Psyllid ID: psy3479

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MLTFNDRVHKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKNSKNQTVVKLTVVPCAPVVEVKIKRPDTKYQLGFSVQNGVAPEGETQPSTEVDLFISTEKIMVLNTDLKAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKILMKTMPTSMFRLLTGQETPVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNHHLC
cccccccccccccccccHHHHHHHHccccEEEEEEEEccccccccccccccccccccccccccEEEEEEcccccEEEEEEEEcccccccccEEEEEEccccHHHHccccccccEEEEEccEEcccccHHHHHHHHHHcccccEEEEEEEEccccEEEEEEccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccEEEEEEEEEEccccHHHHHHHHHHHcccccccccEEEEEcccccccccccccccccccccEEEEEccccccHHEEccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEEEEEccccccccEEEEEcccccccccEEEEEEccccHHHHccccccccEEEEEccEEcccccHHHHHHHHHHHcccccEEEEEEEcccccEEEEEccccccccEEEEccccccccccEEEEEEccccHHHHccccccccEEEEEccEEcccccHHHHHHHHHHccccc
cccEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccccccccEEEEEcccccEEEEEEEEEEccccccccEEEEEccccHHHHHcccccccEEEEEccEEcccccHHHHHHHHHHcccccEEEEEEEccccEEEEEEcccccHHHcccccccccccccccccccccccHHHHHHccccccccccccccccccccccEEEEEccccccccEEEEEHccccccccccEEEcccEEEEEcccccccccHHHHHHHHHccccEEEEEEcccHHHHHHHccccccHcHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEEEEcccccccccEEEEEccccHHHHHcccccccEEEEEccEEcccccHHHHHHHHHHccccEEEEEEEEccccEEEEEEEccccccEEEEEEEEEccccccccEEEEEccccHHHHHcccccccEEEEEccEEcccccHHHHHHHHHHHHccc
MLTFNDRVHKEIMMDHALRTISYIADIGDLVVLMARRRFvsqeadeppkisrtpkmichvfesdevvvpkakGEILGVVIVEsgwgsmlpTVVIANLapagaaarcgqlnigdqiiAVNGvslvglplstcqtyiknsknqtvVKLTvvpcapvvevkikrpdtkyqlgfsvqngvapegetqpstevdlFISTEKIMVLNtdlkapegetqpstevdlFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFvsqeadeppkisrtpkmichvfesDEAQFIAQSIGQAFQVAYMEFLKAngiedhsfvkemdyqevlnsqeIFGDELQMFAKKELqkevvvpkakgEILGVVIVEsgwgsmlpTVVIANLapagaaarcgqlnigdqiiAVNGVslvglplsTCQTYIKILMKTMPTSMFrlltgqetpvvvpkakgEILGVVIVEsgwgsmlpTVVIANLapagaaarcgqlnigdqiiAVNGVslvglplstcQTYIKVNHHLC
MLTFNDRVHKEIMMDHALRTISYIADIGDLVVLMARRRFVsqeadeppkisrtpkmiCHVFESdevvvpkakGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYiknsknqtvvkltvvpcapvvevkikrpdtkyQLGFsvqngvapegetqpstEVDLFISTEKIMVLNTDlkapegetqpstevdlfisTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVsqeadeppkisrtPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQkevvvpkakgEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKILMKTMPTSMFRLLTGQETPVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNHHLC
MLTFNDRVHKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKNSKNQTVVKLTVVPCAPVVEVKIKRPDTKYQLGFSVQNGVAPEGETQPSTEVDLFISTEKIMVLNTDLKAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKILMKTMPTSMFRLLTGQETPVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNHHLC
*******VHKEIMMDHALRTISYIADIGDLVVLMARRRFV*************PKMICHVFESDEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKNSKNQTVVKLTVVPCAPVVEVKIKRPDTKYQLGFSVQN*************VDLFISTEKIMVLNTD************EVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFV**************KMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKILMKTMPTSMFRLLTGQETPVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNH***
*******VHKEIMMDHALRTISYIADIGDLVVL****************************ESDEVVVPKAKGEIL***********MLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQT**K*****TVVKLTVVPCAPVVE******************************************************************************************YIADIGDLVVLM*******************PKMICHVFESDEAQ*************************************************************************IVE*GWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKILMKTMPTSMFRLLTGQETPVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNHH**
MLTFNDRVHKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKNSKNQTVVKLTVVPCAPVVEVKIKRPDTKYQLGFSVQNGVAPEGETQPSTEVDLFISTEKIMVLNTDLKAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKILMKTMPTSMFRLLTGQETPVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNHHLC
*LTFNDRVHKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKNSKNQTVVKLTVVPCAPVVEVKIKRPDTKYQLGFSVQNGVAPEG**********************DLKAP***TQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKAN********************EIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKILMKTMPTSMFRLLTGQETPVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNHHLC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTFNDRVHKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKNSKNQTVVKLTVVPCAPVVEVKIKRPDTKYQLGFSVQNGVAPEGETQPSTEVDLFISTEKIMVLNTDLKAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKILMKTMPTSMFRLLTGQETPVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNHHLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query518 2.2.26 [Sep-21-2011]
O17583982 Protein lin-10 OS=Caenorh yes N/A 0.546 0.288 0.590 5e-92
Q02410837 Amyloid beta A4 precursor yes N/A 0.557 0.345 0.516 1e-76
O35430839 Amyloid beta A4 precursor yes N/A 0.598 0.369 0.491 1e-76
B2RUJ5842 Amyloid beta A4 precursor yes N/A 0.594 0.365 0.491 2e-76
O35431750 Amyloid beta A4 precursor no N/A 0.536 0.370 0.498 1e-70
P98084750 Amyloid beta A4 precursor no N/A 0.536 0.370 0.498 2e-70
Q99767749 Amyloid beta A4 precursor no N/A 0.536 0.371 0.498 2e-70
Q5RD33749 Amyloid beta A4 precursor no N/A 0.536 0.371 0.495 1e-69
O70248569 Amyloid beta A4 precursor no N/A 0.550 0.500 0.441 2e-60
O88888571 Amyloid beta A4 precursor no N/A 0.550 0.499 0.445 5e-55
>sp|O17583|LIN10_CAEEL Protein lin-10 OS=Caenorhabditis elegans GN=lin-10 PE=1 SV=1 Back     alignment and function desciption
 Score =  338 bits (867), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 190/322 (59%), Positives = 230/322 (71%), Gaps = 39/322 (12%)

Query: 204 LKAPEGETQPSTEVDLFISTEKIMVLNTDLK---------EIMMDHALRTISYIADIGDL 254
           +KAPEG+ QPSTE+DLFISTEKIMVLNTDL+         +I+MDHALRTISYIADIGDL
Sbjct: 639 VKAPEGDVQPSTEIDLFISTEKIMVLNTDLQRISDTDVRQDILMDHALRTISYIADIGDL 698

Query: 255 VVLMARRRFVSQEADEP--------PKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYM 306
           VVLMARR   S  +DE           + +TPK+ICHVFESDEA FIAQSIGQAFQVAY+
Sbjct: 699 VVLMARRMSTSH-SDESCSDGDSSGGGVRKTPKVICHVFESDEASFIAQSIGQAFQVAYV 757

Query: 307 EFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIV 366
           EFL+ANGI+D S+++++DYQEVLNSQE+ GDEL+MFAKKE QKEVVVPK  GE LG+V+V
Sbjct: 758 EFLRANGIDDPSYLRQIDYQEVLNSQELLGDELEMFAKKETQKEVVVPKKAGEPLGIVVV 817

Query: 367 ESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKILMKT 426
           ESGWGSMLPTVV+A++ P G AA   +LNIGDQII +NG+SLVGLPLS  QT I    K 
Sbjct: 818 ESGWGSMLPTVVLAHMNPVGPAAHSNKLNIGDQIININGISLVGLPLSAAQTQI----KN 873

Query: 427 MPTSMFRLLTGQETPVVV------PKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAA 480
           M T+    +T   TP VV      P  K + LG   V++G        VI +L   G A 
Sbjct: 874 MKTATAVRMTVVSTPPVVEVRIRRPDTKYQ-LGFS-VQNG--------VICSLLRGGIAE 923

Query: 481 RCGQLNIGDQIIAVNGVSLVGL 502
           R G + +G +II +NG S+V +
Sbjct: 924 RGG-IRVGHRIIEINGTSVVAV 944
Required specifically for the determination of 3 vulval precursor cell fates P5.p, P6.p and P7.p during late second and early third larval stages; required for basolateral localization of receptor tyrosine kinase let-23. Could have a general but redundant role in development, functioning in diverse cell lineages to control cell fates.
Caenorhabditis elegans (taxid: 6239)
>sp|Q02410|APBA1_HUMAN Amyloid beta A4 precursor protein-binding family A member 1 OS=Homo sapiens GN=APBA1 PE=1 SV=3 Back     alignment and function description
>sp|O35430|APBA1_RAT Amyloid beta A4 precursor protein-binding family A member 1 OS=Rattus norvegicus GN=Apba1 PE=1 SV=1 Back     alignment and function description
>sp|B2RUJ5|APBA1_MOUSE Amyloid beta A4 precursor protein-binding family A member 1 OS=Mus musculus GN=Apba1 PE=2 SV=2 Back     alignment and function description
>sp|O35431|APBA2_RAT Amyloid beta A4 precursor protein-binding family A member 2 OS=Rattus norvegicus GN=Apba2 PE=1 SV=1 Back     alignment and function description
>sp|P98084|APBA2_MOUSE Amyloid beta A4 precursor protein-binding family A member 2 OS=Mus musculus GN=Apba2 PE=1 SV=2 Back     alignment and function description
>sp|Q99767|APBA2_HUMAN Amyloid beta A4 precursor protein-binding family A member 2 OS=Homo sapiens GN=APBA2 PE=1 SV=3 Back     alignment and function description
>sp|Q5RD33|APBA2_PONAB Amyloid beta A4 precursor protein-binding family A member 2 OS=Pongo abelii GN=APBA2 PE=2 SV=1 Back     alignment and function description
>sp|O70248|APBA3_RAT Amyloid beta A4 precursor protein-binding family A member 3 OS=Rattus norvegicus GN=Apba3 PE=2 SV=2 Back     alignment and function description
>sp|O88888|APBA3_MOUSE Amyloid beta A4 precursor protein-binding family A member 3 OS=Mus musculus GN=Apba3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
241781539532 amyloid beta A4 precursor protein (APP)- 0.594 0.578 0.753 1e-132
242024334 1298 conserved hypothetical protein [Pediculu 0.598 0.238 0.702 1e-119
195135033 2018 GI14470 [Drosophila mojavensis] gi|19390 0.598 0.153 0.690 1e-116
195432643 2155 GK20104 [Drosophila willistoni] gi|19416 0.598 0.143 0.690 1e-116
195393522 2082 GJ18807 [Drosophila virilis] gi|19414991 0.598 0.148 0.690 1e-116
195566087 985 GD16984 [Drosophila simulans] gi|1942040 0.592 0.311 0.684 1e-116
195167022 1156 GL14982 [Drosophila persimilis] gi|19410 0.598 0.268 0.690 1e-116
442615839 2063 X11Lbeta, isoform B [Drosophila melanoga 0.598 0.150 0.690 1e-116
198468962 2068 GA22393 [Drosophila pseudoobscura pseudo 0.598 0.149 0.690 1e-116
195481967 2276 GE17852 [Drosophila yakuba] gi|194189377 0.598 0.136 0.690 1e-115
>gi|241781539|ref|XP_002400290.1| amyloid beta A4 precursor protein (APP)-binding protein, putative [Ixodes scapularis] gi|215510721|gb|EEC20174.1| amyloid beta A4 precursor protein (APP)-binding protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
 Score =  478 bits (1230), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 248/329 (75%), Positives = 274/329 (83%), Gaps = 21/329 (6%)

Query: 181 ETQPSTEVDLFISTEKIMVLNTDLKAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDH 240
           E QP+    +  + E +    + +KAPEGE QPSTEVDLFISTEKIMVLNTDLKEIMMDH
Sbjct: 184 EGQPTKATRMIQAEEAV----SRIKAPEGEAQPSTEVDLFISTEKIMVLNTDLKEIMMDH 239

Query: 241 ALRTISYIADIGDLVVLMARRRFVSQEADEPP--KISRTPKMICHVFESDEAQFIAQSIG 298
           ALR+ISYIADIGDLVVLMARRR +    D+P   K+ RTPKMICHVFES+EAQFIAQSIG
Sbjct: 240 ALRSISYIADIGDLVVLMARRRTLE---DDPGGGKLRRTPKMICHVFESEEAQFIAQSIG 296

Query: 299 QAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKG 358
           QAFQVAYMEFLKANGIED SFVKEMDYQEVLNSQEIFG+EL+MFAKKE QKEVVVPK KG
Sbjct: 297 QAFQVAYMEFLKANGIEDSSFVKEMDYQEVLNSQEIFGNELEMFAKKERQKEVVVPKQKG 356

Query: 359 EILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQT 418
           EILG+VIVESGWGSMLPTVV+AN+A  G AARC QLNIGDQIIA+NGVSLVGLPLSTCQ 
Sbjct: 357 EILGMVIVESGWGSMLPTVVVANMAHNGPAARCSQLNIGDQIIAINGVSLVGLPLSTCQA 416

Query: 419 YIKILMKTMPTSMFRLLTGQETPVVVPKA--KGEILGVVIVESGWGSMLPTVVIANLAPA 476
           Y+K    T   ++ +L        VVP A  KGEILG+VIVESGWGSMLPTVV+AN+A  
Sbjct: 417 YVK---NTKHQNVVKL-------TVVPCAPVKGEILGMVIVESGWGSMLPTVVVANMAHN 466

Query: 477 GAAARCGQLNIGDQIIAVNGVSLVGLPLS 505
           G AARC QLNIGDQIIA+NGVSLVGLPL+
Sbjct: 467 GPAARCSQLNIGDQIIAINGVSLVGLPLT 495

Source: Ixodes scapularis

Species: Ixodes scapularis

Genus: Ixodes

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242024334|ref|XP_002432583.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518043|gb|EEB19845.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195135033|ref|XP_002011940.1| GI14470 [Drosophila mojavensis] gi|193909194|gb|EDW08061.1| GI14470 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195432643|ref|XP_002064326.1| GK20104 [Drosophila willistoni] gi|194160411|gb|EDW75312.1| GK20104 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195393522|ref|XP_002055403.1| GJ18807 [Drosophila virilis] gi|194149913|gb|EDW65604.1| GJ18807 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195566087|ref|XP_002106622.1| GD16984 [Drosophila simulans] gi|194204004|gb|EDX17580.1| GD16984 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195167022|ref|XP_002024333.1| GL14982 [Drosophila persimilis] gi|194107706|gb|EDW29749.1| GL14982 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|442615839|ref|NP_001259425.1| X11Lbeta, isoform B [Drosophila melanogaster] gi|440216634|gb|AGB95268.1| X11Lbeta, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|198468962|ref|XP_002134177.1| GA22393 [Drosophila pseudoobscura pseudoobscura] gi|198146653|gb|EDY72804.1| GA22393 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195481967|ref|XP_002101853.1| GE17852 [Drosophila yakuba] gi|194189377|gb|EDX02961.1| GE17852 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
FB|FBgn00526772139 X11Lbeta "X11Lbeta" [Drosophil 0.602 0.145 0.687 3.7e-104
WB|WBGene00002999982 lin-10 [Caenorhabditis elegans 0.557 0.294 0.588 3.1e-85
UNIPROTKB|O17583982 lin-10 "Protein lin-10" [Caeno 0.557 0.294 0.588 3.1e-85
FB|FBgn00263131168 X11L "X11L" [Drosophila melano 0.604 0.267 0.580 3.1e-84
UNIPROTKB|Q02410837 APBA1 "Amyloid beta A4 precurs 0.554 0.342 0.532 1.1e-80
UNIPROTKB|E1C7H3824 APBA1 "Uncharacterized protein 0.554 0.348 0.532 1.1e-80
UNIPROTKB|F1MYC3835 APBA1 "Uncharacterized protein 0.554 0.343 0.532 1.1e-80
UNIPROTKB|F1SJD2394 APBA1 "Uncharacterized protein 0.554 0.728 0.532 1.1e-80
UNIPROTKB|F1NYK4758 APBA2 "Uncharacterized protein 0.542 0.370 0.516 3.7e-74
UNIPROTKB|F1MLB6752 APBA2 "Uncharacterized protein 0.542 0.373 0.513 1.6e-73
FB|FBgn0052677 X11Lbeta "X11Lbeta" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1044 (372.6 bits), Expect = 3.7e-104, P = 3.7e-104
 Identities = 222/323 (68%), Positives = 250/323 (77%)

Query:   181 ETQPSTEVDLFISTEKIMVLNTDLKAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDH 240
             E QP+    +  + E +  +     AP+G+ QPSTEVDLFISTEKIMVLNTDLKEIMMDH
Sbjct:  1791 EGQPTKSTRMMQAEEAVSRIKA--LAPDGDVQPSTEVDLFISTEKIMVLNTDLKEIMMDH 1848

Query:   241 ALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQA 300
             ALRTISYIADIGDLVVLMARRRFV Q+ D+ PK +RTPKMICHVFESDEAQFIAQSIGQA
Sbjct:  1849 ALRTISYIADIGDLVVLMARRRFVPQDIDDAPKPNRTPKMICHVFESDEAQFIAQSIGQA 1908

Query:   301 FQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEI 360
             FQVAYMEFLKANGIEDH FVKEMDYQEVLNSQEIFGDEL++FAKKELQKEVVVPKAKGEI
Sbjct:  1909 FQVAYMEFLKANGIEDHRFVKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEI 1968

Query:   361 LGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYI 420
             LGVVIVESGWGSMLPTVVIANL  +GAAARCGQLNIGDQ+IA+NG+SLVGLPLSTCQTYI
Sbjct:  1969 LGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTYI 2028

Query:   421 KILMKTMPTSMFRLLTGQETPVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAA 480
             K    T   ++ +       PVV  K K       +     G  +   VI +L   G A 
Sbjct:  2029 K---NTKNQTVVKFTVVPCAPVVEVKIKRPETKYQL-----GFSVQNGVICSLLRGGIAE 2080

Query:   481 RCGQLNIGDQIIAVNGVSLVGLP 503
             R G + +G +II +N  S+V +P
Sbjct:  2081 R-GGVRVGHRIIEINNQSVVAVP 2102
GO:0001540 "beta-amyloid binding" evidence=ISS
WB|WBGene00002999 lin-10 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O17583 lin-10 "Protein lin-10" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0026313 X11L "X11L" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q02410 APBA1 "Amyloid beta A4 precursor protein-binding family A member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7H3 APBA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYC3 APBA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SJD2 APBA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYK4 APBA2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MLB6 APBA2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O17583LIN10_CAEELNo assigned EC number0.59000.54630.2881yesN/A
Q02410APBA1_HUMANNo assigned EC number0.51630.55790.3452yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
cd01208161 cd01208, PTB_X11, X11-like Phosphotyrosine-binding 4e-77
cd01208161 cd01208, PTB_X11, X11-like Phosphotyrosine-binding 5e-29
pfam00640133 pfam00640, PID, Phosphotyrosine interaction domain 1e-27
smart00462134 smart00462, PTB, Phosphotyrosine-binding domain, p 5e-17
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 5e-12
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 6e-12
cd01273144 cd01273, PTB_CED-6, Cell death protein 6 homolog ( 3e-11
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 6e-10
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 9e-10
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-09
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 3e-09
cd00934119 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-lik 3e-08
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 3e-08
pfam00640133 pfam00640, PID, Phosphotyrosine interaction domain 6e-08
cd01274146 cd01274, PTB_Anks, Ankyrin repeat and sterile alph 2e-07
cd13161120 cd13161, PTB_TK_HMTK, Tyrosine-specific kinase/HM- 2e-07
cd13157129 cd13157, PTB_tensin-related, Tensin-related Phosph 3e-07
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 3e-06
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 6e-06
cd01212149 cd01212, PTB_JIP, JNK-interacting protein-like (JI 8e-06
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 5e-05
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 8e-05
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 0.002
>gnl|CDD|241244 cd01208, PTB_X11, X11-like Phosphotyrosine-binding (PTB) domain Back     alignment and domain information 
 Score =  239 bits (611), Expect = 4e-77
 Identities = 81/119 (68%), Positives = 91/119 (76%), Gaps = 7/119 (5%)

Query: 205 KAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFV 264
           KAPEGE+QPSTEVDLFISTE+I VLN D +E MMDHALRTISYIADIG++VVLMARRR  
Sbjct: 43  KAPEGESQPSTEVDLFISTERIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMP 102

Query: 265 SQEADEP-------PKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIED 316
              + E         +  R  KMICHVFES++AQ IAQSIGQAF VAY EFL+ANGI  
Sbjct: 103 RSSSQECIETTPPAQEGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINP 161

The function of the neuronal protein X11 is unknown to date. X11 has a PTB domain followed by two PDZ domains. PTB domains have a common PH-like fold and are found in various eukaryotic signaling molecules. This domain was initially shown to binds peptides with a NPXY motif with differing requirements for phosphorylation of the tyrosine, although more recent studies have found that some types of PTB domains can bind to peptides lack tyrosine residues altogether. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. PTB domains are classified into three groups: phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains. This cd is part of the Dab-like subgroup. Length = 161
>gnl|CDD|241244 cd01208, PTB_X11, X11-like Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|144292 pfam00640, PID, Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>gnl|CDD|214675 smart00462, PTB, Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|241303 cd01273, PTB_CED-6, Cell death protein 6 homolog (CED-6/GULP1) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|241236 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|144292 pfam00640, PID, Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>gnl|CDD|241304 cd01274, PTB_Anks, Ankyrin repeat and sterile alpha motif (SAM) domain-containing (Anks) protein family Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|241315 cd13161, PTB_TK_HMTK, Tyrosine-specific kinase/HM-motif TK (TM/HMTK) Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|241311 cd13157, PTB_tensin-related, Tensin-related Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|241248 cd01212, PTB_JIP, JNK-interacting protein-like (JIP) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 518
KOG3605|consensus829 100.0
KOG3209|consensus 984 100.0
KOG3605|consensus829 100.0
KOG3209|consensus984 100.0
KOG3580|consensus 1027 99.94
KOG3580|consensus 1027 99.62
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.61
cd01208156 X11 X11 Phosphotyrosine-binding (PTB) domain. X11 99.59
PRK10139455 serine endoprotease; Provisional 99.44
KOG3550|consensus207 99.42
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.41
PRK10942473 serine endoprotease; Provisional 99.41
PRK10779 449 zinc metallopeptidase RseP; Provisional 99.33
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.29
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 99.27
KOG3550|consensus207 99.14
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.13
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.09
KOG3549|consensus505 99.07
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 99.06
KOG3571|consensus626 99.04
PRK10942473 serine endoprotease; Provisional 99.04
KOG3553|consensus124 99.01
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.99
KOG3551|consensus506 98.98
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.97
KOG1892|consensus 1629 98.94
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.89
KOG3651|consensus429 98.85
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.85
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.84
KOG3553|consensus124 98.8
PRK10139455 serine endoprotease; Provisional 98.79
cd01208156 X11 X11 Phosphotyrosine-binding (PTB) domain. X11 98.75
KOG3551|consensus 506 98.71
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.68
KOG3549|consensus 505 98.68
KOG0609|consensus542 98.59
PRK10779449 zinc metallopeptidase RseP; Provisional 98.59
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.55
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.52
KOG1892|consensus 1629 98.52
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.51
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.51
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 98.47
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.44
KOG3552|consensus 1298 98.43
PRK11186667 carboxy-terminal protease; Provisional 98.43
PLN00049389 carboxyl-terminal processing protease; Provisional 98.4
KOG3938|consensus334 98.38
KOG3606|consensus358 98.38
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.33
KOG3571|consensus 626 98.33
KOG3651|consensus 429 98.3
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.26
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.24
cd01209160 SHC SHC phosphotyrosine-binding (PTB) domain. SHC 98.24
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.23
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.19
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.14
KOG3542|consensus 1283 98.12
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.12
KOG3606|consensus358 98.1
KOG3542|consensus 1283 97.91
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.9
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.9
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.89
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.87
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.84
KOG4371|consensus1332 97.81
KOG3552|consensus 1298 97.8
KOG0609|consensus 542 97.75
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.71
KOG4371|consensus1332 97.67
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.55
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.54
KOG4407|consensus 1973 97.5
PRK11186 667 carboxy-terminal protease; Provisional 97.5
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.5
PRK10898353 serine endoprotease; Provisional 97.49
KOG3938|consensus334 97.44
KOG3834|consensus 462 97.43
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.39
KOG3129|consensus231 97.28
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.18
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.16
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.13
COG3975558 Predicted protease with the C-terminal PDZ domain 97.11
PRK10898353 serine endoprotease; Provisional 97.1
KOG0606|consensus 1205 97.04
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.01
KOG0606|consensus 1205 96.8
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.79
cd01273142 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain. 96.75
KOG1320|consensus473 96.74
KOG1738|consensus638 96.67
PRK09681276 putative type II secretion protein GspC; Provision 96.37
KOG3129|consensus231 96.34
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.32
KOG4407|consensus 1973 96.31
COG3975558 Predicted protease with the C-terminal PDZ domain 96.2
KOG3532|consensus 1051 95.96
KOG1421|consensus 955 95.85
PF1281278 PDZ_1: PDZ-like domain 95.78
cd01267132 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, 95.68
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.67
KOG1421|consensus955 95.62
cd01274127 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) doma 95.49
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.09
KOG1738|consensus 638 94.22
KOG3532|consensus 1051 93.91
COG3480342 SdrC Predicted secreted protein containing a PDZ d 93.76
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 93.68
KOG1320|consensus473 93.6
COG3031275 PulC Type II secretory pathway, component PulC [In 93.08
PRK09681276 putative type II secretion protein GspC; Provision 91.87
cd01270140 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phos 91.26
KOG3834|consensus462 91.15
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 90.43
PF00640140 PID: Phosphotyrosine interaction domain (PTB/PID) 89.41
cd01268138 Numb Numb Phosphotyrosine-binding (PTB) domain. Nu 87.18
smart00462134 PTB Phosphotyrosine-binding domain, phosphotyrosin 87.01
PF1281278 PDZ_1: PDZ-like domain 84.77
cd01216123 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, ph 81.0
cd00934123 PTB Phosphotyrosine-binding (PTB) domain. Phosphot 80.22
>KOG3605|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.3e-57  Score=460.09  Aligned_cols=213  Identities=59%  Similarity=0.887  Sum_probs=196.8

Q ss_pred             hhhhhhhhccccccceeeecCcEEEEEEeecCCCCCCC---C----CCCCCCCCccccccccce----------------
Q psy3479           8 VHKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEAD---E----PPKISRTPKMICHVFESD----------------   64 (518)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~rr~~~~~~~~---~----~~~~~~~~~~~~~vf~s~----------------   64 (518)
                      .+||+||||+||||||||||||+||||||||+.+....   +    .++.+|+||||||||+|+                
T Consensus       523 dlqe~mmdhaLrtisyiadIg~lvvlMarrr~~~~s~~~~~~~~~~~~~~~rtpKMICHVFESdeAQfIAQSIGQAFqVA  602 (829)
T KOG3605|consen  523 DLQETMMDHALRTISYIADIGNVVVLMARRRDVRSSSEDCSEDIDPAQKGNRTPKMICHVFESDEAQFIAQSIGQAFQVA  602 (829)
T ss_pred             hhHHhhhhhhhhhhHHHhhhhHHHHHHHHhhcccccccccCCCCCcccccCCCcceEEEEeccchHHHHHHHHHHHHHHH
Confidence            58999999999999999999999999999999765332   2    246789999999999998                


Q ss_pred             ---------------------------------------------eEEEEccCCcceeEEEEecCCcCCCCcEEEEEecC
Q psy3479          65 ---------------------------------------------EVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAP   99 (518)
Q Consensus        65 ---------------------------------------------~v~l~k~~~~~lG~~l~~~~~~~~~~~~~V~~v~~   99 (518)
                                                                   ||+|+|.+|++||+.|++++||+.+|+++|+++++
T Consensus       603 Y~EFLrANGI~~e~l~~q~dYqevlNsQei~gDeLe~FakkE~qKEVvv~K~kGEiLGVViVESGWGSmLPTVViAnmm~  682 (829)
T KOG3605|consen  603 YMEFLRANGIEPEDLVSQMDYQEVLNSQEIFGDELEHFAKKENQKEVVLEKHKGEILGVVIVESGWGSILPTVVIANMMH  682 (829)
T ss_pred             HHHHHHHcCCCchHhhhhcchhhccchhhhhccHHHHhhhhcccceeeeecccCceeeEEEEecCccccchHHHHHhccc
Confidence                                                         49999999999999999999999999999999999


Q ss_pred             CChhhhcCCCCCCCEEEEECCEEcCCCCHHHHHHHHhcCCCCcEEEEEEEeCCceeEEEeeCCCCccccceEecCCCCCC
Q psy3479         100 AGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKNSKNQTVVKLTVVPCAPVVEVKIKRPDTKYQLGFSVQNGVAPE  179 (518)
Q Consensus       100 gg~A~~~G~L~~GD~Il~VNg~~l~~~~~~~~~~~l~~~~~~~~v~l~v~~~~~~~~~~~~rp~~~~~~g~~v~~~~~~~  179 (518)
                      +|||+|+|+|.+||+|++|||++|+|+++..|+.+||+.++++.|+|+|++|||+++++|+||+.+|||||+|++|++= 
T Consensus       683 ~GpAarsgkLnIGDQiiaING~SLVGLPLstcQs~Ik~~KnQT~VkltiV~cpPV~~V~I~RPd~kyQLGFSVQNGiIC-  761 (829)
T KOG3605|consen  683 GGPAARSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQTAVKLNIVSCPPVTTVLIRRPDLRYQLGFSVQNGIIC-  761 (829)
T ss_pred             CChhhhcCCccccceeEeecCceeccccHHHHHHHHhcccccceEEEEEecCCCceEEEeecccchhhccceeeCcEee-
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999988772 


Q ss_pred             CCCCCCCcccccccccceeEeeecccCCCCCCCCCCccceeeeceEEEEcccchhhhhHHHHHHHhhcc
Q psy3479         180 GETQPSTEVDLFISTEKIMVLNTDLKAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYI  248 (518)
Q Consensus       180 ~~~~P~~~~~~~~s~~~~gi~v~~i~~p~g~a~~~~~g~L~~gD~il~Vng~~~~~~~~~eav~~lk~~  248 (518)
                                            +-.  -||-|.+.   ++++|.+|++|||.++-.+.|+..+++|..+
T Consensus       762 ----------------------SLl--RGGIAERG---GVRVGHRIIEINgQSVVA~pHekIV~lLs~a  803 (829)
T KOG3605|consen  762 ----------------------SLL--RGGIAERG---GVRVGHRIIEINGQSVVATPHEKIVQLLSNA  803 (829)
T ss_pred             ----------------------hhh--cccchhcc---CceeeeeEEEECCceEEeccHHHHHHHHHHh
Confidence                                  222  36767665   8999999999999999999999999999765

>KOG3209|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd01209 SHC SHC phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>cd01273 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>cd01267 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>cd01274 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>cd01270 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains Back     alignment and domain information
>cd01268 Numb Numb Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>smart00462 PTB Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>cd01216 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd00934 PTB Phosphotyrosine-binding (PTB) domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
3suz_A287 Crystal Structure Of Rat Mint2 Ppc Length = 287 6e-66
3suz_A287 Crystal Structure Of Rat Mint2 Ppc Length = 287 6e-18
1u3b_A185 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 2e-39
1u3b_A185 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 5e-26
1u3b_A 185 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 4e-23
4dbb_A162 The Ptb Domain Of Mint1 Is Autoinhibited By A Helix 1e-38
3sv1_A190 Crystal Structure Of App Peptide Bound Rat Mint2 Pa 4e-37
1aqc_A172 X11 Ptb Domain-10mer Peptide Complex Length = 172 5e-34
1u38_A89 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 2e-27
1u38_A89 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 5e-24
1u38_A89 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 3e-23
1x45_A98 Solution Structure Of The First Pdz Domain Of Amylo 3e-27
1x45_A98 Solution Structure Of The First Pdz Domain Of Amylo 2e-23
2yt7_A101 Solution Structure Of The Pdz Domain Of Amyloid Bet 8e-24
2yt7_A101 Solution Structure Of The Pdz Domain Of Amyloid Bet 2e-18
2yt7_A101 Solution Structure Of The Pdz Domain Of Amyloid Bet 1e-17
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 1e-06
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 2e-06
2qt5_A200 Crystal Structure Of Grip1 Pdz12 In Complex With Th 3e-06
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 6e-06
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 1e-05
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 1e-05
1p1d_A196 Structural Insights Into The Inter-Domain Chaperoni 2e-04
1n3h_A207 Coupling Of Folding And Binding In The Ptb Domain O 2e-04
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 2e-04
2l1c_A211 Shc-Ptb:biphosphorylated Integrin Beta3 Cytoplasmic 2e-04
2yt8_A94 Solution Structure Of The Pdz Domain Of Amyloid Bet 3e-04
1shc_A195 Shc Ptb Domain Complexed With A Trka Receptor Phosp 3e-04
1uew_A114 Solution Structure Of The Forth Pdz Domain Of Human 3e-04
3hvq_C170 Crystal Structure Of A Complex Between Protein Phos 5e-04
1u39_A80 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 6e-04
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 7e-04
2fn5_A94 Nmr Structure Of The Neurabin Pdz Domain (502-594) 8e-04
>pdb|1U3B|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 185 Back     alignment and structure
>pdb|1U3B|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 185 Back     alignment and structure
>pdb|1U3B|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 185 Back     alignment and structure
>pdb|4DBB|A Chain A, The Ptb Domain Of Mint1 Is Autoinhibited By A Helix In The C-Terminal Linker Region Length = 162 Back     alignment and structure
>pdb|3SV1|A Chain A, Crystal Structure Of App Peptide Bound Rat Mint2 Parm Length = 190 Back     alignment and structure
>pdb|1AQC|A Chain A, X11 Ptb Domain-10mer Peptide Complex Length = 172 Back     alignment and structure
>pdb|1U38|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 89 Back     alignment and structure
>pdb|1U38|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 89 Back     alignment and structure
>pdb|1U38|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 89 Back     alignment and structure
>pdb|1X45|A Chain A, Solution Structure Of The First Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A, Member 1 Length = 98 Back     alignment and structure
>pdb|1X45|A Chain A, Solution Structure Of The First Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A, Member 1 Length = 98 Back     alignment and structure
>pdb|2YT7|A Chain A, Solution Structure Of The Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A Member 3 Length = 101 Back     alignment and structure
>pdb|2YT7|A Chain A, Solution Structure Of The Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A Member 3 Length = 101 Back     alignment and structure
>pdb|2YT7|A Chain A, Solution Structure Of The Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A Member 3 Length = 101 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2QT5|A Chain A, Crystal Structure Of Grip1 Pdz12 In Complex With The Fras1 Peptide Length = 200 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|1P1D|A Chain A, Structural Insights Into The Inter-Domain Chaperoning Of Tandem Pdz Domains In Glutamate Receptor Interacting Proteins Length = 196 Back     alignment and structure
>pdb|1N3H|A Chain A, Coupling Of Folding And Binding In The Ptb Domain Of The Signaling Protein Shc Length = 207 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2L1C|A Chain A, Shc-Ptb:biphosphorylated Integrin Beta3 Cytoplasmic Tail Complex (1:1) Length = 211 Back     alignment and structure
>pdb|2YT8|A Chain A, Solution Structure Of The Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A Member 3 (Neuron- Specific X11l2 Protein) (Neuronal Munc18-1-Interacting Protein 3) (Mint-3) (Adapter Protein X11gamma) Length = 94 Back     alignment and structure
>pdb|1SHC|A Chain A, Shc Ptb Domain Complexed With A Trka Receptor Phosphopeptide, Nmr, Minimized Average Structure Length = 195 Back     alignment and structure
>pdb|1UEW|A Chain A, Solution Structure Of The Forth Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 114 Back     alignment and structure
>pdb|3HVQ|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Neurabin Length = 170 Back     alignment and structure
>pdb|1U39|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 80 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|2FN5|A Chain A, Nmr Structure Of The Neurabin Pdz Domain (502-594) Length = 94 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 5e-67
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 6e-26
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-14
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 3e-10
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 4e-10
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 5e-33
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 1e-10
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 1e-32
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 3e-07
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-31
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 2e-24
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-23
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-31
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 7e-20
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-14
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 8e-12
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-29
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-17
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-13
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-29
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 4e-14
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 5e-14
3r0h_A 206 INAD, inactivation-NO-after-potential D protein; p 8e-13
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 5e-29
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 3e-20
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-11
2ela_A175 Adapter protein containing PH domain, PTB domain a 6e-27
2ela_A175 Adapter protein containing PH domain, PTB domain a 1e-08
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 3e-23
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 2e-07
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 1e-21
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 5e-04
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 7e-21
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 2e-05
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 2e-20
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 4e-20
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 7e-18
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 7e-12
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-04
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-19
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-16
2xkx_A721 Disks large homolog 4; structural protein, scaffol 1e-07
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 4e-06
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 3e-04
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 3e-19
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 5e-16
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 1e-15
1n3h_A207 SHC transforming protein; free protein, beta sandw 4e-19
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 8e-19
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-16
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-15
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 9e-18
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 7e-05
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 4e-17
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 4e-04
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-16
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-14
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-13
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-16
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 8e-13
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-12
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 6e-16
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 2e-13
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 6e-13
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 9e-16
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-12
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-12
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 7e-15
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-12
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 5e-12
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-14
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-12
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 4e-12
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 3e-14
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 1e-11
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 3e-11
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 3e-14
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 6e-12
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 7e-12
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 4e-14
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 9e-13
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 1e-11
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-13
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 6e-12
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-11
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 1e-13
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 4e-11
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 1e-10
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 2e-13
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 1e-11
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 2e-11
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-13
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-11
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 6e-11
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-13
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 3e-12
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 8e-11
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-13
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-10
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-10
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 4e-13
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 1e-09
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 3e-09
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-12
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 4e-11
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-10
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 1e-12
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 3e-09
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 4e-09
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 2e-12
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 5e-12
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 6e-12
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-12
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 4e-11
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-10
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-12
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 8e-10
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 2e-09
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 3e-12
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 1e-10
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 4e-10
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 4e-12
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 2e-11
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 3e-11
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 4e-12
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 2e-10
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 5e-10
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 4e-12
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 3e-11
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 7e-11
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-12
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-11
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-11
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 6e-12
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-11
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 6e-10
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 6e-12
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-10
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-10
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 6e-12
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 5e-11
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 9e-11
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 9e-12
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-09
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 3e-09
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 1e-11
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 3e-09
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 5e-09
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 1e-11
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 3e-09
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 4e-09
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 1e-11
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 5e-10
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 8e-10
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 1e-11
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 4e-10
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 9e-10
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-11
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 6e-11
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 4e-10
2opg_A98 Multiple PDZ domain protein; structural protein, s 2e-11
2opg_A98 Multiple PDZ domain protein; structural protein, s 5e-11
2opg_A98 Multiple PDZ domain protein; structural protein, s 1e-09
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 2e-11
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 6e-09
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 6e-09
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 2e-11
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 7e-11
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-09
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-11
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 7e-09
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-08
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 3e-11
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-08
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-08
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 3e-11
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 1e-09
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-09
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 3e-11
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 4e-11
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 1e-10
2djt_A104 Unnamed protein product; PDZ domain, structural ge 4e-11
2djt_A104 Unnamed protein product; PDZ domain, structural ge 3e-09
2djt_A104 Unnamed protein product; PDZ domain, structural ge 3e-09
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 4e-11
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 4e-09
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 5e-09
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 4e-11
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 5e-09
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 5e-09
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 4e-11
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 5e-10
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 2e-09
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 4e-11
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 2e-08
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 2e-08
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 5e-11
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 7e-10
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 2e-08
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 5e-11
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 2e-09
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 3e-09
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 5e-11
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 8e-09
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 2e-08
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 6e-11
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 2e-10
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 1e-09
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 9e-11
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 3e-08
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 3e-08
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 9e-11
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-09
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-09
1z87_A 263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-10
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 4e-10
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 8e-10
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 1e-10
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 9e-10
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 2e-09
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-10
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-09
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-09
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 1e-10
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 4e-08
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 4e-08
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 2e-10
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 5e-09
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 6e-09
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-10
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-08
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-08
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 2e-10
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 8e-10
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 1e-09
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-10
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 9e-09
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 1e-08
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 3e-10
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-08
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-08
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-10
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-09
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-09
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 3e-10
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 3e-09
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 3e-09
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 4e-10
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 1e-09
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 4e-09
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 4e-10
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 1e-09
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 3e-09
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 5e-10
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 1e-08
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 1e-08
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 6e-10
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 1e-09
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 9e-09
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 6e-10
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 5e-09
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-08
2byg_A117 Channel associated protein of synapse-110; DLG2, P 6e-10
2byg_A117 Channel associated protein of synapse-110; DLG2, P 2e-08
2byg_A117 Channel associated protein of synapse-110; DLG2, P 3e-08
2awx_A105 Synapse associated protein 97; membrane protein, s 6e-10
2awx_A105 Synapse associated protein 97; membrane protein, s 2e-08
2awx_A105 Synapse associated protein 97; membrane protein, s 2e-08
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 6e-10
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 1e-08
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 4e-08
2fne_A117 Multiple PDZ domain protein; structural protein, s 7e-10
2fne_A117 Multiple PDZ domain protein; structural protein, s 3e-09
2fne_A117 Multiple PDZ domain protein; structural protein, s 7e-09
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 7e-10
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 9e-08
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 3e-07
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 8e-10
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 8e-09
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 8e-09
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 9e-10
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 4e-09
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 5e-09
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 9e-10
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 5e-08
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 5e-08
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 9e-10
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 1e-08
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 1e-08
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 1e-09
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 2e-08
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 2e-08
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-09
2o2t_A117 Multiple PDZ domain protein; structural protein, s 5e-09
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-08
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 1e-09
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 6e-08
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 7e-08
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 2e-09
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 8e-09
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 1e-08
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 4e-09
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 1e-08
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 3e-08
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 4e-09
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 3e-06
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 9e-06
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 4e-09
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 8e-08
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 2e-07
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 5e-09
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 5e-09
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 1e-08
3k1r_A192 Harmonin; protein-protein complex, alternative spl 5e-09
3k1r_A192 Harmonin; protein-protein complex, alternative spl 7e-07
3k1r_A192 Harmonin; protein-protein complex, alternative spl 2e-06
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 6e-09
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 3e-08
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 4e-08
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 6e-09
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 8e-07
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 1e-06
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 7e-09
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 2e-06
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 3e-06
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 1e-08
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 5e-07
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 3e-06
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 1e-08
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 6e-08
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 1e-07
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 1e-08
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 5e-07
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 2e-06
2eeh_A100 PDZ domain-containing protein 7; structural genomi 1e-08
2eeh_A100 PDZ domain-containing protein 7; structural genomi 2e-07
2eeh_A100 PDZ domain-containing protein 7; structural genomi 3e-07
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 2e-08
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 7e-06
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 7e-06
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-08
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 3e-07
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-06
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 2e-08
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 2e-08
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 5e-08
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-08
2eaq_A90 LIM domain only protein 7; conserved hypothetical 7e-06
2eaq_A90 LIM domain only protein 7; conserved hypothetical 1e-05
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 2e-08
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 3e-08
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 8e-08
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 4e-08
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-06
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 3e-05
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 6e-08
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 1e-06
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 2e-06
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 7e-08
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 2e-05
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 2e-05
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 7e-08
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-05
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-05
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 8e-08
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 2e-05
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 2e-05
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 9e-08
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 2e-05
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 2e-05
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 9e-08
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-05
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-05
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 9e-08
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 2e-05
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 3e-05
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 1e-07
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 4e-05
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 4e-05
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 1e-07
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 4e-05
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 4e-05
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 2e-07
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 2e-06
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 2e-06
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-07
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-06
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-06
2dyq_A144 Amyloid beta A4 precursor protein-binding family 3 2e-07
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 2e-07
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 5e-05
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 2e-04
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 2e-07
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 5e-05
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 5e-05
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 3e-07
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 4e-05
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 1e-04
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 4e-07
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 6e-05
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 6e-05
2ego_A96 General receptor for phosphoinositides 1- associat 4e-07
2ego_A96 General receptor for phosphoinositides 1- associat 2e-05
2ego_A96 General receptor for phosphoinositides 1- associat 5e-05
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 4e-07
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 8e-05
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 1e-04
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 5e-07
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 1e-04
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 2e-04
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 5e-07
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 4e-05
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 4e-05
3khf_A99 Microtubule-associated serine/threonine-protein ki 6e-07
3khf_A99 Microtubule-associated serine/threonine-protein ki 2e-04
3khf_A99 Microtubule-associated serine/threonine-protein ki 5e-04
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 6e-07
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-05
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-05
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 7e-07
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 3e-06
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 6e-06
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 9e-07
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 2e-04
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 2e-04
2v90_A96 PDZ domain-containing protein 3; membrane, protein 1e-06
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-05
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-05
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 1e-06
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 7e-04
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 8e-04
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 1e-06
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 7e-05
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 9e-05
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 1e-06
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 1e-04
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 1e-04
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 2e-06
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 1e-04
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 1e-04
2eei_A106 PDZ domain-containing protein 1; regulatory factor 2e-06
2eei_A106 PDZ domain-containing protein 1; regulatory factor 5e-05
2eei_A106 PDZ domain-containing protein 1; regulatory factor 5e-05
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-06
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 6e-05
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 1e-04
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 3e-06
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 1e-04
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 3e-04
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 4e-06
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 1e-04
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 1e-04
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 4e-06
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 4e-04
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 4e-04
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 4e-06
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-05
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 2e-05
2d90_A102 PDZ domain containing protein 1; structural genomi 4e-06
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-04
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-04
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 4e-06
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-04
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-04
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 4e-06
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 5e-06
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 6e-06
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 1e-04
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 1e-04
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 9e-06
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 6e-04
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 7e-04
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 1e-05
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-04
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 4e-04
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 1e-05
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 1e-04
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-04
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 4e-05
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 4e-05
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 6e-05
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 4e-04
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 5e-05
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 5e-04
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 5e-04
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 6e-05
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 7e-05
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 1e-04
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 8e-04
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 9e-05
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 6e-04
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 6e-04
2ysz_A185 Amyloid beta A4 precursor protein-binding family B 1e-04
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 2e-04
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 3e-04
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
 Score =  220 bits (560), Expect = 5e-67
 Identities = 147/345 (42%), Positives = 203/345 (58%), Gaps = 17/345 (4%)

Query: 175 GVAPEGETQPSTEVDLFISTEKIMVLNTDLKAPEGETQPSTEVDLFISTEKIMVLNTDLK 234
             +       + E    +   +           EG+ Q  TEVDLFIST++I VLN D +
Sbjct: 26  NPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSEGDAQTLTEVDLFISTQRIKVLNADTQ 85

Query: 235 EIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKIS-------RTPKMICHVFES 287
           E MMDHALRTISYIADIG++VVLMARRR     + +  + +       +  KMICHVFES
Sbjct: 86  ETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFES 145

Query: 288 DEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKEL 347
           ++AQ IAQSIGQAF VAY EFL+ANGI       + +Y +++N+QE++ D+L  F+  E 
Sbjct: 146 EDAQLIAQSIGQAFSVAYQEFLRANGINPEDL-SQKEYSDIINTQEMYNDDLIHFSNSEN 204

Query: 348 QKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVS 407
            KE+ + K KGEILGVV+VESGWGS+LPTV++AN+   G AAR G+L+IGDQI+++NG S
Sbjct: 205 CKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARSGKLSIGDQIMSINGTS 264

Query: 408 LVGLPLSTCQTYIKILMKTMPTSMFRLLTGQETPVVVPKAKGEILGVVIVESGWGSMLPT 467
           LVGLPL+TCQ  IK L       +  +     T V++ +           +   G  +  
Sbjct: 265 LVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDL--------KYQLGFSVQN 316

Query: 468 VVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIK 512
            +I +L   G A R G + +G +II +NG S+V          + 
Sbjct: 317 GIICSLMRGGIAERGG-VRVGHRIIEINGQSVVATAHEKIVQALS 360
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Length = 172 Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Length = 172 Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Length = 162 Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Length = 162 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Length = 175 Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Length = 175 Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Length = 160 Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Length = 160 Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Length = 160 Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Length = 160 Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Length = 168 Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Length = 168 Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Length = 152 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* Length = 207 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} PDB: 3dxd_A 3dxc_A Length = 140 Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} PDB: 3dxd_A 3dxc_A Length = 140 Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Length = 137 Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Length = 137 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Length = 144 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Length = 185 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 100.0
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.97
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.96
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.94
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.9
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.89
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.86
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.86
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.85
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.83
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.81
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.8
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.79
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.75
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.68
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.67
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.66
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.6
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.58
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.57
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.55
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.54
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.54
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.53
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.53
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.52
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.52
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.52
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.52
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.52
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.52
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.51
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.51
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.51
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.51
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.5
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.5
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.5
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.5
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.5
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.49
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.49
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.49
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.49
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.49
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.48
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.48
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.48
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.48
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.48
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.48
2awx_A105 Synapse associated protein 97; membrane protein, s 99.48
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.48
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.48
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.47
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.47
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.47
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.47
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.47
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.47
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.46
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.46
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.46
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.46
2ego_A96 General receptor for phosphoinositides 1- associat 99.46
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.45
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.45
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.45
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.45
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.45
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.45
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.44
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.44
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.44
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.44
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.44
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.44
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.44
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.43
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.43
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.43
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.43
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.43
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.43
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.42
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.42
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.42
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.42
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.42
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.42
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.41
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.41
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.41
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.41
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.41
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.41
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.4
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.4
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.4
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.4
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.4
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.4
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.4
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.4
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.39
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.39
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.39
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.38
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.38
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.38
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.38
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.38
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.37
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.37
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.37
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.36
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.35
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.35
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.35
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.35
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.35
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.35
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.35
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.34
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.34
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.34
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.34
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.34
2d90_A102 PDZ domain containing protein 1; structural genomi 99.33
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.33
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.33
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.33
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.32
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.31
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.31
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.31
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.3
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.3
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.3
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.3
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.3
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.3
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.29
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.29
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.29
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.29
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.29
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.28
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.28
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.28
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.28
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.28
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.28
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.27
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.27
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.27
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.27
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.27
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.27
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.26
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.26
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.26
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.26
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.25
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.24
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.24
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.24
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.24
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.24
2awx_A105 Synapse associated protein 97; membrane protein, s 99.24
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.23
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.23
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.23
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.23
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.23
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.22
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.22
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.22
2ego_A96 General receptor for phosphoinositides 1- associat 99.22
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.22
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.22
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.21
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.21
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.21
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.21
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.21
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.84
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.21
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.2
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.2
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.2
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.2
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.2
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.19
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.19
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.19
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.19
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.19
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.19
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.19
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.19
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.19
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.18
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.18
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.18
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.18
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.18
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.17
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.17
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.17
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.17
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.17
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.16
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.16
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.16
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.16
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.16
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.16
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.16
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.16
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.16
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.15
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.15
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.15
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.15
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.15
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.15
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.14
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.14
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.14
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.14
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.14
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.14
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.14
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.14
2d90_A102 PDZ domain containing protein 1; structural genomi 99.13
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.13
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.13
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.13
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.13
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.13
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.13
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.13
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.12
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.12
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.12
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.12
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.12
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.11
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.11
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.11
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.11
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.11
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.11
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.1
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.1
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.1
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.1
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.1
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.1
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.1
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.1
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.09
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.09
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.09
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.08
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.08
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.08
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.08
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.08
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.07
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.06
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.06
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.05
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 99.05
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.04
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.04
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.04
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.04
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.04
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.02
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.02
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.02
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.01
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.01
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.01
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.01
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.01
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.01
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.0
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.0
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.0
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.0
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.99
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.99
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.98
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.98
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.98
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.98
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.98
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.97
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.97
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.51
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.95
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.95
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.94
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.94
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.94
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.91
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.9
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.89
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.89
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.89
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.88
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.86
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.86
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.85
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.84
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.84
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.84
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.84
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.84
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.82
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.8
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.8
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.8
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.8
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 98.78
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.78
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.77
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.77
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.71
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.69
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.66
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.61
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.59
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.57
2kl1_A94 YLBL protein; structure genomics, structural genom 98.51
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.51
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 98.46
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.43
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.43
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.38
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.35
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.29
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.28
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.22
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.19
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.17
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.17
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.17
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.15
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.15
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.15
3k50_A403 Putative S41 protease; structural genomics, joint 98.14
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.14
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.12
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.1
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.08
2kl1_A94 YLBL protein; structure genomics, structural genom 98.07
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 98.07
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.06
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.04
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.94
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 97.92
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 97.91
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.85
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.83
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.7
3k50_A 403 Putative S41 protease; structural genomics, joint 97.66
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 97.64
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.61
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.57
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.56
2ela_A175 Adapter protein containing PH domain, PTB domain a 97.56
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.52
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.45
1k32_A1045 Tricorn protease; protein degradation, substrate g 97.4
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.31
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.29
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.14
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 95.99
1n3h_A207 SHC transforming protein; free protein, beta sandw 95.86
1k32_A 1045 Tricorn protease; protein degradation, substrate g 95.79
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 95.72
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 95.24
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 95.24
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 94.86
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 92.63
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
Probab=100.00  E-value=2.9e-35  Score=303.57  Aligned_cols=225  Identities=51%  Similarity=0.772  Sum_probs=131.0

Q ss_pred             cccchhhhhhhhccccccceeeecCcEEEEEEeecCCCCCC---C----CCCCCCCCCccccccccce------------
Q psy3479           4 FNDRVHKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEA---D----EPPKISRTPKMICHVFESD------------   64 (518)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rr~~~~~~~---~----~~~~~~~~~~~~~~vf~s~------------   64 (518)
                      +-+.-|||+||+|+||+|||+||+++++++|||++......   .    .+...+++++|+||||+++            
T Consensus        79 v~~~~t~~~~~~~~l~~IS~~~d~~~~~~~iak~~~~~~~~~~~~~~~~~~~~~~~~~~~~ChvF~s~~a~~i~~ti~qa  158 (388)
T 3suz_A           79 VLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQA  158 (388)
T ss_dssp             EEETTTCCEEEEEEGGGEEEEEECSSEEEEEEEECCCCCC-------------CCCCEEEEEEEEECTTHHHHHHHHHHH
T ss_pred             EEecCCcChhhhccccceeEEeecCceEEEEEecCCCccccccccccCccccccccccceEEEEecccCHHHHHHHHHHH
Confidence            34455899999999999999999999999999998865432   1    1134678999999999987            


Q ss_pred             ------------------------------------------------eEEEEccCCcceeEEEEecCCcCCCCcEEEEE
Q psy3479          65 ------------------------------------------------EVVVPKAKGEILGVVIVESGWGSMLPTVVIAN   96 (518)
Q Consensus        65 ------------------------------------------------~v~l~k~~~~~lG~~l~~~~~~~~~~~~~V~~   96 (518)
                                                                      +|+|.|.+|++|||+|.+.++|...++++|.+
T Consensus       159 f~~~y~~~l~~~gi~~~~~~~~~y~~~~~~~~~~~d~~~~~~~~~~~~~V~i~k~~ge~lG~~i~~~~~g~~~~g~~V~~  238 (388)
T 3suz_A          159 FSVAYQEFLRANGINPEDLSQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILAN  238 (388)
T ss_dssp             HHHHHHHHHHHHTCCTTTSCHHHHHHHHHHHHHHHHHHHHTCCSSCCEEEEECCCSSCCCCCCCBCC---CCSCCCBCCC
T ss_pred             HHHHhhhhccccCcCccccchhhhcccccccccccchhhhhcccccceEEEEECCCCCceeEEEEecCCCCcCCCEEEEe
Confidence                                                            38999998999999999888877788899999


Q ss_pred             ecCCChhhhcCCCCCCCEEEEECCEEcCCCCHHHHHHHHhcCCCCcEEEEEEEeCCceeEEEeeCCCCccccceEecCCC
Q psy3479          97 LAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKNSKNQTVVKLTVVPCAPVVEVKIKRPDTKYQLGFSVQNGV  176 (518)
Q Consensus        97 v~~gg~A~~~G~L~~GD~Il~VNg~~l~~~~~~~~~~~l~~~~~~~~v~l~v~~~~~~~~~~~~rp~~~~~~g~~v~~~~  176 (518)
                      |.|||||+++|+|++||+|++|||+++.+++|.+++.+|+..+.+..|+|+|.|.++..++.+.+++...++||++.++ 
T Consensus       239 V~~gspA~~aG~L~~GD~Il~VnG~~v~~~~~~~~~~~l~~~~~~~~v~l~v~r~~~~~~v~l~~~~~~~~lG~~i~~g-  317 (388)
T 3suz_A          239 MMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLGFSVQNG-  317 (388)
T ss_dssp             CCCSSHHHHTCCCCTTCEEEEETTEECSSCCSTTHHHHTTTCTTCSCEEEEEEECCSCC---------------------
T ss_pred             eCCCCHHHHcCCCCCCCEEEEECCEEccCCCHHHHHHHHHhccCCCccccccccccccceeeEeecCCCCccceEEecC-
Confidence            9999999999999999999999999999999999999999987667899999999888888887777777788876542 


Q ss_pred             CCCCCCCCCCcccccccccceeEeeecccCCCCCCCCCCccceeeeceEEEEcccchhhhhHHHHHHHhhcccccccEEE
Q psy3479         177 APEGETQPSTEVDLFISTEKIMVLNTDLKAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVV  256 (518)
Q Consensus       177 ~~~~~~~P~~~~~~~~s~~~~gi~v~~i~~p~g~a~~~~~g~L~~gD~il~Vng~~~~~~~~~eav~~lk~~~~~~~lvv  256 (518)
                                             +|..|. |+++|+..   +|+.||+|++|||.++.+.+|+++++.++.......+.+
T Consensus       318 -----------------------~I~~V~-~gs~A~~a---GL~~GD~Il~VNg~~v~~~s~~~~~~~l~~~~~~v~L~V  370 (388)
T 3suz_A          318 -----------------------IICSLM-RGGIAERG---GVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHMKT  370 (388)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             -----------------------EEEEee-cCCHHHHc---CCCCCCEEEEECCEECCCCCHHHHHHHHHhCCCeEEEEE
Confidence                                   566676 89999887   499999999999999999999999999987644443333
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Back     alignment and structure
>1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 518
d1aqca_166 b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 96 3e-35
d1aqca_166 b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 96 1e-13
d1oy2a_191 b.55.1.2 (A:) Shc adaptor protein {Human (Homo sap 1e-27
d1oy2a_191 b.55.1.2 (A:) Shc adaptor protein {Human (Homo sap 2e-07
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 4e-23
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 2e-17
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 9e-17
d1p3ra_148 b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mu 3e-19
d1wj1a_156 b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 1 2e-18
d1wj1a_156 b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 1 1e-04
d1ntva_152 b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mu 1e-16
d1ddma_135 b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanoga 3e-16
d1ddma_135 b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanoga 1e-04
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 1e-14
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 8e-12
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 4e-09
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 2e-13
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 1e-10
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 2e-09
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 3e-13
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 3e-09
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 6e-09
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-12
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-11
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-10
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 3e-12
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 5e-10
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 9e-10
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 3e-12
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 1e-09
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-09
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 4e-12
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 9e-12
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-09
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 1e-11
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 9e-09
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 3e-08
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-11
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-07
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-07
d1wgua_136 b.55.1.2 (A:) Amyloid beta A4 precursor protein-bi 1e-11
d1wgua_136 b.55.1.2 (A:) Amyloid beta A4 precursor protein-bi 6e-05
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-11
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 1e-07
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-07
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 3e-11
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 1e-09
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 7e-09
d2cy5a1129 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {M 4e-11
d2cy5a1129 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {M 0.002
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-11
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-07
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-07
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 7e-11
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-09
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-08
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-11
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-07
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-07
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 1e-10
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-10
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 4e-08
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 1e-10
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 7e-09
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 2e-08
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 1e-10
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 3e-08
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 3e-08
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 1e-10
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 2e-08
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 2e-08
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 2e-10
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 1e-07
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 4e-07
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-10
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 8e-09
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 4e-08
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 6e-10
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-07
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 5e-07
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 9e-10
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-06
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-06
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-09
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-06
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-06
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 3e-09
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 9e-07
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 9e-07
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 3e-09
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 4e-07
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 2e-06
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 5e-09
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 7e-06
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 1e-05
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 5e-09
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 7e-07
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 2e-06
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 7e-09
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-06
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-06
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 1e-08
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 3e-05
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 4e-05
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 2e-08
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 4e-06
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 5e-05
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-08
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 1e-05
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 4e-05
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-08
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 7e-07
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 4e-06
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-08
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 8e-05
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 8e-05
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 2e-07
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 5e-05
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 1e-04
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-07
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 1e-04
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 1e-04
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 3e-07
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 2e-05
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 4e-05
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 4e-07
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 7e-05
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 7e-05
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 4e-07
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 2e-05
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-07
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-04
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-04
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 4e-07
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 9e-05
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 1e-04
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-07
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 4e-05
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-04
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 5e-07
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 3e-04
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 3e-04
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 6e-07
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 8e-05
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 6e-04
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 1e-06
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 2e-05
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 7e-05
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 1e-06
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-06
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-04
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 4e-04
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 2e-06
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 4e-04
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 0.004
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 2e-06
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 7e-04
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 0.001
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-06
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 8e-05
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 4e-04
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 3e-06
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 1e-04
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 4e-04
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 4e-06
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 2e-04
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 6e-04
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 4e-06
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 0.001
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 0.001
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 6e-06
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-04
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 7e-04
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 8e-06
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 6e-04
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 6e-04
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 3e-05
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 3e-05
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.001
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.002
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 8e-05
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 0.004
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 1e-04
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 3e-04
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Phosphotyrosine-binding domain (PTB)
domain: X11
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  127 bits (320), Expect = 3e-35
 Identities = 74/117 (63%), Positives = 86/117 (73%), Gaps = 7/117 (5%)

Query: 201 NTDLKAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMAR 260
            +  KAPEGE+QP TEVDLFI T++I VLN D +E MMDH LRTISYIADIG++VVLMAR
Sbjct: 50  KSRKKAPEGESQPMTEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMAR 109

Query: 261 RRFVSQEADEPPKIS-------RTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLK 310
           RR     + E  + S       R  KMICHVFES++AQ IAQSIGQAF VAY EFL+
Sbjct: 110 RRIPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLR 166
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Length = 156 Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Length = 156 Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 152 Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 135 Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 135 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 129 Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 129 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.84
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.79
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.78
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.76
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.76
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.76
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.76
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.75
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.75
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.74
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.74
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.74
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.73
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.73
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.72
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.72
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.72
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.72
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.71
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.71
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.71
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.71
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.71
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.7
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.7
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.7
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.7
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.69
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.69
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.69
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.68
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.68
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.68
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.66
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.66
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.66
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.66
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.66
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.65
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.63
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.63
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.63
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.63
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.61
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.61
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.6
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.6
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.59
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.58
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.58
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.55
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.54
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.53
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.53
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.52
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.52
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.51
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.5
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.5
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.5
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.5
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.5
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.49
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.49
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.48
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.48
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.47
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.47
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.46
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.46
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.46
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.45
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.45
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.45
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.44
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.43
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.43
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.43
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.43
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.43
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.42
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.42
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.42
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.42
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.42
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.4
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.39
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.38
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.37
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.36
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.36
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.35
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.35
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.34
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.32
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.32
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.31
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.31
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.31
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.26
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.21
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.2
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.12
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.12
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.11
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.07
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.97
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.83
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.81
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.77
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.66
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.66
d1aqca_166 X11 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.46
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.46
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.39
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.36
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.35
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.34
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.21
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.21
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.18
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.03
d1oy2a_191 Shc adaptor protein {Human (Homo sapiens) [TaxId: 95.97
d1wj1a_156 Numb {Mouse (Mus musculus) [TaxId: 10090]} 92.24
d2dkqa1147 Tensin {Human (Homo sapiens) [TaxId: 9606]} 91.4
d1ddma_135 Numb {Fruit fly (Drosophila melanogaster) [TaxId: 90.78
d1aqca_166 X11 {Human (Homo sapiens) [TaxId: 9606]} 88.23
d2cy5a1129 EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) 86.66
d1ntva_152 Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [T 86.62
d1p3ra_148 Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [T 82.78
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=7e-21  Score=150.36  Aligned_cols=85  Identities=67%  Similarity=1.078  Sum_probs=80.0

Q ss_pred             eEEEEccCCcceeEEEEecCCcCCCCcEEEEEecCCChhhhcCCCCCCCEEEEECCEEcCCCCHHHHHHHHhcCCCCcEE
Q psy3479          65 EVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKNSKNQTVV  144 (518)
Q Consensus        65 ~v~l~k~~~~~lG~~l~~~~~~~~~~~~~V~~v~~gg~A~~~G~L~~GD~Il~VNg~~l~~~~~~~~~~~l~~~~~~~~v  144 (518)
                      ||+|+|.+|++|||+|+++++++..+++||.+|.|+|||+++|+|++||+|++|||+++.+++|++|+++||+++++..|
T Consensus         1 eV~l~k~~g~~LGi~i~~~~~~~~~~~i~I~~v~~gg~A~~~G~l~~GD~Il~VNg~~v~~~s~~e~~~~l~~~~~~~~v   80 (85)
T d1x45a1           1 DVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRV   80 (85)
T ss_dssp             EEEEECCTTSCCCEEEECCTTTSSSCCCEEEEECTTCHHHHHCSCCTTCEEEEETTEECTTCCHHHHHHHHHTTTTCSEE
T ss_pred             CeEEEeCCCCccCEEEEeCCCCCCCCCEEEEEeCCCCHHHHcCCCCcCCEEEEECCEECCCCCHHHHHHHHHcCCCCCEE
Confidence            68999999999999999888777788999999999999999999999999999999999999999999999999988888


Q ss_pred             EEEEE
Q psy3479         145 KLTVV  149 (518)
Q Consensus       145 ~l~v~  149 (518)
                      +|+|.
T Consensus        81 ~L~Vv   85 (85)
T d1x45a1          81 KLNIV   85 (85)
T ss_dssp             EEEEE
T ss_pred             EEEEC
Confidence            88874
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure