Psyllid ID: psy351
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 146 | ||||||
| 322800098 | 949 | hypothetical protein SINV_11855 [Solenop | 0.945 | 0.145 | 0.671 | 2e-49 | |
| 307184299 | 917 | Hypoxia up-regulated protein 1 [Camponot | 0.945 | 0.150 | 0.642 | 4e-49 | |
| 345491538 | 923 | PREDICTED: hypoxia up-regulated protein | 0.856 | 0.135 | 0.688 | 2e-48 | |
| 345491532 | 938 | PREDICTED: hypoxia up-regulated protein | 0.856 | 0.133 | 0.688 | 2e-48 | |
| 383847076 | 946 | PREDICTED: hypoxia up-regulated protein | 0.965 | 0.149 | 0.617 | 3e-48 | |
| 328784616 | 951 | PREDICTED: hypoxia up-regulated protein | 0.897 | 0.137 | 0.656 | 5e-48 | |
| 380029680 | 952 | PREDICTED: hypoxia up-regulated protein | 0.897 | 0.137 | 0.656 | 1e-47 | |
| 332031611 | 952 | Hypoxia up-regulated protein 1 [Acromyrm | 0.828 | 0.127 | 0.702 | 4e-47 | |
| 307192771 | 946 | Hypoxia up-regulated protein 1 [Harpegna | 0.938 | 0.144 | 0.652 | 6e-47 | |
| 403183091 | 925 | AAEL017263-PA [Aedes aegypti] | 0.897 | 0.141 | 0.636 | 3e-46 |
| >gi|322800098|gb|EFZ21204.1| hypothetical protein SINV_11855 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 200 bits (508), Expect = 2e-49, Method: Compositional matrix adjust.
Identities = 94/140 (67%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
Query: 7 ISLVTLCSSVVLLLTLFEHSYGIAVMSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPT 66
IS+ +L S++L+ T S IAVMS+DLGSEWMKVAIVSPGVPMEIALNKESKRKTP
Sbjct: 8 ISMASL--SLLLIATFIGISEEIAVMSIDLGSEWMKVAIVSPGVPMEIALNKESKRKTPV 65
Query: 67 LVAFHKGERTFGEDAQIIGTRFPSNSYGYFLDLLGKSIDSPVVQLFKSRFPYYDIVADEE 126
++AF GER+FGEDAQ+IG RFP N++ Y LDLLGK ID+P+VQL++ RFPYYDIVAD+E
Sbjct: 66 VIAFRDGERSFGEDAQVIGVRFPQNTFFYILDLLGKPIDNPLVQLYRDRFPYYDIVADDE 125
Query: 127 RGTIVFKTNDNELYHVEELV 146
R TI F+ N+N Y EEL+
Sbjct: 126 RKTIAFRLNENTTYTPEELI 145
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307184299|gb|EFN70757.1| Hypoxia up-regulated protein 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|345491538|ref|XP_003426636.1| PREDICTED: hypoxia up-regulated protein 1-like isoform 4 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345491532|ref|XP_003426634.1| PREDICTED: hypoxia up-regulated protein 1-like isoform 2 [Nasonia vitripennis] gi|345491534|ref|XP_001606217.2| PREDICTED: hypoxia up-regulated protein 1-like isoform 1 [Nasonia vitripennis] gi|345491536|ref|XP_003426635.1| PREDICTED: hypoxia up-regulated protein 1-like isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383847076|ref|XP_003699181.1| PREDICTED: hypoxia up-regulated protein 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328784616|ref|XP_624153.3| PREDICTED: hypoxia up-regulated protein 1-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380029680|ref|XP_003698495.1| PREDICTED: hypoxia up-regulated protein 1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|332031611|gb|EGI71083.1| Hypoxia up-regulated protein 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307192771|gb|EFN75861.1| Hypoxia up-regulated protein 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|403183091|gb|EJY57847.1| AAEL017263-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 146 | ||||||
| FB|FBgn0023529 | 923 | CG2918 [Drosophila melanogaste | 0.828 | 0.131 | 0.669 | 2.2e-40 | |
| UNIPROTKB|Q5ZLK7 | 1002 | HYOU1 "Hypoxia up-regulated pr | 0.835 | 0.121 | 0.532 | 4.9e-29 | |
| UNIPROTKB|F1NJZ5 | 980 | HYOU1 "Hypoxia up-regulated pr | 0.808 | 0.120 | 0.542 | 1.6e-28 | |
| UNIPROTKB|F1NY05 | 986 | HYOU1 "Hypoxia up-regulated pr | 0.808 | 0.119 | 0.542 | 1.6e-28 | |
| ZFIN|ZDB-GENE-030131-5344 | 980 | hyou1 "hypoxia up-regulated 1" | 0.808 | 0.120 | 0.508 | 4.7e-26 | |
| UNIPROTKB|J3KTF1 | 224 | HYOU1 "Hypoxia up-regulated pr | 0.808 | 0.526 | 0.491 | 2.2e-25 | |
| UNIPROTKB|J3QL06 | 211 | HYOU1 "Hypoxia up-regulated pr | 0.808 | 0.559 | 0.491 | 2.2e-25 | |
| UNIPROTKB|E9PJ21 | 656 | HYOU1 "Hypoxia up-regulated pr | 0.808 | 0.179 | 0.491 | 1.8e-24 | |
| UNIPROTKB|E9PL22 | 937 | HYOU1 "Hypoxia up-regulated pr | 0.808 | 0.125 | 0.491 | 3.7e-24 | |
| UNIPROTKB|Q9Y4L1 | 999 | HYOU1 "Hypoxia up-regulated pr | 0.808 | 0.118 | 0.491 | 4.1e-24 |
| FB|FBgn0023529 CG2918 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 439 (159.6 bits), Expect = 2.2e-40, P = 2.2e-40
Identities = 81/121 (66%), Positives = 100/121 (82%)
Query: 26 SYGIAVMSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGERTFGEDAQIIG 85
S G AVMSVDLGSEWMKV +VSPGVPMEIALN+ESKRKTP ++AF G RT GEDAQ IG
Sbjct: 17 SQGAAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIG 76
Query: 86 TRFPSNSYGYFLDLLGKSIDSPVVQLFKSRFPYYDIVADEERGTIVFKTNDNELYHVEEL 145
+ P+++YGY LDLLGK+ID+P+V L++ RFPYY+IV D ER T+VF+ +D + + VEEL
Sbjct: 77 IKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVVFRKSDTDEFSVEEL 136
Query: 146 V 146
V
Sbjct: 137 V 137
|
|
| UNIPROTKB|Q5ZLK7 HYOU1 "Hypoxia up-regulated protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NJZ5 HYOU1 "Hypoxia up-regulated protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NY05 HYOU1 "Hypoxia up-regulated protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5344 hyou1 "hypoxia up-regulated 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KTF1 HYOU1 "Hypoxia up-regulated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QL06 HYOU1 "Hypoxia up-regulated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PJ21 HYOU1 "Hypoxia up-regulated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PL22 HYOU1 "Hypoxia up-regulated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y4L1 HYOU1 "Hypoxia up-regulated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 146 | |||
| cd10230 | 388 | cd10230, HYOU1-like_NBD, Nucleotide-binding domain | 9e-56 | |
| cd11732 | 377 | cd11732, HSP105-110_like_NBD, Nucleotide-binding d | 2e-24 | |
| cd10228 | 381 | cd10228, HSPA4_like_NDB, Nucleotide-binding domain | 6e-13 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 1e-10 | |
| COG0443 | 579 | COG0443, DnaK, Molecular chaperone [Posttranslatio | 1e-07 | |
| cd10241 | 374 | cd10241, HSPA5-like_NBD, Nucleotide-binding domain | 7e-07 | |
| cd11739 | 383 | cd11739, HSPH1_NBD, Nucleotide-binding domain of H | 1e-06 | |
| cd11734 | 373 | cd11734, Ssq1_like_NBD, Nucleotide-binding domain | 1e-06 | |
| PTZ00009 | 653 | PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro | 9e-06 | |
| cd10170 | 369 | cd10170, HSP70_NBD, Nucleotide-binding domain of t | 5e-05 | |
| PTZ00400 | 663 | PTZ00400, PTZ00400, DnaK-type molecular chaperone; | 8e-05 | |
| cd11733 | 377 | cd11733, HSPA9-like_NBD, Nucleotide-binding domain | 2e-04 | |
| PLN03184 | 673 | PLN03184, PLN03184, chloroplast Hsp70; Provisional | 4e-04 | |
| cd10233 | 376 | cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding | 4e-04 | |
| PRK13410 | 668 | PRK13410, PRK13410, molecular chaperone DnaK; Prov | 5e-04 | |
| cd10232 | 386 | cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma | 0.001 | |
| cd10234 | 376 | cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d | 0.001 | |
| cd10238 | 375 | cd10238, HSPA14-like_NBD, Nucleotide-binding domai | 0.002 | |
| PTZ00186 | 657 | PTZ00186, PTZ00186, heat shock 70 kDa precursor pr | 0.002 | |
| cd11738 | 383 | cd11738, HSPA4L_NBD, Nucleotide-binding domain of | 0.002 | |
| PRK13411 | 653 | PRK13411, PRK13411, molecular chaperone DnaK; Prov | 0.003 | |
| TIGR02350 | 595 | TIGR02350, prok_dnaK, chaperone protein DnaK | 0.003 |
| >gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins | Back alignment and domain information |
|---|
Score = 178 bits (454), Expect = 9e-56
Identities = 67/115 (58%), Positives = 80/115 (69%)
Query: 32 MSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGERTFGEDAQIIGTRFPSN 91
+ +DLGSEW+KVA+V PGVP EI LN+ESKRKTP+ VAF GER FG DA + RFP
Sbjct: 1 LGIDLGSEWIKVALVKPGVPFEIVLNEESKRKTPSAVAFKGGERLFGSDASSLAARFPQQ 60
Query: 92 SYGYFLDLLGKSIDSPVVQLFKSRFPYYDIVADEERGTIVFKTNDNELYHVEELV 146
Y + DLLGK D P V L++SR P +V DE RGT+ FK +D E Y VEELV
Sbjct: 61 VYLHLKDLLGKPADDPSVSLYQSRHPLPYLVVDESRGTVAFKISDGEEYSVEELV 115
|
This subgroup includes human HYOU1 (also known as human hypoxia up-regulated 1, GRP170; HSP12A; ORP150; GRP-170; ORP-150; the human HYOU1 gene maps to11q23.1-q23.3) and Saccharomyces cerevisiae Lhs1p (also known as Cer1p, SsI1). Mammalian HYOU1 functions as a nucleotide exchange factor (NEF) for HSPA5 (alos known as BiP, Grp78 or HspA5) and may also function as a HSPA5-independent chaperone. S. cerevisiae Lhs1p, does not have a detectable endogenous ATPase activity like canonical HSP70s, but functions as a NEF for Kar2p; it's interaction with Kar2p is stimulated by nucleotide-binding. In addition, Lhs1p has a nucleotide-independent holdase activity that prevents heat-induced aggregation of proteins in vitro. This subgroup belongs to the 105/110 kDa heat shock protein (HSP105/110) subfamily of the HSP70-like family. HSP105/110s are believed to function generally as co-chaperones of HSP70 chaperones, acting as NEFs, to remove ADP from their HSP70 chaperone partners during the ATP hydrolysis cycle. HSP70 chaperones assist in protein folding and assembly, and can direct incompetent "client" proteins towards degradation. Like HSP70 chaperones, HSP105/110s have an N-terminal nucleotide-binding domain (NBD) and a C-terminal substrate-binding domain (SBD). For HSP70 chaperones, the nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. Hsp70 chaperone activity is also regulated by J-domain proteins. Length = 388 |
| >gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 | Back alignment and domain information |
|---|
| >gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family | Back alignment and domain information |
|---|
| >gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L | Back alignment and domain information |
|---|
| >gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| KOG0100|consensus | 663 | 99.97 | ||
| PTZ00009 | 653 | heat shock 70 kDa protein; Provisional | 99.91 | |
| PTZ00400 | 663 | DnaK-type molecular chaperone; Provisional | 99.91 | |
| PTZ00186 | 657 | heat shock 70 kDa precursor protein; Provisional | 99.91 | |
| KOG0102|consensus | 640 | 99.91 | ||
| PRK13410 | 668 | molecular chaperone DnaK; Provisional | 99.89 | |
| PRK00290 | 627 | dnaK molecular chaperone DnaK; Provisional | 99.88 | |
| PRK13411 | 653 | molecular chaperone DnaK; Provisional | 99.88 | |
| PLN03184 | 673 | chloroplast Hsp70; Provisional | 99.88 | |
| PF00012 | 602 | HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho | 99.87 | |
| TIGR02350 | 595 | prok_dnaK chaperone protein DnaK. Members of this | 99.87 | |
| CHL00094 | 621 | dnaK heat shock protein 70 | 99.87 | |
| KOG0101|consensus | 620 | 99.87 | ||
| KOG0103|consensus | 727 | 99.86 | ||
| TIGR01991 | 599 | HscA Fe-S protein assembly chaperone HscA. The Hea | 99.86 | |
| PRK05183 | 616 | hscA chaperone protein HscA; Provisional | 99.86 | |
| KOG0104|consensus | 902 | 99.85 | ||
| COG0443 | 579 | DnaK Molecular chaperone [Posttranslational modifi | 99.73 | |
| PRK01433 | 595 | hscA chaperone protein HscA; Provisional | 99.72 | |
| PRK11678 | 450 | putative chaperone; Provisional | 99.59 | |
| PRK13929 | 335 | rod-share determining protein MreBH; Provisional | 98.5 | |
| TIGR00904 | 333 | mreB cell shape determining protein, MreB/Mrl fami | 98.25 | |
| PRK13928 | 336 | rod shape-determining protein Mbl; Provisional | 98.16 | |
| COG1077 | 342 | MreB Actin-like ATPase involved in cell morphogene | 98.11 | |
| PF06723 | 326 | MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba | 98.06 | |
| PRK13930 | 335 | rod shape-determining protein MreB; Provisional | 97.88 | |
| PRK13927 | 334 | rod shape-determining protein MreB; Provisional | 97.77 | |
| PF00370 | 245 | FGGY_N: FGGY family of carbohydrate kinases, N-ter | 92.13 | |
| smart00732 | 99 | YqgFc Likely ribonuclease with RNase H fold. YqgF | 90.47 | |
| PRK10331 | 470 | L-fuculokinase; Provisional | 88.69 | |
| COG1070 | 502 | XylB Sugar (pentulose and hexulose) kinases [Carbo | 88.52 | |
| PRK10939 | 520 | autoinducer-2 (AI-2) kinase; Provisional | 86.84 | |
| TIGR02628 | 465 | fuculo_kin_coli L-fuculokinase. Members of this fa | 86.68 | |
| PRK15027 | 484 | xylulokinase; Provisional | 86.64 | |
| PF03652 | 135 | UPF0081: Uncharacterised protein family (UPF0081); | 86.61 | |
| TIGR01315 | 541 | 5C_CHO_kinase FGGY-family pentulose kinase. This m | 85.81 | |
| TIGR00241 | 248 | CoA_E_activ CoA-substrate-specific enzyme activase | 85.58 | |
| smart00268 | 373 | ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki | 85.46 | |
| TIGR01314 | 505 | gntK_FGGY gluconate kinase, FGGY type. Gluconate i | 85.03 | |
| PTZ00294 | 504 | glycerol kinase-like protein; Provisional | 84.95 | |
| TIGR01311 | 493 | glycerol_kin glycerol kinase. This model describes | 84.95 | |
| PRK00047 | 498 | glpK glycerol kinase; Provisional | 84.93 | |
| TIGR03192 | 293 | benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s | 84.52 | |
| PLN00130 | 213 | succinate dehydrogenase (SDH3); Provisional | 84.17 | |
| TIGR01234 | 536 | L-ribulokinase L-ribulokinase. This enzyme catalyz | 84.17 | |
| PLN02295 | 512 | glycerol kinase | 83.64 | |
| PRK04123 | 548 | ribulokinase; Provisional | 82.72 | |
| cd00012 | 371 | ACTIN Actin; An ubiquitous protein involved in the | 82.01 | |
| PF14450 | 120 | FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B | 81.79 | |
| PRK13321 | 256 | pantothenate kinase; Reviewed | 80.73 |
| >KOG0100|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=9.9e-32 Score=222.69 Aligned_cols=116 Identities=28% Similarity=0.381 Sum_probs=107.3
Q ss_pred CCcEEEEEcCCccEEEEEEeCCCceEEEecCCCCcceeEEEEEcCCeeeecHhHHHhhhcCCCCeeecchhhccCCCCCh
Q psy351 28 GIAVMSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGERTFGEDAQIIGTRFPSNSYGYFLDLLGKSIDSP 107 (146)
Q Consensus 28 ~~~~iGIDlGTtns~va~~~~~~~~~iv~n~~~~~~~PS~V~f~~~~~~vG~~A~~~~~~~p~~~i~~~KrliG~~~~d~ 107 (146)
-+.+||||||||+|||+++.+| +++|+.|++|+|.+||+|+|.+.+|++|.+|++|+..||+||+++.||||||+|+|+
T Consensus 35 ~gtvigIdLGTTYsCVgV~kNg-rvEIiANdQGNRItPSyVaFt~derLiGdAAKNQ~~~NPenTiFD~KRLIGr~~~d~ 113 (663)
T KOG0100|consen 35 LGTVIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTDDERLIGDAAKNQLTSNPENTIFDAKRLIGRKFNDK 113 (663)
T ss_pred cceEEEEecCCceeeEEEEeCC-eEEEEecCCCCccccceeeeccchhhhhhHhhcccccCcccceechHHHhCcccCCh
Confidence 3579999999999999999999 999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhhhccCcceEEeecCCCCceEEEEcC--CcEEEeeeee
Q psy351 108 VVQLFKSRFPYYDIVADEERGTIVFKTN--DNELYHVEEL 145 (146)
Q Consensus 108 ~v~~~~~~~p~~~v~~d~~~g~~~~~~~--~~~~~speev 145 (146)
.+|++.++|||+++.+++ ...+.+..+ +.+.|+||||
T Consensus 114 ~vq~Dik~~Pfkvv~k~~-kp~i~v~v~~g~~K~FtPeEi 152 (663)
T KOG0100|consen 114 SVQKDIKFLPFKVVNKDG-KPYIQVKVGGGETKVFTPEEI 152 (663)
T ss_pred hhhhhhhcCceEEEcCCC-CccEEEEccCCcccccCHHHH
Confidence 999999999999887765 566666654 4589999997
|
|
| >PTZ00009 heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00400 DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >PTZ00186 heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >KOG0102|consensus | Back alignment and domain information |
|---|
| >PRK13410 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PRK00290 dnaK molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PRK13411 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PLN03184 chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins | Back alignment and domain information |
|---|
| >TIGR02350 prok_dnaK chaperone protein DnaK | Back alignment and domain information |
|---|
| >CHL00094 dnaK heat shock protein 70 | Back alignment and domain information |
|---|
| >KOG0101|consensus | Back alignment and domain information |
|---|
| >KOG0103|consensus | Back alignment and domain information |
|---|
| >TIGR01991 HscA Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >PRK05183 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >KOG0104|consensus | Back alignment and domain information |
|---|
| >COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01433 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >PRK11678 putative chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK13929 rod-share determining protein MreBH; Provisional | Back alignment and domain information |
|---|
| >TIGR00904 mreB cell shape determining protein, MreB/Mrl family | Back alignment and domain information |
|---|
| >PRK13928 rod shape-determining protein Mbl; Provisional | Back alignment and domain information |
|---|
| >COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes | Back alignment and domain information |
|---|
| >PRK13930 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PRK13927 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related | Back alignment and domain information |
|---|
| >smart00732 YqgFc Likely ribonuclease with RNase H fold | Back alignment and domain information |
|---|
| >PRK10331 L-fuculokinase; Provisional | Back alignment and domain information |
|---|
| >COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10939 autoinducer-2 (AI-2) kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02628 fuculo_kin_coli L-fuculokinase | Back alignment and domain information |
|---|
| >PRK15027 xylulokinase; Provisional | Back alignment and domain information |
|---|
| >PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination | Back alignment and domain information |
|---|
| >TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase | Back alignment and domain information |
|---|
| >TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative | Back alignment and domain information |
|---|
| >smart00268 ACTIN Actin | Back alignment and domain information |
|---|
| >TIGR01314 gntK_FGGY gluconate kinase, FGGY type | Back alignment and domain information |
|---|
| >PTZ00294 glycerol kinase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01311 glycerol_kin glycerol kinase | Back alignment and domain information |
|---|
| >PRK00047 glpK glycerol kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit | Back alignment and domain information |
|---|
| >PLN00130 succinate dehydrogenase (SDH3); Provisional | Back alignment and domain information |
|---|
| >TIGR01234 L-ribulokinase L-ribulokinase | Back alignment and domain information |
|---|
| >PLN02295 glycerol kinase | Back alignment and domain information |
|---|
| >PRK04123 ribulokinase; Provisional | Back alignment and domain information |
|---|
| >cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton | Back alignment and domain information |
|---|
| >PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T | Back alignment and domain information |
|---|
| >PRK13321 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 146 | ||||
| 3gdq_A | 408 | Crystal Structure Of The Human 70kda Heat Shock Pro | 6e-07 | ||
| 1ba1_A | 386 | Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi | 2e-06 | ||
| 1kax_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71m | 3e-06 | ||
| 3jxu_A | 409 | Crystal Structure Of The Human 70kda Heat Shock Pro | 4e-06 | ||
| 3d2e_B | 382 | Crystal Structure Of A Complex Of Sse1p And Hsp70, | 5e-06 | ||
| 1bup_A | 386 | T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot | 6e-06 | ||
| 3d2f_B | 382 | Crystal Structure Of A Complex Of Sse1p And Hsp70 L | 6e-06 | ||
| 1hjo_A | 380 | Atpase Domain Of Human Heat Shock 70kda Protein 1 L | 7e-06 | ||
| 2e8a_A | 391 | Crystal Structure Of The Human Hsp70 Atpase Domain | 7e-06 | ||
| 2e88_A | 391 | Crystal Structure Of The Human Hsp70 Atpase Domain | 7e-06 | ||
| 3a8y_A | 392 | Crystal Structure Of The Complex Between The Bag5 B | 7e-06 | ||
| 1kay_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71a | 8e-06 | ||
| 1s3x_A | 382 | The Crystal Structure Of The Human Hsp70 Atpase Dom | 9e-06 | ||
| 1qqn_A | 378 | D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 9e-06 | ||
| 2qwn_A | 394 | Crystal Structure Of Disulfide-Bond-Crosslinked Com | 1e-05 | ||
| 2qw9_B | 394 | Crystal Structure Of Bovine Hsc70 (1-394aa)in The A | 1e-05 | ||
| 1atr_A | 386 | Threonine 204 Of The Chaperone Protein Hsc70 Influe | 1e-05 | ||
| 1ngd_A | 386 | Structural Basis Of The 70-kilodalton Heat Shock Co | 1e-05 | ||
| 1ngf_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-05 | ||
| 1nga_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-05 | ||
| 1ngb_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-05 | ||
| 3cqx_A | 386 | Chaperone Complex Length = 386 | 1e-05 | ||
| 1hpm_A | 386 | How Potassium Affects The Activity Of The Molecular | 1e-05 | ||
| 1ats_A | 386 | Threonine 204 Of The Chaperone Protein Hsc70 Influe | 1e-05 | ||
| 1ngc_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-05 | ||
| 1nge_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-05 | ||
| 1ba0_A | 386 | Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi | 1e-05 | ||
| 1qqo_A | 378 | E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 1e-05 | ||
| 3c7n_B | 554 | Structure Of The Hsp110:hsc70 Nucleotide Exchange C | 1e-05 | ||
| 3fzf_A | 381 | Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP | 1e-05 | ||
| 1yuw_A | 554 | Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 | 1e-05 | ||
| 1kaz_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71e | 1e-05 | ||
| 1hx1_A | 400 | Crystal Structure Of A Bag Domain In Complex With T | 1e-05 | ||
| 2v7z_A | 543 | Crystal Structure Of The 70-Kda Heat Shock Cognate | 1e-05 | ||
| 2bup_A | 381 | T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 | 2e-05 | ||
| 1qqm_A | 378 | D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 2e-05 | ||
| 3kvg_A | 400 | Crystal Structure Of The N-Terminal Domain Of Hsp70 | 3e-05 | ||
| 1ngh_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 4e-05 | ||
| 1ngg_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 8e-05 | ||
| 3iuc_A | 408 | Crystal Structure Of The Human 70kda Heat Shock Pro | 9e-05 | ||
| 3ldl_A | 384 | Crystal Structure Of Human Grp78 (70kda Heat Shock | 9e-05 | ||
| 4fsv_A | 387 | Crystal Structure Of A Heat Shock 70kda Protein 2 ( | 1e-04 | ||
| 4gni_A | 409 | Structure Of The Ssz1 Atpase Bound To Atp And Magne | 1e-04 | ||
| 3qfp_A | 390 | Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D | 2e-04 | ||
| 3qfu_A | 394 | Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE | 2e-04 | ||
| 3i33_A | 404 | Crystal Structure Of The Human 70kda Heat Shock Pro | 2e-04 | ||
| 3gl1_A | 387 | Crystal Structure Of Atpase Domain Of Ssb1 Chaperon | 2e-04 | ||
| 1dkg_D | 383 | Crystal Structure Of The Nucleotide Exchange Factor | 4e-04 | ||
| 3fe1_A | 403 | Crystal Structure Of The Human 70kda Heat Shock Pro | 4e-04 | ||
| 2kho_A | 605 | Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP | 6e-04 |
| >pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 | Back alignment and structure |
|
| >pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 | Back alignment and structure |
| >pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 | Back alignment and structure |
| >pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 | Back alignment and structure |
| >pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 | Back alignment and structure |
| >pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 | Back alignment and structure |
| >pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 | Back alignment and structure |
| >pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 | Back alignment and structure |
| >pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 | Back alignment and structure |
| >pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 | Back alignment and structure |
| >pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 | Back alignment and structure |
| >pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 | Back alignment and structure |
| >pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 | Back alignment and structure |
| >pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 | Back alignment and structure |
| >pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 | Back alignment and structure |
| >pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 | Back alignment and structure |
| >pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|3CQX|A Chain A, Chaperone Complex Length = 386 | Back alignment and structure |
| >pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 | Back alignment and structure |
| >pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 | Back alignment and structure |
| >pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 | Back alignment and structure |
| >pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 | Back alignment and structure |
| >pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 | Back alignment and structure |
| >pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 | Back alignment and structure |
| >pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 | Back alignment and structure |
| >pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 | Back alignment and structure |
| >pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 | Back alignment and structure |
| >pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 | Back alignment and structure |
| >pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 | Back alignment and structure |
| >pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 | Back alignment and structure |
| >pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 | Back alignment and structure |
| >pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 | Back alignment and structure |
| >pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 | Back alignment and structure |
| >pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 | Back alignment and structure |
| >pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 | Back alignment and structure |
| >pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 | Back alignment and structure |
| >pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 | Back alignment and structure |
| >pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 | Back alignment and structure |
| >pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 146 | |||
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 1e-07 | |
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 2e-05 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 4e-05 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 1e-04 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 2e-04 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 3e-04 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 7e-04 |
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 | Back alignment and structure |
|---|
Score = 48.1 bits (115), Expect = 1e-07
Identities = 20/85 (23%), Positives = 34/85 (40%), Gaps = 1/85 (1%)
Query: 34 VDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGERTFGEDAQIIGTRFPSNSY 93
+DLG+ +A+ +I +N+ S R TP++V F R GE + T N+
Sbjct: 7 LDLGNNNSVLAVARNRGI-DIVVNEVSNRSTPSVVGFGPKNRYLGETGKNKQTSNIKNTV 65
Query: 94 GYFLDLLGKSIDSPVVQLFKSRFPY 118
++G P + F
Sbjct: 66 ANLKRIIGLDYHHPDFEQESKHFTS 90
|
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 99.91 | |
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 99.9 | |
| 4b9q_A | 605 | Chaperone protein DNAK; HET: ATP; 2.40A {Escherich | 99.9 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 99.89 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 99.88 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 99.87 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 99.85 | |
| 4gni_A | 409 | Putative heat shock protein; HSP70-type ATPase, AT | 99.8 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 99.66 | |
| 1jce_A | 344 | ROD shape-determining protein MREB; MBL, actin, HS | 98.48 | |
| 4ehu_A | 276 | Activator of 2-hydroxyisocaproyl-COA dehydratase; | 96.43 | |
| 2ych_A | 377 | Competence protein PILM; cell cycle, type IV pilus | 96.09 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 95.62 | |
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 95.58 | |
| 2fsj_A | 346 | Hypothetical protein TA0583; actin homologs, archa | 94.82 | |
| 2zgy_A | 320 | Plasmid segregation protein PARM; plasmid partitio | 93.68 | |
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 92.13 | |
| 1hux_A | 270 | Activator of (R)-2-hydroxyglutaryl-COA dehydratase | 89.11 | |
| 3ezw_A | 526 | Glycerol kinase; glycerol metabolism, allosteric r | 88.51 | |
| 3g25_A | 501 | Glycerol kinase; IDP00743, ATP-binding, glycerol m | 87.57 | |
| 3h6e_A | 482 | Carbohydrate kinase, FGGY; novosphingobium aromati | 86.95 | |
| 3l0q_A | 554 | Xylulose kinase; xlylulose kinase, SGX, PSI, struc | 86.68 | |
| 3i8b_A | 515 | Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 | 86.55 | |
| 2w40_A | 503 | Glycerol kinase, putative; closed conformation, ma | 86.45 | |
| 3h3n_X | 506 | Glycerol kinase; ATP-binding, glycerol metabolism, | 86.31 | |
| 2p3r_A | 510 | Glycerol kinase; glycerol metabolism, allosteric r | 86.29 | |
| 3ifr_A | 508 | Carbohydrate kinase, FGGY; xylulose kinase, SGX, s | 86.13 | |
| 1vhx_A | 150 | Putative holliday junction resolvase; structural g | 85.87 | |
| 3ll3_A | 504 | Gluconate kinase; xylulose kinase, nysgx, ATP, ADP | 85.59 | |
| 4bc3_A | 538 | Xylulose kinase; transferase, glucuronate xyluloki | 85.53 | |
| 4e1j_A | 520 | Glycerol kinase; structural genomics, PSI-biology, | 85.25 | |
| 3jvp_A | 572 | Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su | 85.14 | |
| 2zf5_O | 497 | Glycerol kinase; hyperthermophilic archaeon, ATP-b | 84.74 | |
| 3hz6_A | 511 | Xylulokinase; xylulose, structural genomic, chromo | 84.68 | |
| 1hjr_A | 158 | Holliday junction resolvase (RUVC); site-specific | 84.41 | |
| 2dpn_A | 495 | Glycerol kinase; thermus thermophilus HB8, structu | 84.29 | |
| 1iv0_A | 98 | Hypothetical protein; rnaseh-like, YQGF, structura | 84.26 | |
| 2uyt_A | 489 | Rhamnulokinase; rhamnose degradation, IN-LINE phos | 84.17 | |
| 3djc_A | 266 | Type III pantothenate kinase; structural genomics, | 83.97 | |
| 3qb0_A | 498 | Actin-related protein 4; actin fold, ATP binding, | 82.78 | |
| 2itm_A | 484 | Xylulose kinase, xylulokinase; ATPase, FGGY kinase | 82.68 | |
| 2d4w_A | 504 | Glycerol kinase; alpha and beta protein, ribonucle | 81.59 |
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* | Back alignment and structure |
|---|
Probab=99.91 E-value=1.4e-24 Score=186.77 Aligned_cols=115 Identities=26% Similarity=0.396 Sum_probs=100.0
Q ss_pred CcEEEEEcCCccEEEEEEeCCCceEEEecCCCCcceeEEEEEcCCeeeecHhHHHhhhcCCCCeeecchhhccCCCCChh
Q psy351 29 IAVMSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGERTFGEDAQIIGTRFPSNSYGYFLDLLGKSIDSPV 108 (146)
Q Consensus 29 ~~~iGIDlGTtns~va~~~~~~~~~iv~n~~~~~~~PS~V~f~~~~~~vG~~A~~~~~~~p~~~i~~~KrliG~~~~d~~ 108 (146)
+.+||||||||||+||++.+| +++++.|++|++++||+|+|.++++++|.+|++++.++|.++++++||+||++++|+.
T Consensus 4 ~~~iGIDlGTt~s~va~~~~g-~~~ii~n~~g~~~~PS~V~~~~~~~~vG~~A~~~~~~~p~~ti~~~KrllG~~~~d~~ 82 (554)
T 1yuw_A 4 GPAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAV 82 (554)
T ss_dssp CCCEEEEECSSEEEEEEECSS-SEEECCCTTSCSEEECCEEECSSCEEETHHHHTTTTTCGGGEECCGGGTTTCCSSCSH
T ss_pred CCEEEEEeCcccEEEEEEECC-EEEEEECCCCCeecceEEEEcCCcEEEcHHHHHhhhhChhhehHhhHHhcCCCCCcHH
Confidence 468999999999999999988 9999999999999999999988899999999999999999999999999999999999
Q ss_pred hhhhccCcceEEeecCCCCceEEEEc-CCcEEEeeeee
Q psy351 109 VQLFKSRFPYYDIVADEERGTIVFKT-NDNELYHVEEL 145 (146)
Q Consensus 109 v~~~~~~~p~~~v~~d~~~g~~~~~~-~~~~~~speev 145 (146)
++...+++||.++..++ ...+.+.. ++.+.|+||||
T Consensus 83 v~~~~~~~p~~v~~~~g-~~~~~v~~~~~~~~~sp~ei 119 (554)
T 1yuw_A 83 VQSDMKHWPFMVVNDAG-RPKVQVEYKGETKSFYPEEV 119 (554)
T ss_dssp HHHHHTTCSSEEEEETT-EEEEEEEETTEEEEECHHHH
T ss_pred HHHHhhcCCeEEEecCC-ceEEEEEECCCceEEcHHHH
Confidence 99999999998764332 22222322 34578999987
|
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* | Back alignment and structure |
|---|
| >4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 | Back alignment and structure |
|---|
| >4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A | Back alignment and structure |
|---|
| >4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A | Back alignment and structure |
|---|
| >2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A | Back alignment and structure |
|---|
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... | Back alignment and structure |
|---|
| >2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* | Back alignment and structure |
|---|
| >2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A | Back alignment and structure |
|---|
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* | Back alignment and structure |
|---|
| >1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 | Back alignment and structure |
|---|
| >3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* | Back alignment and structure |
|---|
| >3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* | Back alignment and structure |
|---|
| >3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} | Back alignment and structure |
|---|
| >2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* | Back alignment and structure |
|---|
| >3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O | Back alignment and structure |
|---|
| >3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 | Back alignment and structure |
|---|
| >3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* | Back alignment and structure |
|---|
| >4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* | Back alignment and structure |
|---|
| >4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} | Back alignment and structure |
|---|
| >3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* | Back alignment and structure |
|---|
| >1hjr_A Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} SCOP: c.55.3.6 | Back alignment and structure |
|---|
| >2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 | Back alignment and structure |
|---|
| >2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* | Back alignment and structure |
|---|
| >3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A | Back alignment and structure |
|---|
| >2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 146 | ||||
| d1bupa1 | 185 | c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas | 5e-21 | |
| d1dkgd1 | 183 | c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas | 4e-16 |
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Heat shock protein 70kDa, ATPase fragment species: Cow (Bos taurus) [TaxId: 9913]
Score = 82.0 bits (202), Expect = 5e-21
Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 1/116 (0%)
Query: 31 VMSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGERTFGEDAQIIGTRFPS 90
+ +DLGS + V + G EI N + R TP+ VAF ER G+ A+ P+
Sbjct: 3 AVGIDLGSTYSCVGVFQHGKV-EIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPT 61
Query: 91 NSYGYFLDLLGKSIDSPVVQLFKSRFPYYDIVADEERGTIVFKTNDNELYHVEELV 146
N+ L+G+ D VVQ +P+ + V + + ++ EE+
Sbjct: 62 NTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 117
|
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| d1bupa1 | 185 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 99.94 | |
| d1dkgd1 | 183 | Heat shock protein 70kDa, ATPase fragment {Escheri | 99.93 | |
| d1jcea1 | 137 | Prokaryotic actin homolog MreB {Thermotoga maritim | 98.79 | |
| d1huxa_ | 259 | Hydroxyglutaryl-CoA dehydratase component A {Acida | 95.28 | |
| d2p3ra1 | 252 | Glycerol kinase {Escherichia coli [TaxId: 562]} | 93.45 | |
| d1zc6a1 | 114 | Probable N-acetylglucosamine kinase CV2896 {Chromo | 93.27 | |
| d2aa4a1 | 119 | N-acetylmannosamine kinase NanK {Escherichia coli | 92.51 | |
| d2ap1a2 | 117 | Putative regulator protein YcfX {Salmonella typhim | 90.76 | |
| d1woqa1 | 129 | Inorganic polyphosphate/ATP-glucomannokinase PPGMK | 90.57 | |
| d2gupa1 | 114 | Hypothetical protein SP2142 {Streptococcus pneumon | 90.48 | |
| d1r59o1 | 252 | Glycerol kinase {Enterococcus casseliflavus [TaxId | 90.46 | |
| d1q18a1 | 110 | Glucokinase Glk {Escherichia coli [TaxId: 562]} | 89.92 | |
| d1iv0a_ | 98 | Hypothetical protein, YqgF homologue {Thermus ther | 88.73 | |
| d2ewsa1 | 267 | Type II pantothenate kinase, CoaW {Staphylococcus | 88.72 | |
| d2zgya1 | 157 | Plasmid segregation protein ParM {Escherichia coli | 87.63 | |
| d2fsja2 | 164 | Hypothetical protein Ta0583 {Archaeon Thermoplasma | 87.36 | |
| d1vhxa_ | 140 | Hypothetical protein YrrK (RuvX) {Bacillus subtili | 85.38 | |
| d3bexa1 | 118 | Type III pantothenate kinase, CoaX {Thermotoga mar | 85.33 | |
| d1nu0a_ | 138 | Hypothetical protein YqgF (RuvX) {Escherichia coli | 84.83 | |
| d2f9wa2 | 114 | Type III pantothenate kinase, CoaX {Pseudomonas ae | 83.91 | |
| d1xc3a1 | 118 | Putative fructokinase YhdR {Bacillus subtilis [Tax | 82.27 |
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Heat shock protein 70kDa, ATPase fragment species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.94 E-value=3.3e-27 Score=175.44 Aligned_cols=115 Identities=27% Similarity=0.403 Sum_probs=101.2
Q ss_pred CcEEEEEcCCccEEEEEEeCCCceEEEecCCCCcceeEEEEEcCCeeeecHhHHHhhhcCCCCeeecchhhccCCCCChh
Q psy351 29 IAVMSVDLGSEWMKVAIVSPGVPMEIALNKESKRKTPTLVAFHKGERTFGEDAQIIGTRFPSNSYGYFLDLLGKSIDSPV 108 (146)
Q Consensus 29 ~~~iGIDlGTtns~va~~~~~~~~~iv~n~~~~~~~PS~V~f~~~~~~vG~~A~~~~~~~p~~~i~~~KrliG~~~~d~~ 108 (146)
+.+||||||||||+||++++| +++++.|++|+|.+||+|+|.++++.+|..|+.++.++|+++++++|||||++++|+.
T Consensus 1 g~vvGIDfGTt~s~va~~~~g-~~~ii~~~~~~r~~Ps~i~~~~~~~~vG~~a~~~~~~~p~~~i~~~KrllG~~~~~~~ 79 (185)
T d1bupa1 1 GPAVGIDLGSTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAV 79 (185)
T ss_dssp CCCEEEEECSSEEEEEEEETT-EEEECCCTTSCSSEECCEEECSSCEEETHHHHTTTTTCGGGEECCHHHHTTCCTTCHH
T ss_pred CCEEEEEcChhcEEEEEEECC-EEEEEECCCCCccceeEEEECCCcEEEeechHHHhhcCcccchhHHHHHhCCCCccHH
Confidence 468999999999999999999 8999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhhccCcceEEeecCCCCceEEEE-cCCcEEEeeeee
Q psy351 109 VQLFKSRFPYYDIVADEERGTIVFK-TNDNELYHVEEL 145 (146)
Q Consensus 109 v~~~~~~~p~~~v~~d~~~g~~~~~-~~~~~~~speev 145 (146)
++...+.+|+.++..++ +....+. .++.+.|+||||
T Consensus 80 ~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~s~~el 116 (185)
T d1bupa1 80 VQSDMKHWPFMVVNDAG-RPKVQVEYKGETKSFYPEEV 116 (185)
T ss_dssp HHHHHTTCSSEEEEETT-EEEEEEEETTEEEEECHHHH
T ss_pred HHHHhhcCCceEEcCCC-CccEEEEEcCCceEEcHHHH
Confidence 99999999998765433 4444443 345578999987
|
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} | Back information, alignment and structure |
|---|
| >d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} | Back information, alignment and structure |
|---|
| >d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2zgya1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1vhxa_ c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3bexa1 c.55.1.13 (A:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f9wa2 c.55.1.13 (A:1-114) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|