Psyllid ID: psy359


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-----
MKPKETTSIKCEACHRTFSSPYEYGGHKLKCNLFLVQTTDDSYIVPAISQQSESTLKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCAKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCDQCDRTYQTKKSLYVHRRAHLGIVYRYKSKTDRCELCDKVVTNLAAHHNEVHAHERKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDFESVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHMGLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFAQSNDMKKHRRTVHKAQIHAVEDKG
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccEccccHHHHHccccccccccccccccccccEccccHHHHHcccccccccccccccccEEccccHcHEcEEEcccccccccccccccccccccEcccccHHHHcHccccccccccccccccEccccHHHHHEEEccccccccccccccccHHcHHHHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccccccccccEccccHHHHHHHHcccccEEcccccccccccccccEccccHHHHHHHHcccccccEEcccccccHHcccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHcccccEccccccEcccHHHHHHHHcHHcccccccccccc
mkpkettsikceachrtfsspyeygghklkcNLFLVqttddsyivpaisqqsestlktktrtsaddletleisntptsaanvenktlpltypcaktktrtsaddletleisntptsaanvenktlpltypcdqcdrtyqtkkSLYVHRRAHLGIVYryksktdrcelCDKVVTNLAAHhnevhaherkfpctfceksfkrkLHLKVHTrthtgekpyacylcDKRFAQISDRIKHLksshnfdfesvknkttpltRYLNKhlhdahpeAIKTERERKLIFKcdlcgnilsskHILQEHVRVVHMGlsrkyhyeykpdgvcdvCGEYKKQLLQHkrlhfplrpyactqcdktfkkknhltthyrihtgekpyqcdicgrgfaqsndmkkhRRTVHKAQIHAVEDKG
mkpkettsikceachrtfsspyeyggHKLKCNLFLVQTTDDSYIVPaisqqsestlktktrtsaddletleisntptsaanvenktlpltypcaktktrtsaddletleisntptsaanvenktlpltypcdqCDRTYqtkkslyvhrrAHLGIvyryksktdRCELCDKVVTNLAAHhnevhaherkfpCTFCEKSFKRKLHLKVhtrthtgekpyacyLCDKRFAQISDRIKHLksshnfdfesvknkttPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHMGLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTTHyrihtgekpyqcdICGRGFAQSNDMKKHRRTVHkaqihavedkg
MKPKETTSIKCEACHRTFSSPYEYGGHKLKCNLFLVQTTDDSYIVPAISQQSESTLKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCAKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCDQCDRTYQTKKSLYVHRRAHLGIVYRYKSKTDRCELCDKVVTNLAAHHNEVHAHERKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDFESVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHMGLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFAQSNDMKKHRRTVHKAQIHAVEDKG
********IKCEACHRTFSSPYEYGGHKLKCNLFLVQTTDDSYIVPAI**************************************************************************KTLPLTYPCDQCDRTYQTKKSLYVHRRAHLGIVYRYKSKTDRCELCDKVVTNLAAHHNEVHAHERKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDFESVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHMGLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFA************************
**PKETTSIKCEACHRTFSSPYEYGGHKLKCNLFLVQTTDDSYIVPAISQQSESTLKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCAKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCDQCDRTYQTKKSLYVHRRAHLGIVYRYKSKTDRCELCDKVVTNLAAHHNEVHAHERKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDFESVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHMGLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFAQSNDMKKHRRTVHKAQIHAVEDKG
********IKCEACHRTFSSPYEYGGHKLKCNLFLVQTTDDSYIVPAISQQSESTLKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCAKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCDQCDRTYQTKKSLYVHRRAHLGIVYRYKSKTDRCELCDKVVTNLAAHHNEVHAHERKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDFESVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHMGLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFAQSN***********AQIHAVEDKG
*****TTSIKCEACHRTFSSPYEYGGHKLKCNLFLVQTTDDSYIVPAISQQSESTLKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCAKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCDQCDRTYQTKKSLYVHRRAHLGIVYRYKSKTDRCELCDKVVTNLAAHHNEVHAHERKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDFESVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHMGLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFAQSNDMKKHRRTVHKAQIHAV**K*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPKETTSIKCEACHRTFSSPYEYGGHKLKCNLFLVQTTDDSYIVPAISQQSESTLKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCAKTKTRTSADDLETLEISNTPTSAANVENKTLPLTYPCDQCDRTYQTKKSLYVHRRAHLGIVYRYKSKTDRCELCDKVVTNLAAHHNEVHAHERKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDFESVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHMGLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFAQSNDMKKHRRTVHKAQIHAVEDKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query405 2.2.26 [Sep-21-2011]
Q08DG8 657 Zinc finger protein 135 O no N/A 0.585 0.360 0.343 2e-34
P52742 658 Zinc finger protein 135 O yes N/A 0.577 0.355 0.339 3e-34
Q8BPP0452 Zinc finger protein 436 O no N/A 0.525 0.471 0.345 2e-33
A6NK53670 Zinc finger protein 233 O no N/A 0.580 0.350 0.338 6e-33
Q9C0F3470 Zinc finger protein 436 O no N/A 0.525 0.453 0.342 8e-33
A0JNB1 787 Zinc finger protein 227 O no N/A 0.624 0.321 0.326 1e-32
Q5TYW11059 Zinc finger protein 658 O no N/A 0.587 0.224 0.359 1e-32
Q14590738 Zinc finger protein 235 O no N/A 0.580 0.318 0.330 1e-32
Q4V348819 Zinc finger protein 658B no N/A 0.587 0.290 0.355 1e-32
Q86WZ6 799 Zinc finger protein 227 O no N/A 0.622 0.315 0.335 2e-32
>sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 Back     alignment and function desciption
 Score =  147 bits (370), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 131/271 (48%), Gaps = 34/271 (12%)

Query: 129 YPCDQCDRTYQTKKSLYVHRRAHLGIVYRYKSKTDRCELCDKVVTNLAA--HHNEVHAHE 186
           Y C QC RT+     L  H+R H G       K   C  C K  +  ++   H   H  E
Sbjct: 269 YKCAQCGRTFNQIAPLIQHQRTHTG------EKPYECSECGKSFSFRSSFSQHERTHTGE 322

Query: 187 RKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLK---SSHNFD 243
           + + C+ C K+F++ +HL  H R HTGEKPY C  C K F+  S   KH +       ++
Sbjct: 323 KPYTCSQCGKAFRQSIHLTQHLRIHTGEKPYQCGECGKAFSHSSSLTKHQRIHTGEKPYE 382

Query: 244 FESVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVH 303
            ++     T +T  +       H      ER     ++C  CG   S   +L EH R+  
Sbjct: 383 CQACGKAFTQITPLIQ------HQRIHTGERP----YECSECGRAFSQSTLLTEHRRI-- 430

Query: 304 MGLSRKYHYEYKPDGVCDVCGE---YKKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTT 360
                  H   KP G C+ CG+   +   L QH+R H   +PYAC+QC K F++  HLT 
Sbjct: 431 -------HTGEKPYG-CNECGKAFSHSSSLSQHERTHTGEKPYACSQCGKAFRQSTHLTQ 482

Query: 361 HYRIHTGEKPYQCDICGRGFAQSNDMKKHRR 391
           H R HTGEKPY+C  CG+ F+ S+ + KH+R
Sbjct: 483 HQRTHTGEKPYECSDCGKAFSHSSSLTKHQR 513




Plays a role in the regulation of cell morphology and cytoskeletal organization. May be involved in transcriptional regulation.
Bos taurus (taxid: 9913)
>sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 Back     alignment and function description
>sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 Back     alignment and function description
>sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 Back     alignment and function description
>sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=2 SV=2 Back     alignment and function description
>sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 Back     alignment and function description
>sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 Back     alignment and function description
>sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 Back     alignment and function description
>sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 Back     alignment and function description
>sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query405
328715046392 PREDICTED: zinc finger protein 271-like 0.639 0.660 0.354 7e-37
410054508 541 PREDICTED: zinc finger protein 347-like 0.612 0.458 0.340 2e-35
328710109430 PREDICTED: zinc finger protein 135-like 0.590 0.555 0.362 3e-35
441630695 544 PREDICTED: zinc finger protein 160-like 0.612 0.455 0.336 9e-35
328704791339 PREDICTED: zinc finger protein 271-like 0.592 0.707 0.366 1e-34
328702980414 PREDICTED: zinc finger protein 271-like, 0.602 0.589 0.352 1e-34
328708421434 PREDICTED: zinc finger protein 271-like 0.664 0.619 0.346 3e-34
328726418484 PREDICTED: zinc finger protein 271-like 0.595 0.497 0.368 3e-34
328712679 716 PREDICTED: zinc finger protein 271-like 0.592 0.335 0.366 5e-34
301788764 1836 PREDICTED: zinc finger protein 91-like [ 0.612 0.135 0.334 7e-34
>gi|328715046|ref|XP_001949223.2| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  161 bits (407), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 151/299 (50%), Gaps = 40/299 (13%)

Query: 129 YPCDQCDRTYQTKKSLYVHRRAHLGIVYRYKSKTDRCELCDKVVT---NLAAHHNEVHAH 185
           Y CD CD+++    SL +HRR H G       K   C++CDK  +   NL  H   +H  
Sbjct: 106 YACDVCDKSFSVSDSLTIHRRTHTG------EKPYACDVCDKSFSENGNLTKH-KRIHTG 158

Query: 186 ERKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDFE 245
           E+ + C  C+KSF    HL  H RTHTGEKPYAC +CDK F++     KH ++ H  +  
Sbjct: 159 EKPYACDVCDKSFSLSHHLMTHRRTHTGEKPYACDVCDKSFSESGSLTKHQRT-HTGEKP 217

Query: 246 ---SVKNKTTPLTRYLNKH--LHDA--------------HPEAIKTERE---RKLIFKCD 283
               V +K+  ++  L  H  +H                 P  + T R     +  F CD
Sbjct: 218 YACDVCDKSFSISSGLTTHKRIHTGEKPYACDVCDKSFSQPNNLTTHRRTHTGEKPFACD 277

Query: 284 LCGNILSSKHILQEHVRVVHMGLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPY 343
           +C    S    L  H R+ H G        Y  D VCD+         +H+R H   +PY
Sbjct: 278 VCDKSFSENGSLTVHKRM-HTGEK-----PYACD-VCDMSFSESGSFTKHQRTHTGEQPY 330

Query: 344 ACTQCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFAQSNDMKKHRRTVHKAQIHAVE 402
           AC  CDK+F + ++LTTH RIHTGEKPY CD+C + F+QS+++ +HRRT    +++A +
Sbjct: 331 ACDVCDKSFSQSSNLTTHKRIHTGEKPYACDVCDKSFSQSSNLTRHRRTHTGEKLYACD 389




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|410054508|ref|XP_003953662.1| PREDICTED: zinc finger protein 347-like [Pan troglodytes] Back     alignment and taxonomy information
>gi|328710109|ref|XP_001948812.2| PREDICTED: zinc finger protein 135-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|441630695|ref|XP_004089567.1| PREDICTED: zinc finger protein 160-like [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|328704791|ref|XP_003242604.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328702980|ref|XP_001947926.2| PREDICTED: zinc finger protein 271-like, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328708421|ref|XP_001947682.2| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328726418|ref|XP_003248889.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328712679|ref|XP_003244876.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|301788764|ref|XP_002929799.1| PREDICTED: zinc finger protein 91-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query405
UNIPROTKB|F1NXS0596 F1NXS0 "Uncharacterized protei 0.604 0.411 0.362 2e-43
UNIPROTKB|C9K0H3546 ZNF28 "Zinc finger protein 28" 0.604 0.448 0.350 1.9e-39
UNIPROTKB|Q5VIY5522 ZNF468 "Zinc finger protein 46 0.624 0.484 0.337 8.3e-39
UNIPROTKB|P0CJ79500 ZNF888 "Zinc finger protein 88 0.624 0.506 0.346 1.7e-38
UNIPROTKB|A5D7K3464 ZFP2 "Uncharacterized protein" 0.607 0.530 0.335 3.5e-38
UNIPROTKB|J9P0A1463 ZFP2 "Uncharacterized protein" 0.607 0.531 0.335 3.5e-38
UNIPROTKB|I3LT86573 ZNF311 "Uncharacterized protei 0.617 0.436 0.326 4.5e-38
UNIPROTKB|F1RMT4 908 F1RMT4 "Uncharacterized protei 0.609 0.272 0.338 6.9e-38
ZFIN|ZDB-GENE-060503-58 499 si:dkey-20i20.11 "si:dkey-20i2 0.617 0.501 0.333 7e-38
UNIPROTKB|E1BCC4646 LOC787057 "Uncharacterized pro 0.612 0.383 0.334 9.3e-38
UNIPROTKB|F1NXS0 F1NXS0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 431 (156.8 bits), Expect = 2.0e-43, Sum P(2) = 2.0e-43
 Identities = 98/270 (36%), Positives = 138/270 (51%)

Query:   129 YPCDQCDRTYQTKKSLYVHRRAHLGIVYRYKSKTDRCELCDKVVTN---LAAHHNEVHAH 185
             Y C  C+RT+    +L    R H+ +  R   K  RCE C +   N   L +H   VH+ 
Sbjct:   341 YKCRACERTFTDMSTL----RRHVSV--RQPQKLYRCETCSQTFVNRCNLKSHQRHVHSS 394

Query:   186 ERKFPCTFCEKSFKRKLHLK-VHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDF 244
             ER FPC  C K FKRK  +K +H RTHTG+KPY C  C+ +F+Q S    H++  H  + 
Sbjct:   395 ERHFPCELCGKKFKRKKDVKRLHERTHTGDKPYGCTECEAKFSQPSALKTHMRI-HTGEK 453

Query:   245 ESVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHM 304
               V ++     R+   H+   H      ER     F C+ CG   +SK  L+ H R+ H 
Sbjct:   454 PFVCDECG--ARFTQNHMLIYHKRCHTGERP----FMCETCGKSFASKEYLKHHNRI-HT 506

Query:   305 GLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTTHYRI 364
             G S+ +  E     VC      +  L QH ++H   RPY C QC K F + N L  H+RI
Sbjct:   507 G-SKPFKCE-----VCFRTFAQRNSLYQHIKVHTGERPYCCDQCGKQFTQLNALQRHHRI 560

Query:   365 HTGEKPYQCDICGRGFAQSNDMKKHRRTVH 394
             HTGEKP+ C+ CGR F   + +++H  ++H
Sbjct:   561 HTGEKPFMCNACGRTFTDKSTLRRHT-SIH 589


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|C9K0H3 ZNF28 "Zinc finger protein 28" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VIY5 ZNF468 "Zinc finger protein 468" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P0CJ79 ZNF888 "Zinc finger protein 888" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7K3 ZFP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P0A1 ZFP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LT86 ZNF311 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMT4 F1RMT4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-58 si:dkey-20i20.11 "si:dkey-20i20.11" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BCC4 LOC787057 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query405
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 4e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 4e-04
pfam12756100 pfam12756, zf-C2H2_2, C2H2 type zinc-finger (2 cop 0.001
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 37.0 bits (86), Expect = 4e-04
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 203 HLKVHTRTHTGEKPYACYLCDKRFAQ 228
           +L+ H RTHTGEKPY C +C K F+ 
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|221755 pfam12756, zf-C2H2_2, C2H2 type zinc-finger (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 405
KOG2462|consensus279 99.93
KOG2462|consensus279 99.91
KOG3608|consensus467 99.91
KOG1074|consensus958 99.91
KOG1074|consensus958 99.87
KOG3623|consensus 1007 99.87
KOG3608|consensus467 99.82
KOG3576|consensus267 99.66
KOG3576|consensus267 99.59
KOG3623|consensus 1007 99.51
PHA00733128 hypothetical protein 99.19
PLN03086567 PRLI-interacting factor K; Provisional 99.18
PLN03086567 PRLI-interacting factor K; Provisional 99.05
PHA0276855 hypothetical protein; Provisional 98.91
PHA00733128 hypothetical protein 98.76
KOG3993|consensus500 98.68
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.56
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.55
PHA0276855 hypothetical protein; Provisional 98.52
PHA0061644 hypothetical protein 98.48
PHA0061644 hypothetical protein 98.43
KOG3993|consensus500 98.4
PHA0073279 hypothetical protein 98.33
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.31
PHA0073279 hypothetical protein 97.94
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.86
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.78
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.76
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.75
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.72
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.61
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.6
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.48
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.42
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.21
COG5189423 SFP1 Putative transcriptional repressor regulating 97.11
COG5189423 SFP1 Putative transcriptional repressor regulating 97.1
KOG2231|consensus 669 96.98
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.93
smart0035526 ZnF_C2H2 zinc finger. 96.75
KOG2785|consensus 390 96.63
smart0035526 ZnF_C2H2 zinc finger. 96.6
KOG2231|consensus 669 96.5
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.47
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.45
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.18
PRK04860160 hypothetical protein; Provisional 96.14
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.03
COG5236493 Uncharacterized conserved protein, contains RING Z 95.79
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.7
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.4
PRK04860160 hypothetical protein; Provisional 95.38
KOG2482|consensus423 95.37
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.24
KOG4173|consensus253 95.04
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.92
KOG2482|consensus 423 94.78
KOG2893|consensus 341 94.62
KOG1146|consensus 1406 94.51
KOG2785|consensus390 93.26
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.07
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.99
KOG4173|consensus253 92.73
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.97
KOG1146|consensus1406 91.96
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 91.37
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.07
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 90.41
KOG2893|consensus 341 89.35
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 89.33
COG404965 Uncharacterized protein containing archaeal-type C 87.43
COG404965 Uncharacterized protein containing archaeal-type C 86.65
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 86.25
COG5048 467 FOG: Zn-finger [General function prediction only] 86.15
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 84.79
COG5048467 FOG: Zn-finger [General function prediction only] 83.75
PF04959 214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 82.48
PRK00464154 nrdR transcriptional regulator NrdR; Validated 82.35
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 80.7
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 80.42
>KOG2462|consensus Back     alignment and domain information
Probab=99.93  E-value=7.7e-27  Score=193.94  Aligned_cols=133  Identities=31%  Similarity=0.655  Sum_probs=111.4

Q ss_pred             CcccccchHhhhChHHHHHHHhhhCCCCcccccCCCCcchHHhhhhhcccCcchhhhhhhcccceecCCCcccCCChHHH
Q psy359          216 PYACYLCDKRFAQISDRIKHLKSSHNFDFESVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHIL  295 (405)
Q Consensus       216 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l  295 (405)
                      .|+|..|++.+.+.+.|.+|.+.|-..+                                ..+.+.|+.|++.|.+...|
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~--------------------------------s~ka~~C~~C~K~YvSmpAL  177 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLD--------------------------------SKKAFSCKYCGKVYVSMPAL  177 (279)
T ss_pred             ceeccccccccccccccchhhccccccc--------------------------------ccccccCCCCCceeeehHHH
Confidence            3666666666666666666666643222                                35578899999999999999


Q ss_pred             HHHHhhhccCCCccccccCCCCCcCCCcccc---hHHHHhhhhhcCCCCccccccccccccCchhHHHHhhhhCCCCccc
Q psy359          296 QEHVRVVHMGLSRKYHYEYKPDGVCDVCGEY---KKQLLQHKRLHFPLRPYACTQCDKTFKKKNHLTTHYRIHTGEKPYQ  372 (405)
Q Consensus       296 ~~H~~~~h~~~~~~~~~~~~~~~~C~~C~~~---~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~  372 (405)
                      ..|++. |...           +.|.+||+.   .=.|+.|+|+|||||||.|+.|+++|+.++.|+.||+.|.+.+.|+
T Consensus       178 kMHirT-H~l~-----------c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~q  245 (279)
T KOG2462|consen  178 KMHIRT-HTLP-----------CECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQ  245 (279)
T ss_pred             hhHhhc-cCCC-----------cccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcccc
Confidence            999994 5432           789999997   4489999999999999999999999999999999999999999999


Q ss_pred             CCccccccCChHHHHHHHHh
Q psy359          373 CDICGRGFAQSNDMKKHRRT  392 (405)
Q Consensus       373 C~~C~~~f~~~~~l~~H~~~  392 (405)
                      |..|+|.|...+.|.+|...
T Consensus       246 C~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  246 CPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             CcchhhHHHHHHHHHHhhhh
Confidence            99999999999999999765



>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query405
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-23
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-14
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-14
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 4e-14
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 4e-14
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-14
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 8e-14
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 8e-14
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 2e-13
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-13
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-09
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-06
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 7e-12
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-11
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-11
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 7e-11
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-10
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 5e-10
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 7e-10
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-09
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-09
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-09
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 6e-09
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 9e-09
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-08
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 4e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 7e-08
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-07
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-07
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-07
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 4e-07
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 6e-07
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 2e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 5e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-05
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-06
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-05
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 1e-04
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2en6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2em2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-04
2epu_A45 Solution Structure Of The Secound C2h2 Type Zinc Fi 2e-04
2emj_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eqw_A42 Solution Structure Of The 6th C2h2 Type Zinc Finger 3e-04
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-04
2el4_A46 Solution Structure Of The 15th Zf-C2h2 Domain From 3e-04
2emm_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 3e-04
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 4e-04
2ytg_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2emk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2eq3_A46 Solution Structure Of The 17th C2h2 Type Zinc Finge 5e-04
2eq1_A46 Solution Structure Of The 9th C2h2 Type Zinc Finger 5e-04
2em4_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2ene_A46 Solution Structure Of The C2h2 Type Zinc Finger (re 6e-04
2ep1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2emp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2eoe_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2ep2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2emw_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 106 bits (265), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 71/210 (33%), Positives = 95/210 (45%), Gaps = 48/210 (22%) Query: 186 ERKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDFE 245 E+ + C C KSF R HL H RTHTGEKPY C C K F+ D Sbjct: 19 EKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKD-------------- 64 Query: 246 SVKNKTTPLTRYLNKHLHDAHPEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHMG 305 LTR+ H + +KC CG S + L+ H R Sbjct: 65 --------LTRHQRTHTGEK-------------PYKCPECGKSFSQRANLRAHQRT---- 99 Query: 306 LSRKYHYEYKPDGVCDVCGEYKKQLLQ---HKRLHFPLRPYACTQCDKTFKKKNHLTTHY 362 H KP C CG+ QL H+R H +PY C +C K+F ++++L TH Sbjct: 100 -----HTGEKPY-ACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQ 153 Query: 363 RIHTGEKPYQCDICGRGFAQSNDMKKHRRT 392 R HTGEKPY+C CG+ F++ + + H+RT Sbjct: 154 RTHTGEKPYKCPECGKSFSRRDALNVHQRT 183
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EN6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 887- 919) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EM2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 584- 616) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2EPU|A Chain A, Solution Structure Of The Secound C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 32 Length = 45 Back     alignment and structure
>pdb|2EMJ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 612- 644) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EQW|A Chain A, Solution Structure Of The 6th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 484 Length = 42 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2EL4|A Chain A, Solution Structure Of The 15th Zf-C2h2 Domain From Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EMM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 544- 576) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2YTG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 369- 401) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2EMK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 668- 700) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EQ3|A Chain A, Solution Structure Of The 17th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EQ1|A Chain A, Solution Structure Of The 9th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EM4|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 724- 756) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2ENE|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (region 592- 624) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EP1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 435- 467) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EMP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 536- 568) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EOE|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 508- 540) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EP2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 603- 635) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EMW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 301- 331) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query405
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-35
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-29
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-27
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-16
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-16
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-26
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 7e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-23
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-21
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-18
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-18
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-15
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-12
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-22
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-18
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-17
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-11
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-21
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-12
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-14
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-21
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-11
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-20
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-20
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-20
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-20
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-20
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-20
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-19
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-18
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-13
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-19
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-19
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-16
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-18
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-18
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-12
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-18
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-13
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-15
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-13
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-15
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-14
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-14
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-14
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-14
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-14
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-14
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-14
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-14
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-14
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-14
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-14
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-14
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-13
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-10
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-13
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-13
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-13
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-10
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-13
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-13
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-10
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-13
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-13
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-13
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-13
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-12
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-12
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-12
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 9e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 8e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-11
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 6e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 9e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-10
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-10
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 9e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-10
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 9e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 8e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 7e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 1e-06
1ard_A29 Yeast transcription factor ADR1; transcription reg 4e-06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 8e-06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 5e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 2e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 6e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 4e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 6e-05
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 5e-05
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 7e-04
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 8e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  126 bits (319), Expect = 8e-35
 Identities = 71/226 (31%), Positives = 99/226 (43%), Gaps = 55/226 (24%)

Query: 173 TNLAAHHNEVHAHERKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDR 232
           ++  A    +   E+ + C  C KSF R  HL  H RTHTGEKPY C  C K F+   D 
Sbjct: 7   SSSVAQA-ALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDL 65

Query: 233 IKHLKSSHNFDFESVKNKTTPLTRYLNKHLHDAHPEAIKT-ERERKLIFKCDLCGNILSS 291
            +H +                                  T E+     +KC  CG   S 
Sbjct: 66  TRHQR--------------------------------THTGEKP----YKCPECGKSFSQ 89

Query: 292 KHILQEHVRVVHMGLSRKYHYE--YKPDGVCDVCGE---YKKQLLQHKRLHFPLRPYACT 346
           +  L+ H R  H G       E  Y     C  CG+       L  H+R H   +PY C 
Sbjct: 90  RANLRAHQRT-HTG-------EKPYA----CPECGKSFSQLAHLRAHQRTHTGEKPYKCP 137

Query: 347 QCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFAQSNDMKKHRRT 392
           +C K+F ++++L TH R HTGEKPY+C  CG+ F++ + +  H+RT
Sbjct: 138 ECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRT 183


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Length = 121 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Length = 28 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query405
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.86
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.86
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.85
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.85
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.84
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.83
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.83
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.83
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.76
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.74
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.72
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.7
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.69
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.68
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.68
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.67
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.66
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.65
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.65
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.65
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.63
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.63
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.63
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.63
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.62
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.61
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.6
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.58
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.58
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.58
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.57
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.57
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.57
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.56
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.55
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.54
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.53
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.53
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.53
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.52
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.52
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.52
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.51
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.49
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.49
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.48
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.45
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.45
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.44
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.43
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.42
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.4
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.38
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.37
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.36
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.36
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.34
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.29
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.29
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.29
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.27
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.27
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.26
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.25
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.25
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.25
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.24
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.24
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.23
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.23
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.23
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.22
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.21
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.21
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.2
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.19
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.19
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.18
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.18
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.17
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.17
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.17
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.16
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.16
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.15
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.14
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.14
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.13
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.09
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.09
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.03
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.03
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.03
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.03
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.03
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.02
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.02
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.01
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.01
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.0
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.0
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.98
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.97
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.96
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.96
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.95
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.95
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.93
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.91
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.9
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.87
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.87
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.85
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.85
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.81
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.77
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.73
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.69
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.68
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.67
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.62
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.62
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.59
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.56
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.53
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.53
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.5
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.48
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.47
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.47
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.39
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.36
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.29
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.28
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.26
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.26
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.25
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.23
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.23
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.2
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.2
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.18
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.16
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.16
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.14
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.14
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.13
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.13
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.13
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.1
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.1
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.1
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.1
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.08
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.35
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.06
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.06
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.06
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.06
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.33
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.05
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.05
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.04
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.03
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.02
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.29
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.28
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.02
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.02
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.01
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.96
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.89
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.88
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.11
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.07
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.65
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.62
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.49
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.26
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.44
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.4
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.19
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.97
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.94
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.88
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.12
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.95
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.3
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.06
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.06
2k5c_A95 Uncharacterized protein PF0385; structural genomic 89.15
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 87.75
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 86.78
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 86.14
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 85.36
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 83.94
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.07
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 80.11
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 80.1
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=6.6e-35  Score=245.86  Aligned_cols=143  Identities=38%  Similarity=0.775  Sum_probs=101.4

Q ss_pred             CCccCccchhccCChHHHHHHHhhhcCCCCcccccchHhhhChHHHHHHHhhhCCCCcccccCCCCcchHHhhhhhcccC
Q psy359          187 RKFPCTFCEKSFKRKLHLKVHTRTHTGEKPYACYLCDKRFAQISDRIKHLKSSHNFDFESVKNKTTPLTRYLNKHLHDAH  266 (405)
Q Consensus       187 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~c~~c~~~~~~~~~l~~h~~~~~  266 (405)
                      ++|.|..|++.|.+...|..|+..|+++++|.|..|++.|.+...|..|++.++                          
T Consensus        48 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~--------------------------  101 (190)
T 2i13_A           48 KPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHT--------------------------  101 (190)
T ss_dssp             CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHH--------------------------
T ss_pred             CCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHHhcC--------------------------
Confidence            445566666666666666666555555555666666666666666666655543                          


Q ss_pred             cchhhhhhhcccceecCCCcccCCChHHHHHHHhhhccCCCccccccCCCCCcCCCcccchHHHHhhhhhcCCCCccccc
Q psy359          267 PEAIKTERERKLIFKCDLCGNILSSKHILQEHVRVVHMGLSRKYHYEYKPDGVCDVCGEYKKQLLQHKRLHFPLRPYACT  346 (405)
Q Consensus       267 ~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~~~~C~~C~~~~~~l~~H~~~h~~~~~~~C~  346 (405)
                               ++.+|.|++|++.|.+...|..|+                                   ++|+++++|+|+
T Consensus       102 ---------~~~~~~C~~C~~~f~~~~~l~~H~-----------------------------------~~h~~~~~~~C~  137 (190)
T 2i13_A          102 ---------GEKPYACPECGKSFSQLAHLRAHQ-----------------------------------RTHTGEKPYKCP  137 (190)
T ss_dssp             ---------TCCCEECTTTCCEESSHHHHHHHH-----------------------------------HHHHCCCCEECT
T ss_pred             ---------CCCCCcCCCCCCccCCHHHHHHHH-----------------------------------HHhCCCCCeECC
Confidence                     234566666666666655555555                                   456778899999


Q ss_pred             cccccccCchhHHHHhhhhCCCCcccCCccccccCChHHHHHHHHhhcccccc
Q psy359          347 QCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFAQSNDMKKHRRTVHKAQIH  399 (405)
Q Consensus       347 ~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~  399 (405)
                      +|++.|.+...|..|++.|+++++|.|++|++.|.+...|..|+++|++++||
T Consensus       138 ~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          138 ECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             TTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             CCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            99999999999999999999999999999999999999999999999999986



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 405
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-11
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-09
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 9e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 5e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 9e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.002
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 6e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 8e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 7e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 9e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.001
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
d1wira_121 g.37.1.5 (A:) Protein arginine N-methyltransferase 6e-05
d2dlqa330 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 3e-04
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 3e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 6e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 55.0 bits (133), Expect = 6e-11
 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 341 RPYACTQCDKTFKKKNHLTTHYR-IHTGEKPYQCDI 375
           +PY C  C K F + +HL  H + +HT E+P++C +
Sbjct: 4   KPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 121 Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query405
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.62
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.42
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.19
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.19
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.13
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.12
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.11
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.11
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.08
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.08
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.06
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.04
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.99
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.95
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.92
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.92
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.92
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.91
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.9
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.88
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.86
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.86
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.83
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.79
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.75
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.75
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.73
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.6
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.6
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.57
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.54
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.5
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.5
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.35
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.34
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.32
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.26
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.19
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.12
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.07
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.05
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.04
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.04
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.97
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.97
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.86
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.82
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.81
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.71
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.68
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.66
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.57
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.57
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.54
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.51
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.46
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.43
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.35
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.25
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.24
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.15
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.11
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.11
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.11
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.07
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.06
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.03
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.99
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.88
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.88
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.87
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.86
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.86
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.79
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.67
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.55
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.53
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.38
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.3
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.17
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.12
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.08
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.05
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.02
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.61
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.48
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.37
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.33
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.21
d1y0jb136 U-shaped transcription factor, different fingers { 94.79
d1y0jb136 U-shaped transcription factor, different fingers { 94.57
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.5
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.18
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.45
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.45
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.89
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.89
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.98
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 91.56
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.2
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.99
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.88
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.12
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 90.1
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 89.94
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 88.16
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.14
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 87.13
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 87.11
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.92
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 84.79
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 84.07
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 83.61
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 83.3
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 83.01
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 82.24
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 80.62
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.62  E-value=1e-16  Score=101.29  Aligned_cols=53  Identities=32%  Similarity=0.788  Sum_probs=50.8

Q ss_pred             CCccccccccccccCchhHHHHhhhhCCCCcccCCccccccCChHHHHHHHHhh
Q psy359          340 LRPYACTQCDKTFKKKNHLTTHYRIHTGEKPYQCDICGRGFAQSNDMKKHRRTV  393 (405)
Q Consensus       340 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  393 (405)
                      |+||+| .||++|.....|..|+++|.|++||.|.+|++.|.+.+.|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            589999 59999999999999999999999999999999999999999999876



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure