Psyllid ID: psy3448

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MNFSGLHILVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQQQIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFLFLNFLLHTIPGLILDGVASMFGKTPM
ccccccccEEEEEcccccccEEccccccHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccEEEEEccccccccHHHHHHcccccccccccccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccccEEEEEEEccccccccccEcccccccEEEEEccccEEEEEEcccccEEcEccHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
MNFSGLHILVVSTyrepvrgwidnvygpvglmVGIGTGVLHtyqydqdavtemvPVDMVVNSVIATAWYTAksnqqqipiynyvssvqkpvtWNEFLQHnikhghhwptIRAVWYYSFWPTKSRIMFLFLNFLLHTIPGLILDGVASMFGKTPM
MNFSGLHILVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQQQIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFLFLNFLLHTIPGLILDGVASMFGKTPM
MNFSGLHILVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQQQIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFLFLNFLLHTIPGLILDGVASMFGKTPM
****GLHILVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQQQIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFLFLNFLLHTIPGLILDGVASMF*****
***SGLHILVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQQQIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFLFLNFLLHTIPGLILDGVASMFGKTPM
MNFSGLHILVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQQQIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFLFLNFLLHTIPGLILDGVASMFGKTPM
*NFSGLHILVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQQQIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFLFLNFLLHTIPGLILDGVASMFGKTP*
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiii
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFSGLHILVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQQQIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFLFLNFLLHTIPGLILDGVASMFGKTPM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
A1ZAI5 625 Putative fatty acyl-CoA r no N/A 0.915 0.225 0.362 5e-23
Q922J9 515 Fatty acyl-CoA reductase yes N/A 0.941 0.281 0.310 3e-17
Q7ZXF5 515 Fatty acyl-CoA reductase N/A N/A 0.941 0.281 0.303 5e-17
Q5R834 515 Fatty acyl-CoA reductase yes N/A 0.941 0.281 0.310 7e-17
Q8WVX9 515 Fatty acyl-CoA reductase yes N/A 0.941 0.281 0.310 7e-17
Q5ZM72 515 Fatty acyl-CoA reductase yes N/A 0.941 0.281 0.310 2e-16
Q66H50 515 Fatty acyl-CoA reductase yes N/A 0.909 0.271 0.333 2e-15
Q960W6 516 Putative fatty acyl-CoA r no N/A 0.948 0.282 0.302 5e-15
Q0P5J1 515 Fatty acyl-CoA reductase no N/A 0.922 0.275 0.295 2e-13
Q7TNT2 515 Fatty acyl-CoA reductase no N/A 0.941 0.281 0.310 4e-13
>sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 Back     alignment and function desciption
 Score =  106 bits (265), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 54/149 (36%), Positives = 80/149 (53%), Gaps = 8/149 (5%)

Query: 9   LVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAW 68
           +V ++  EP  GW+DN  GP GL+  +  G+  T   +++ V +MVPVD+V+N +IA AW
Sbjct: 346 IVTASLNEPFAGWVDNFNGPTGLVSALAKGMFRTMMCEKNYVADMVPVDIVINLMIAAAW 405

Query: 69  YTAKSNQQQIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFL 128
            TA      + IYN  +  + P+ W+EF++H +      P    +WY    PT    M  
Sbjct: 406 RTATRKSNNLLIYNCCTGQRNPIIWSEFVKHAMTSVRKHPLEGCLWY----PTGDLRMNR 461

Query: 129 FLNFL----LHTIPGLILDGVASMFGKTP 153
            +N L     H +P  ILDGVA + GK P
Sbjct: 462 PMNTLNCIAKHFLPAYILDGVARIMGKKP 490
Catalyzes the reduction of saturated fatty acyl-CoA to fatty alcohols.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: nEC: 2
>sp|Q922J9|FACR1_MOUSE Fatty acyl-CoA reductase 1 OS=Mus musculus GN=Far1 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZXF5|FACR1_XENLA Fatty acyl-CoA reductase 1 OS=Xenopus laevis GN=far1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R834|FACR1_PONAB Fatty acyl-CoA reductase 1 OS=Pongo abelii GN=FAR1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WVX9|FACR1_HUMAN Fatty acyl-CoA reductase 1 OS=Homo sapiens GN=FAR1 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZM72|FACR1_CHICK Fatty acyl-CoA reductase 1 OS=Gallus gallus GN=FAR1 PE=2 SV=1 Back     alignment and function description
>sp|Q66H50|FACR1_RAT Fatty acyl-CoA reductase 1 OS=Rattus norvegicus GN=Far1 PE=2 SV=1 Back     alignment and function description
>sp|Q960W6|FACR3_DROME Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster GN=CG8306 PE=2 SV=1 Back     alignment and function description
>sp|Q0P5J1|FACR2_BOVIN Fatty acyl-CoA reductase 2 OS=Bos taurus GN=FAR2 PE=2 SV=1 Back     alignment and function description
>sp|Q7TNT2|FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus GN=Far2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
193622556 551 PREDICTED: putative fatty acyl-CoA reduc 0.948 0.264 0.551 8e-46
328720032 499 PREDICTED: putative fatty acyl-CoA reduc 0.948 0.292 0.547 5e-43
328720028 553 PREDICTED: putative fatty acyl-CoA reduc 0.948 0.264 0.540 8e-43
298402911 626 fatty-acyl CoA reductase 2 [Ostrinia nub 0.928 0.228 0.530 3e-41
345496232 566 PREDICTED: putative fatty acyl-CoA reduc 0.941 0.256 0.466 9e-35
156542672 543 PREDICTED: putative fatty acyl-CoA reduc 0.941 0.267 0.466 1e-34
195574617 517 GD18004 [Drosophila simulans] gi|1942012 0.941 0.280 0.420 8e-32
28572029 517 CG1443 [Drosophila melanogaster] gi|2143 0.941 0.280 0.420 9e-32
195503436 517 GE10485 [Drosophila yakuba] gi|194184752 0.941 0.280 0.413 1e-31
195341071 517 GM12273 [Drosophila sechellia] gi|194131 0.941 0.280 0.420 1e-31
>gi|193622556|ref|XP_001950244.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 81/147 (55%), Positives = 110/147 (74%), Gaps = 1/147 (0%)

Query: 9   LVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAW 68
           +V++TYREPVRGWIDNVYGP GL+VG GTGVLHTY  D + +T+M+PVDMVVN++I    
Sbjct: 285 VVIATYREPVRGWIDNVYGPTGLIVGAGTGVLHTYFGDSNIITDMIPVDMVVNALICATK 344

Query: 69  YTAKSNQQ-QIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMF 127
            TA +N+  +IPIY   S+ QKP+ WN+F++ N +HG +WPTIRA+WYYSFW T +   +
Sbjct: 345 ETATNNKDDEIPIYTCSSAAQKPIKWNDFIEMNRRHGIYWPTIRAIWYYSFWATNNPYFY 404

Query: 128 LFLNFLLHTIPGLILDGVASMFGKTPM 154
             LNF  H +PG +LD +A + G+ P+
Sbjct: 405 ALLNFFCHIVPGYLLDTLAVIAGQKPI 431

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328720032|ref|XP_001949806.2| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328720028|ref|XP_001946873.2| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|298402911|gb|ADI82775.1| fatty-acyl CoA reductase 2 [Ostrinia nubilalis] Back     alignment and taxonomy information
>gi|345496232|ref|XP_003427678.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156542672|ref|XP_001602734.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195574617|ref|XP_002105281.1| GD18004 [Drosophila simulans] gi|194201208|gb|EDX14784.1| GD18004 [Drosophila simulans] Back     alignment and taxonomy information
>gi|28572029|ref|NP_651652.2| CG1443 [Drosophila melanogaster] gi|21430520|gb|AAM50938.1| LP09631p [Drosophila melanogaster] gi|28381491|gb|AAF56838.2| CG1443 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195503436|ref|XP_002098651.1| GE10485 [Drosophila yakuba] gi|194184752|gb|EDW98363.1| GE10485 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195341071|ref|XP_002037135.1| GM12273 [Drosophila sechellia] gi|194131251|gb|EDW53294.1| GM12273 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
FB|FBgn0039620 517 CG1443 [Drosophila melanogaste 0.941 0.280 0.420 7.6e-32
FB|FBgn0034145 625 CG5065 [Drosophila melanogaste 0.941 0.232 0.351 2.2e-21
FB|FBgn0085371 570 CG34342 [Drosophila melanogast 0.915 0.247 0.355 2.2e-21
FB|FBgn0038451 510 CG14893 [Drosophila melanogast 0.941 0.284 0.32 5.7e-21
FB|FBgn0038032 502 CG10096 [Drosophila melanogast 0.941 0.288 0.308 2.4e-19
RGD|1306647 515 Far1 "fatty acyl CoA reductase 0.922 0.275 0.331 2.6e-19
UNIPROTKB|Q66H50 515 Far1 "Fatty acyl-CoA reductase 0.922 0.275 0.331 2.6e-19
FB|FBgn0038450 499 CG17560 [Drosophila melanogast 0.948 0.292 0.304 7.9e-18
UNIPROTKB|E2R4R9 514 FAR1 "Uncharacterized protein" 0.941 0.282 0.310 1.4e-17
UNIPROTKB|A5PJQ0 515 FAR1 "Uncharacterized protein" 0.941 0.281 0.310 1.4e-17
FB|FBgn0039620 CG1443 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 350 (128.3 bits), Expect = 7.6e-32, P = 7.6e-32
 Identities = 61/145 (42%), Positives = 92/145 (63%)

Query:     9 LVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAW 68
             +V++TYREPV GWIDN+YGP G++VGIG+GVL  +  D D    +VPVDM VN+++A+AW
Sbjct:   258 IVITTYREPVTGWIDNMYGPCGVIVGIGSGVLRVFTGDMDNKAHIVPVDMCVNALLASAW 317

Query:    69 YTAKSNQQQIPIYNYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFL 128
               A++  +  PIYNYV   +  VTW  +++   ++G   P  +++WY  F        + 
Sbjct:   318 DIARNKYETPPIYNYVPDAENMVTWRRYMEDGFEYGCDIPMRKSIWYPRFTIVPHMWQYH 377

Query:   129 FLNFLLHTIPGLILDGVASMFGKTP 153
              L FL HT+P L++D +  + GK P
Sbjct:   378 ILCFLYHTLPALVMDAIMVIIGKKP 402
GO:0080019 "fatty-acyl-CoA reductase (alcohol-forming) activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
FB|FBgn0034145 CG5065 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0085371 CG34342 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038451 CG14893 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038032 CG10096 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1306647 Far1 "fatty acyl CoA reductase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q66H50 Far1 "Fatty acyl-CoA reductase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0038450 CG17560 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4R9 FAR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJQ0 FAR1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
cd05236320 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (F 7e-27
PLN02996491 PLN02996, PLN02996, fatty acyl-CoA reductase 2e-14
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 8e-09
PLN02503605 PLN02503, PLN02503, fatty acyl-CoA reductase 2 3e-08
>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended (e) SDRs Back     alignment and domain information 
 Score =  101 bits (255), Expect = 7e-27
 Identities = 35/90 (38%), Positives = 54/90 (60%)

Query: 10  VVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWY 69
           V +T +EP  GWIDN  GP GL +  G G+L T   D +AV +++PVD+V N+++A A Y
Sbjct: 222 VGATLKEPFPGWIDNFNGPDGLFLAYGKGILRTMNADPNAVADIIPVDVVANALLAAAAY 281

Query: 70  TAKSNQQQIPIYNYVSSVQKPVTWNEFLQH 99
           +     +++ +Y+  SS   P TW E  + 
Sbjct: 282 SGVRKPRELEVYHCGSSDVNPFTWGEAEEL 311

SDRs are Rossmann-fold NAD(P)H-binding proteins, many of which may function as fatty acyl CoA reductases (FAR), acting on medium and long chain fatty acids, and have been reported to be involved in diverse processes such as biosynthesis of insect pheromones, plant cuticular wax production, and mammalian wax biosynthesis. In Arabidopsis thaliana, proteins with this particular architecture have also been identified as the MALE STERILITY 2 (MS2) gene product, which is implicated in male gametogenesis. Mutations in MS2 inhibit the synthesis of exine (sporopollenin), rendering plants unable to reduce pollen wall fatty acids to corresponding alcohols. This N-terminal domain shares the catalytic triad (but not the upstream Asn) and characteristic NADP-binding motif of the extended SDR family. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 320
>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase Back     alignment and domain information
>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|215279 PLN02503, PLN02503, fatty acyl-CoA reductase 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
KOG1221|consensus467 100.0
PLN02503605 fatty acyl-CoA reductase 2 100.0
PLN02996491 fatty acyl-CoA reductase 99.97
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 98.4
PRK07201 657 short chain dehydrogenase; Provisional 96.3
TIGR01746367 Thioester-redct thioester reductase domain. It has 95.33
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 94.26
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 94.14
PLN02427386 UDP-apiose/xylose synthase 93.63
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 93.52
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 92.5
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 92.46
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 91.85
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 90.73
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 90.72
PLN02260 668 probable rhamnose biosynthetic enzyme 90.45
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 89.54
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 89.32
PTZ00374 1108 dihydroxyacetone phosphate acyltransferase; Provis 89.18
PRK11908347 NAD-dependent epimerase/dehydratase family protein 88.41
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 86.57
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 86.08
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 85.06
PLN00016378 RNA-binding protein; Provisional 84.71
PLN02206442 UDP-glucuronate decarboxylase 83.38
PF06956183 RtcR: Regulator of RNA terminal phosphate cyclase; 80.81
>KOG1221|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.6e-49  Score=335.46  Aligned_cols=152  Identities=39%  Similarity=0.725  Sum_probs=146.8

Q ss_pred             cccccceEEcccCCCccceeccCCchhhhhhhhccCceeeeecCCCCccccchHHHHHHHHHHHhhhhhhccC-CCcCEE
Q psy3448           3 FSGLHILVVSTYREPVRGWIDNVYGPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQ-QQIPIY   81 (154)
Q Consensus         3 ~~~RPSIV~~a~~EP~pGWiDn~~G~~gl~~~~g~G~lr~~~~~~~~~~D~VPvD~vvn~li~aa~~~~~~~~-~~~~VY   81 (154)
                      ..+|||||+||++||+|||+||++||+|+++|+|+|++|++++|++.++|+||||||||++|+++|+++.+.+ ++++||
T Consensus       229 vIiRPsiI~st~~EP~pGWidn~~gp~g~i~g~gkGvlr~~~~d~~~~adiIPvD~vvN~~ia~~~~~~~~~~~~~~~IY  308 (467)
T KOG1221|consen  229 VIIRPSIITSTYKEPFPGWIDNLNGPDGVIIGYGKGVLRCFLVDPKAVADIIPVDMVVNAMIASAWQHAGNSKEKTPPIY  308 (467)
T ss_pred             EEEcCCceeccccCCCCCccccCCCCceEEEEeccceEEEEEEccccccceeeHHHHHHHHHHHHHHHhccCCCCCCcEE
Confidence            3589999999999999999999999999999999999999999999999999999999999999999988754 368999


Q ss_pred             EeecCCCCcccHHHHHHHHHhcCccCCCCccceeeeeeeecCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCC
Q psy3448          82 NYVSSVQKPVTWNEFLQHNIKHGHHWPTIRAVWYYSFWPTKSRIMFLFLNFLLHTIPGLILDGVASMFGKTPM  154 (154)
Q Consensus        82 ~~~ss~~np~t~~~~~~~~~~~~~~~P~~~~~w~p~~~~t~~~~~~~~~~~~~h~lPA~i~D~~~~l~G~kp~  154 (154)
                      |++||..||+||+++.+.+.++++++|+++.+|+|.+.+++|.+.|.++.+++|.|||+++|+++++.|+||+
T Consensus       309 ~~tss~~Np~t~~~~~e~~~~~~~~~Pl~~~iw~P~~~~~sn~~~f~~~~~~~h~lPa~~~d~~~~i~g~k~~  381 (467)
T KOG1221|consen  309 HLTSSNDNPVTWGDFIELALRYFEKIPLEKMIWYPFGTLTSNPWLFNLAAFLYHTLPAYILDLLLRLLGKKPR  381 (467)
T ss_pred             EecccccCcccHHHHHHHHHHhcccCCcccceeccCceeeecHhHHHHHHHHHHHhhHHHHHHHHHHhCCChh
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999985

>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PTZ00374 dihydroxyacetone phosphate acyltransferase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PF06956 RtcR: Regulator of RNA terminal phosphate cyclase; InterPro: IPR009715 RtcR is a sigma54-dependent enhancer binding protein [] that activates transcription of the rtcBA operon Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 7e-12
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
 Score = 61.1 bits (148), Expect = 7e-12
 Identities = 14/82 (17%), Positives = 32/82 (39%), Gaps = 3/82 (3%)

Query: 38  GVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQQQIPIYNYVSSVQKPVTWNEFL 97
               +    Q A  + +PV  V  ++       A S+      Y+ ++     +  +E++
Sbjct: 313 YEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFATYHVMNPHDDGIGLDEYV 372

Query: 98  QHNIKHGHHWPTIRAVWYYSFW 119
              I+ G+    IR +  ++ W
Sbjct: 373 DWLIEAGYP---IRRIDDFAEW 391

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 97.8
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 96.74
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.47
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 96.46
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 96.38
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 96.27
3slg_A372 PBGP3 protein; structural genomics, seattle struct 96.16
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.09
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 95.97
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 95.88
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 95.84
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 95.81
4f6l_B508 AUSA reductase domain protein; thioester reductase 95.74
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 95.59
4f6c_A427 AUSA reductase domain protein; thioester reductase 95.47
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 95.44
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 95.36
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 95.35
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 95.29
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 94.97
3ius_A286 Uncharacterized conserved protein; APC63810, silic 94.94
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 94.89
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 94.83
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 94.71
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 94.31
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 94.16
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 94.09
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 94.04
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 93.98
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 93.91
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 93.68
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 93.67
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 93.64
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 93.62
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 93.48
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 93.22
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 92.87
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 92.79
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 92.76
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 92.65
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 92.54
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 92.14
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 91.38
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 91.33
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 91.33
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 90.97
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 90.89
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 90.78
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 90.48
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 88.46
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 88.36
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 87.27
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 86.83
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 86.69
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 86.42
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 86.41
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 86.19
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 84.78
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 82.68
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 82.52
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
Probab=97.80  E-value=3.5e-05  Score=65.28  Aligned_cols=95  Identities=13%  Similarity=0.231  Sum_probs=64.9

Q ss_pred             ccccceEEcccC----CCccceeccCCchhhhhhhhccCce-eeeecCC------CCccccchHHHHHHHHHHHhhhhhh
Q psy3448           4 SGLHILVVSTYR----EPVRGWIDNVYGPVGLMVGIGTGVL-HTYQYDQ------DAVTEMVPVDMVVNSVIATAWYTAK   72 (154)
Q Consensus         4 ~~RPSIV~~a~~----EP~pGWiDn~~G~~gl~~~~g~G~l-r~~~~~~------~~~~D~VPvD~vvn~li~aa~~~~~   72 (154)
                      .+||+.|.+.-+    .+..+|+..+     +......|.. +.++++.      +...|.||||.|+++++.++.....
T Consensus       273 ivRpg~v~G~~~~~g~~~~~~~~~~l-----~~~~~~~g~~P~~~~~~~~~G~~~~~~~~~v~vdDvA~ai~~~~~~~~~  347 (478)
T 4dqv_A          273 VFRCGMILADTSYAGQLNMSDWVTRM-----VLSLMATGIAPRSFYEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAG  347 (478)
T ss_dssp             EEEECEEECCSSSSSCCCTTBHHHHH-----HHHHHHHCEEESCSBCCCTTSCCCCCCCCEEEHHHHHHHHHHHHHTTC-
T ss_pred             EEECceeeCCCccCCcCCHHHHHHHH-----HHHHHHcCcccccccccccccccccceeeeeeHHHHHHHHHHHHhhccc
Confidence            589999987432    2445555443     1123344665 3333332      7889999999999999998865432


Q ss_pred             ccCCCcCEEEeecCCCCcccHHHHHHHHHhc
Q psy3448          73 SNQQQIPIYNYVSSVQKPVTWNEFLQHNIKH  103 (154)
Q Consensus        73 ~~~~~~~VY~~~ss~~np~t~~~~~~~~~~~  103 (154)
                      .+...-.+||+++...+|+||.|+.+...++
T Consensus       348 ~~~~~~~~ynv~~~~~~~~s~~el~~~l~~~  378 (478)
T 4dqv_A          348 SSLAGFATYHVMNPHDDGIGLDEYVDWLIEA  378 (478)
T ss_dssp             CCCCSEEEEEESCCCCSSCSHHHHHHHHHHT
T ss_pred             CCCCCCceEEecCCCCCCcCHHHHHHHHHHc
Confidence            2223456999999877789999999999985
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 93.39
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 92.34
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 92.1
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 91.84
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 91.49
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.25
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 90.42
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 89.46
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 88.98
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 87.16
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 86.42
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 85.77
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 82.24
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Polymyxin resistance protein ArnA (PrmI)
species: Escherichia coli [TaxId: 562]

Probab=93.39  E-value=0.1  Score=39.25  Aligned_cols=99  Identities=5%  Similarity=-0.114  Sum_probs=65.3

Q ss_pred             ccccceEEcccCCCccceeccCC-chhhhhhhhccCceeeeecCCCCccccchHHHHHHHHHHHhhhhhhccCCCcCEEE
Q psy3448           4 SGLHILVVSTYREPVRGWIDNVY-GPVGLMVGIGTGVLHTYQYDQDAVTEMVPVDMVVNSVIATAWYTAKSNQQQIPIYN   82 (154)
Q Consensus         4 ~~RPSIV~~a~~EP~pGWiDn~~-G~~gl~~~~g~G~lr~~~~~~~~~~D~VPvD~vvn~li~aa~~~~~~~~~~~~VY~   82 (154)
                      ++||+.+.+....+.-|=.++.. ....++...-.|---.++++++..-|++=||=++++++.+.-....+  ..-.+||
T Consensus       172 i~r~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~g~~~r~~i~v~D~~~a~~~~~~~~~~~--~~g~~~N  249 (342)
T d2blla1         172 LFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDIRDGIEALYRIIENAGNR--CDGEIIN  249 (342)
T ss_dssp             EEEECSEECSSCCCTTCSBSCBCHHHHHHHHHHHHTCCEEEGGGSCCEEECEEHHHHHHHHHHHHHCGGGT--TTTEEEE
T ss_pred             EeeccccccccccccccccccccccchHHHHHHHhCCCccccCCCCeeeeecccccccceeeeehhhcccc--CCCeEEE
Confidence            46777777754443332222222 23344455556666677899999999999999999988886433221  1346999


Q ss_pred             eecCCCCcccHHHHHHHHHhcCc
Q psy3448          83 YVSSVQKPVTWNEFLQHNIKHGH  105 (154)
Q Consensus        83 ~~ss~~np~t~~~~~~~~~~~~~  105 (154)
                      ++++ .+++|+.++.+.+.+...
T Consensus       250 ig~~-~~~~t~~~l~~~i~~~~~  271 (342)
T d2blla1         250 IGNP-ENEASIEELGEMLLASFE  271 (342)
T ss_dssp             ECCT-TSEEEHHHHHHHHHHHHH
T ss_pred             Eecc-cchhHHHHHHHHHHHHhC
Confidence            9765 367999999988876543
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure