dna-Binding Domain Length = 71 Back     alignment and structure
>pdb|3D1N|I Chain I, Structure Of Human Brn-5 Transcription Factor In Complex With Corticotrophin-Releasing Hormone Gene Promoter Length = 151 Back     alignment and structure
>pdb|1POG|A Chain A, Solution Structure Of The Oct-1 Pou-Homeo Domain Determined By Nmr And Restrained Molecular Dynamics Length = 67 Back     alignment and structure
>pdb|1HDP|A Chain A, Solution Structure Of A Pou-Specific Homeodomain: 3d-Nmr Studies Of Human B-Cell Transcription Factor Oct-2 Length = 63 Back     alignment and structure
>pdb|1OCP|A Chain A, Solution Structure Of Oct3 Pou-Homeodomain Length = 67 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-78
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-77
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 1e-71
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-70
3d1n_I151 POU domain, class 6, transcription factor 1; prote 8e-66
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-16
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-14
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-11
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 4e-11
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 5e-11
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 5e-11
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 7e-11
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 1e-10
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-10
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 4e-10
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 7e-10
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 8e-10
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 9e-10
2e19_A64 Transcription factor 8; homeobox domain, structura 1e-09
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 4e-09
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 5e-09
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 8e-09
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 9e-09
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 1e-08
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 1e-08
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-08
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 2e-08
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 5e-08
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 5e-08
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 7e-08
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 8e-08
3a01_A93 Homeodomain-containing protein; homeodomain, prote 4e-07
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 5e-07
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-06
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-06
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 3e-06
3ivp_A126 Putative transposon-related DNA-binding protein; A 4e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-05
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 2e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-05
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 6e-05
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 7e-05
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 7e-05
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 1e-04
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-04
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 1e-04
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 1e-04
3kxa_A141 NGO0477 protein, putative uncharacterized protein; 2e-04
2awi_A 317 PRGX; repressor, pheromone, DNA binding, regulator 3e-04
1lfb_A99 Liver transcription factor (LFB1); transcription r 3e-04
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 3e-04
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 5e-04
1uhs_A72 HOP, homeodomain only protein; structural genomics 5e-04
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 7e-04
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 8e-04
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
 Score =  239 bits (611), Expect = 1e-78
 Identities = 141/164 (85%), Positives = 148/164 (90%)

Query: 199 APSGSEEDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQ 258
               S+EDAP+SDDLE FAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQ
Sbjct: 1   GGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQ 60

Query: 259 LSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVTVKGALETHFHK 318
           LSFKNMCKLKPLL KWLEE DS++GSPT++DKIAAQGRKRKKRTSIEV VKGALE+HF K
Sbjct: 61  LSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLK 120

Query: 319 QPKPSAQEITTLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLG 362
            PKPSA EIT LADSLQLEKEVVRVWFCNRRQKEKRMTP    G
Sbjct: 121 CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAG 164
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} Length = 126 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Length = 83 Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Length = 141 Back     alignment and structure
>2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A Length = 317 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
2xsd_C164 POU domain, class 3, transcription factor 1; trans 100.0
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 100.0
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 100.0
3d1n_I151 POU domain, class 6, transcription factor 1; prote 100.0
1e3o_C160 Octamer-binding transcription factor 1; transcript 100.0
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.83
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.76
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.75
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.74
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.74
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.74
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.74
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.74
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.74
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.73
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.73
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.73
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.73
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.73
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.73
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.73
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.72
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.72
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.72
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.72
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.72
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.72
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.72
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.72
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.71
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.71
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.71
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.71
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.71
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.71
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.71
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.71
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.7
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.7
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.7
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.7
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.7
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.7
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.7
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.7
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.7
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.69
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.69
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.68
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.68
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.67
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.67
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.66
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.66
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.66
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.66
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.66
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.66
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.64
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.64
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.64
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.63
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.63
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.63
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.62
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.62
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.61
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.61
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.61
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.59
2e19_A64 Transcription factor 8; homeobox domain, structura 99.59
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.58
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.58
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.46
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.42
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.22
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.21
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.38
4ich_A311 Transcriptional regulator; structural genomics, PS 96.25
4ghj_A101 Probable transcriptional regulator; structural gen 95.57
3g5g_A99 Regulatory protein; transcriptional regulator, hel 93.61
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 93.48
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-t 93.37
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCS 93.27
3s8q_A82 R-M controller protein; protein-DNA complex, helix 93.15
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 93.1
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-bindin 92.64
3vk0_A114 NHTF, transcriptional regulator; HTH motif, XRE tr 92.34
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG 92.25
3qq6_A78 HTH-type transcriptional regulator SINR; helix-tur 92.2
3kz3_A80 Repressor protein CI; five helix bundle, DNA-bindi 92.17
2wiu_B88 HTH-type transcriptional regulator HIPB; transfera 91.8
2a6c_A83 Helix-turn-helix motif; putative transcriptional r 91.25
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 91.24
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1 91.14
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2 90.85
2wus_R112 RODZ, putative uncharacterized protein; structural 90.52
2k27_A159 Paired box protein PAX-8; paired domain, solution 90.51
1lmb_392 Protein (lambda repressor); protein-DNA complex, d 89.73
2o38_A120 Hypothetical protein; alpha-beta, helix-turn-helix 89.63
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-t 89.18
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 89.0
3ivp_A126 Putative transposon-related DNA-binding protein; A 88.8
1b0n_A111 Protein (SINR protein); transcription regulator, a 88.74
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B302 88.71
2k9q_A77 Uncharacterized protein; all helix, helix-turn-hel 88.46
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 88.3
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH- 88.08
1x57_A91 Endothelial differentiation-related factor 1; HMBF 87.88
3f52_A117 CLP gene regulator (CLGR); helix-turn-helix motif, 87.71
1adr_A76 P22 C2 repressor; transcription regulation; NMR {E 87.4
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 86.94
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding 86.27
3t76_A88 VANU, transcriptional regulator vanug; structural 86.14
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 86.01
1jhg_A101 Trp operon repressor; complex (regulatory protein- 85.9
3op9_A114 PLI0006 protein; structural genomics, PSI-2, prote 85.67
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 85.32
3mlf_A111 Transcriptional regulator; structural genomics, he 84.04
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, 83.38
3fym_A130 Putative uncharacterized protein; HTH DNA binding, 83.36
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 82.59
3lfp_A98 CSP231I C protein; transcriptional regulator, DNA 82.55
3kxa_A141 NGO0477 protein, putative uncharacterized protein; 82.15
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 81.21
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 80.53
3cec_A104 Putative antidote protein of plasmid maintenance; 80.49
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=3.9e-47  Score=345.63  Aligned_cols=157  Identities=89%  Similarity=1.306  Sum_probs=126.6

Q ss_pred             CCCCCCChHHHHHHHHHHHhhhhhhccchhhhhhhhhcccccccccccccchhcccCChhhhhhcchhHHHHHHhhhcCC
Q psy3400         203 SEEDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTT  282 (417)
Q Consensus       203 ~~~d~~~~~ele~Fak~fK~rRI~lG~TQ~dVg~aLg~l~g~~~SQtTI~RFE~lqLS~knm~kLkPlLqkWLeEae~~~  282 (417)
                      +++|.++++|||+||++||+|||+|||||+|||.+|+.+||+.|||+||||||+++|+++|||||+|+|++||+|++...
T Consensus         5 ~~~~~~~~~~l~~fa~~fk~~ri~lg~tQ~~vg~alg~l~g~~~Sqtti~rFE~l~ls~kn~~klkPlL~~wl~eae~~~   84 (164)
T 2xsd_C            5 SDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSS   84 (164)
T ss_dssp             ----CCCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHSCCCCHHHHHHHHTTCSBHHHHHHHHHHHHHHHHHHCC--
T ss_pred             ccccccchhHHHHHHHHHHHHHhhcCCcccccccccccccCCCcCcchhhhhhccCCCHHHHHHcchhHHHHHhhhcccc
Confidence            36788999999999999999999999999999999999999999999999999999999999999999999999999887


Q ss_pred             CCCCchhHHhhcCCCCCCCceechhhHHHHhhhccCCCCCCHHHHHHHHHHcCCCCCchhcccchhhhhhhccCCCC
Q psy3400         283 GSPTSIDKIAAQGRKRKKRTSIEVTVKGALETHFHKQPKPSAQEITTLADSLQLEKEVVRVWFCNRRQKEKRMTPPN  359 (417)
Q Consensus       283 ~s~~s~~~~~~~~kkRRkRT~fT~~Ql~~LE~~F~~n~yPS~~er~eLA~~LgLs~~qVqVWFQNRR~K~KR~~~~~  359 (417)
                      +.+...+.+...+++||+||+|+..|+.+||..|..++||+..+|++||.+|+|++++|+|||||||+|+||..+..
T Consensus        85 ~~~~~~~~~~~~~~~rr~Rt~ft~~Ql~~LE~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~kr~~~~~  161 (164)
T 2xsd_C           85 GSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAA  161 (164)
T ss_dssp             ---------------------CCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHTBSCC--
T ss_pred             CCCcccccccccccCCCCceeccHHHHHHHHHHHhcCCCCCHHHHHHHHHHHCCChhhhhhhhHHhhHHHhhccCCC
Confidence            77777777777788899999999999999999999999999999999999999999999999999999999987653
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} Back     alignment and structure
>4ghj_A Probable transcriptional regulator; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.75A {Vibrio vulnificus} Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomic binding; 1.80A {Silicibacter pomeroyi} Back     alignment and structure
>3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} Back     alignment and structure
>3vk0_A NHTF, transcriptional regulator; HTH motif, XRE transcription factor, DNA binding protein; 1.88A {Neisseria meningitidis} Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2wus_R RODZ, putative uncharacterized protein; structural protein, cell WALL morphogenesis, bacterial cytos bacterial actin; 2.90A {Thermotoga maritima} Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Back     alignment and structure
>2o38_A Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, PR structure initiative; 1.83A {Rhodopseudomonas palustris} SCOP: a.35.1.13 Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Back     alignment and structure
>3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional ACTI human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Back     alignment and structure
>3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>3cec_A Putative antidote protein of plasmid maintenance; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.60A {Nostoc punctiforme} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 417
d1e3oc275 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [Tax 7e-46
d1au7a272 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [ 8e-45
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 2e-17
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 9e-17
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 1e-16
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 4e-16
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 5e-16
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-15
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 7e-15
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-14
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-14
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 4e-14
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 1e-13
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-13
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-13
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 6e-13
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 7e-13
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 7e-13
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-12
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 5e-12
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 8e-12
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 1e-11
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-11
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-11
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 9e-11
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 1e-10
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-10
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 5e-10
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-08
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 4e-07
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-06
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 4e-06
d2b5aa177 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacil 0.003
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: POU-specific domain
domain: Oct-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  150 bits (381), Expect = 7e-46
 Identities = 55/75 (73%), Positives = 62/75 (82%)

Query: 205 EDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNM 264
           E+    ++LE FAK FKQRRIKLGFTQ DVGLA+G LYGN FSQTTI RFEAL LSFKNM
Sbjct: 1   EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNM 60

Query: 265 CKLKPLLQKWLEEAD 279
            KLKPLL+KWL +A+
Sbjct: 61  SKLKPLLEKWLNDAE 75
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 72 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Length = 77 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
d1e3oc275 Oct-1 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1au7a272 Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.95
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.78
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.78
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.77
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.76
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.76
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.75
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.75
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.75
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.74
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.74
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.74
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.73
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.73
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.72
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.72
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.72
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.72
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.71
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.69
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.68
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.67
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.67
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.64
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.62
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.62
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.58
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.55
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.54
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.53
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.5
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.47
d1y7ya169 Restriction-modification controller protein C.AhdI 94.45
d1lmb3_87 lambda C1 repressor, DNA-binding domain {Bacteriop 93.24
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 91.23
d2b5aa177 Regulatory protein C.BclI {Bacillus caldolyticus [ 91.08
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 90.74
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 90.57
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 90.5
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas pal 90.27
d1hlva166 DNA-binding domain of centromere binding protein B 90.18
d1x57a178 Endothelial differentiation-related factor 1, EDF1 88.83
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophag 88.26
d1s7ea280 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 87.66
d1y9qa179 Probable transcriptional regulator VC1968, N-termi 86.51
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subti 85.8
d1x2la187 Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens 85.74
d2r1jl166 P22 C2 repressor, DNA-binding domain {Salmonella b 83.52
d1wh6a_101 Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens 80.91
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: POU-specific domain
domain: Oct-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=1.4e-31  Score=210.23  Aligned_cols=75  Identities=73%  Similarity=1.149  Sum_probs=72.9

Q ss_pred             CCCCChHHHHHHHHHHHhhhhhhccchhhhhhhhhcccccccccccccchhcccCChhhhhhcchhHHHHHHhhh
Q psy3400         205 EDAPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAD  279 (417)
Q Consensus       205 ~d~~~~~ele~Fak~fK~rRI~lG~TQ~dVg~aLg~l~g~~~SQtTI~RFE~lqLS~knm~kLkPlLqkWLeEae  279 (417)
                      ||.++++|||+||++||+|||+|||||+|||.+|+.+||.+|||+||||||+++|||+|||||||+|++||+|+|
T Consensus         1 e~~~~l~Ele~Fa~~fk~rRi~LG~TQ~dVG~al~~l~g~~~SQttIcRFE~l~LS~kn~~kLkP~L~~WL~eaE   75 (75)
T d1e3oc2           1 EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAE   75 (75)
T ss_dssp             CCSCCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHSCCCCHHHHHHHHHTCSCHHHHHHHHHHHHHHHHHHC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHcCcchhHHHHHHHHHhccCHHHHHHHHHHHHHHHHhcC
Confidence            577889999999999999999999999999999999999999999999999999999999999999999999986
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1s7ea2 a.35.1.7 (A:6-85) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x2la1 a.35.1.7 (A:9-95) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d1wh6a_ a.35.1.7 (A:) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure