Psyllid ID: psy3652


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MFRSVRHLQCLRFRSYSDSVSKYPFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRAAYAAWAALPAPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHKKKIDRPGYFVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWKQYCRRSTVTINHGKEITLAQGIKFE
ccccccccccccccccccccccHHHHHHccccccccccEEEccEEEccccEEEccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccEEEEEEccccccEEEEcHHHHHHHHHHHHHHHHccHHHHccccccccccccccHHHHHHHHHccEEcccccccccccEEEEEccccccccccccccEEcccccHHHHHHHcccccEEEEEEcccHHHHHHHHcccccccEEEEEcccHHHHHHHHcccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHEEEEEEEEEcccccccccccccc
ccccEEcccHHHHHHHHHHHcccccccccccccccccEEEEccEEEccccEEEEEccccccEEEEEccccHHHHHHHHHHHHHHcccHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccEcccccHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHHHccccEEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHcccEEccEEEEcccccccccccccccEcccccccccEEEHHHccccHEEEccccHHHHHHHHccccHcHEHEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccHHHHHHHHHEEEEEEEEEcccccccHcccEcc
mfrsvrhlqclrfrsysdsvskypflkelglsgsvnpgvydgtswkangeiipsinpstgetiASVQQGNVQDYHRCIESSRAAYAAWAalpaprrgeIVRQIGDALRHklvplgqlvsLEMGKILAEGIGEVQEFIDICDYAvglsrtysgsilpserpghvllenwnplgvvGIISAFNFPVAVYGWNAAIALVGVAVQSRFGKLLLElggnnaiivnEDADLNLAQQCLVFAccgtagqrctTTRRLFLHkkkidrpgyfveptivtglphnsrvvhretfapivyvfpfdsldeAITWNNEvkqglsssiftkDVTNLFkwlgpqgsdcglinvniptngaeiggafggekytgggresgsdswkQYCRRSTVTINHGKEITLAQGIKFE
mfrsvrhlqclrfrsysdsvskYPFLKelglsgsvnpGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRAAYAAWAALPAPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFlhkkkidrpgyfVEPTivtglphnsrvVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWKQYCRRstvtinhgkeitlaqgikfe
MFRSVRHLQCLRFRSYSDSVSKYPFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRaayaawaalpaPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHKKKIDRPGYFVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWKQYCRRSTVTINHGKEITLAQGIKFE
*****RHLQCLRFRSYSDSVSKYPFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRAAYAAWAALPAPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHKKKIDRPGYFVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYT**********WKQYCRRSTVTINHGKEITLA******
***********************PFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRAAYAAWAALPAPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHKKKIDRPGYFVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWKQYCRRSTVTINHGKEITLAQGI***
MFRSVRHLQCLRFRSYSDSVSKYPFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRAAYAAWAALPAPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHKKKIDRPGYFVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYT***********KQYCRRSTVTINHGKEITLAQGIKFE
***SVRHLQCLRFRSYSDSVSKYPFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRAAYAAWAALPAPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHKKKIDRPGYFVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWKQYCRRSTVTINHGKEITLAQGIKFE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRSVRHLQCLRFRSYSDSVSKYPFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRAAYAAWAALPAPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHKKKIDRPGYFVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWKQYCRRSTVTINHGKEITLAQGIKFE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query394 2.2.26 [Sep-21-2011]
P46562531 Putative aldehyde dehydro yes N/A 0.507 0.376 0.540 1e-68
P49419539 Alpha-aminoadipic semiald no N/A 0.505 0.369 0.515 4e-66
Q64057539 Alpha-aminoadipic semiald yes N/A 0.505 0.369 0.523 5e-66
Q9DBF1539 Alpha-aminoadipic semiald yes N/A 0.505 0.369 0.527 6e-66
P25795508 Aldehyde dehydrogenase fa N/A N/A 0.532 0.413 0.503 1e-61
Q2KJC9 539 Alpha-aminoadipic semiald yes N/A 0.439 0.320 0.628 5e-60
Q9ZPB7508 Aldehyde dehydrogenase fa N/A N/A 0.532 0.413 0.492 2e-59
P83401509 Putative aldehyde dehydro yes N/A 0.649 0.502 0.392 5e-58
Q41247 494 Aldehyde dehydrogenase fa N/A N/A 0.444 0.354 0.587 6e-56
Q9SYG7 508 Aldehyde dehydrogenase fa yes N/A 0.444 0.344 0.579 2e-55
>sp|P46562|AL7A1_CAEEL Putative aldehyde dehydrogenase family 7 member A1 homolog OS=Caenorhabditis elegans GN=alh-9 PE=3 SV=2 Back     alignment and function desciption
 Score =  260 bits (665), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 163/261 (62%), Gaps = 61/261 (23%)

Query: 195 LVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHK 254
           +VG  VQ+RFGKLLLELGGNNAIIVNEDADLN+     VFA  GTAGQRCTTTRRL +H 
Sbjct: 271 IVGQQVQARFGKLLLELGGNNAIIVNEDADLNMVVPATVFAAVGTAGQRCTTTRRLIVHD 330

Query: 255 KKID---------------RPGYFVEPTIVTGLPHN------------------------ 275
           K  D               R G  ++   + G  HN                        
Sbjct: 331 KVYDQVLERLKKAYAQFESRIGCPLDSNTIIGPLHNQQAVGKYKASVAEAVASGGKIEYG 390

Query: 276 ----------------------SRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSS 313
                                 S VV RETFAPI+YV  F +L+EAI  NNEV QGLSSS
Sbjct: 391 GKVLERDGNFVLPTIVTGLKHDSPVVLRETFAPILYVLKFSTLEEAIAINNEVDQGLSSS 450

Query: 314 IFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWKQYCR 373
           +FT ++ N+FKW+GP+GSDCG++NVNIPT+GAEIGGAFGGEK TGGGRESGSDSW+QY R
Sbjct: 451 LFTTNIQNVFKWMGPKGSDCGIVNVNIPTSGAEIGGAFGGEKETGGGRESGSDSWRQYMR 510

Query: 374 RSTVTINHGKEITLAQGIKFE 394
           RST TIN+ KE+ LAQGIKFE
Sbjct: 511 RSTCTINYSKELPLAQGIKFE 531





Caenorhabditis elegans (taxid: 6239)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 3
>sp|P49419|AL7A1_HUMAN Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens GN=ALDH7A1 PE=1 SV=5 Back     alignment and function description
>sp|Q64057|AL7A1_RAT Alpha-aminoadipic semialdehyde dehydrogenase OS=Rattus norvegicus GN=Aldh7a1 PE=1 SV=2 Back     alignment and function description
>sp|Q9DBF1|AL7A1_MOUSE Alpha-aminoadipic semialdehyde dehydrogenase OS=Mus musculus GN=Aldh7a1 PE=1 SV=4 Back     alignment and function description
>sp|P25795|AL7A1_PEA Aldehyde dehydrogenase family 7 member A1 OS=Pisum sativum PE=1 SV=3 Back     alignment and function description
>sp|Q2KJC9|AL7A1_BOVIN Alpha-aminoadipic semialdehyde dehydrogenase OS=Bos taurus GN=ALDH7A1 PE=2 SV=4 Back     alignment and function description
>sp|Q9ZPB7|AL7A1_MALDO Aldehyde dehydrogenase family 7 member A1 OS=Malus domestica PE=1 SV=3 Back     alignment and function description
>sp|P83401|AL7A1_DICDI Putative aldehyde dehydrogenase family 7 member A1 homolog OS=Dictyostelium discoideum GN=DDB_G0276821 PE=3 SV=2 Back     alignment and function description
>sp|Q41247|AL7A1_BRANA Aldehyde dehydrogenase family 7 member A1 OS=Brassica napus GN=BTG-26 PE=1 SV=3 Back     alignment and function description
>sp|Q9SYG7|AL7B4_ARATH Aldehyde dehydrogenase family 7 member B4 OS=Arabidopsis thaliana GN=ALDH7B4 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query394
444727966 540 Alpha-aminoadipic semialdehyde dehydroge 0.941 0.687 0.477 1e-118
148223856 511 alpha-aminoadipic semialdehyde dehydroge 0.941 0.726 0.474 1e-113
62858515 511 alpha-aminoadipic semialdehyde dehydroge 0.941 0.726 0.462 1e-108
224073640 516 predicted protein [Populus trichocarpa] 0.941 0.718 0.449 1e-103
322796034463 hypothetical protein SINV_80107 [Solenop 0.984 0.838 0.469 1e-102
383764383 504 piperideine-6-carboxylate dehydrogenase 0.936 0.732 0.396 5e-84
426349812448 PREDICTED: alpha-aminoadipic semialdehyd 0.865 0.761 0.459 3e-83
423316779 516 hypothetical protein HMPREF9699_01255 [B 0.934 0.713 0.395 7e-82
406673541 516 hypothetical protein HMPREF9700_01304 [B 0.934 0.713 0.393 2e-81
363582410 513 l-aminoadipate-semialdehyde dehydrogenas 0.913 0.701 0.391 6e-81
>gi|444727966|gb|ELW68437.1| Alpha-aminoadipic semialdehyde dehydrogenase [Tupaia chinensis] Back     alignment and taxonomy information
 Score =  432 bits (1110), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 241/505 (47%), Positives = 294/505 (58%), Gaps = 134/505 (26%)

Query: 22  KYPFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESS 81
           +Y +LKELGL    N GVY+G SW   GE+I +  P+  E IA V+Q ++ DY   ++ +
Sbjct: 38  QYAWLKELGLREE-NEGVYNG-SWGGRGEVITTYCPANNEPIARVRQASMVDYEETVKKA 95

Query: 82  RAAYAAWAALPAPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICD 141
           R A+  WA +PAP+RGEIVRQIGDALR K+  LG LVSLEMGKIL EG+GEVQE++DICD
Sbjct: 96  REAWKVWADIPAPKRGEIVRQIGDALREKIQVLGNLVSLEMGKILVEGVGEVQEYVDICD 155

Query: 142 YAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYG------------- 188
           YAVGLSR   G ILPSERPGH L+E WNP+G+VGII+AFNFPVAVYG             
Sbjct: 156 YAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVC 215

Query: 189 -WNAA-----------------IALVGVAVQSRFGKLL---------------------- 208
            W  A                  +L+ VAV     K+L                      
Sbjct: 216 LWKGAPTTSLISVAVTKKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTA 275

Query: 209 ---------------LELGGNNAIIVNE-----DADLNLAQQCLVFACCGTAGQRCTTTR 248
                           ++G   A++V E     DADL+L     +FA  GTAGQRCTT R
Sbjct: 276 MAKDKRVNLLSFTGSTQVGKQVALLVQERFVFEDADLSLVVPSALFAAVGTAGQRCTTAR 335

Query: 249 RLF----------------------------------LHKKK------------------ 256
           RLF                                  LH K+                  
Sbjct: 336 RLFLHENIHDEVVNRLKKAYAQIRVGNPWDSDVLYGPLHTKQAVSMFLGAVEAARKEGGT 395

Query: 257 -------IDRPGYFVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQG 309
                  +DRPG +VEPTIVTGL HN+ + H ETFAPI+YVF F   +E   WNNEV+QG
Sbjct: 396 VVCGGQVMDRPGNYVEPTIVTGLAHNASIAHTETFAPILYVFKFKEEEEVFAWNNEVQQG 455

Query: 310 LSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWK 369
           LSSSIFTKD+  +F+WLGP+GSDCG++NVNIPT+GAEIGGAFGGEK+TGGGRESGSD+WK
Sbjct: 456 LSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWK 515

Query: 370 QYCRRSTVTINHGKEITLAQGIKFE 394
           QY RRST TIN+ K++ LAQGIKF+
Sbjct: 516 QYMRRSTCTINYSKDLPLAQGIKFQ 540




Source: Tupaia chinensis

Species: Tupaia chinensis

Genus: Tupaia

Family: Tupaiidae

Order: Scandentia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|148223856|ref|NP_001087698.1| alpha-aminoadipic semialdehyde dehydrogenase [Xenopus laevis] gi|51703516|gb|AAH81104.1| MGC83352 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|62858515|ref|NP_001016377.1| alpha-aminoadipic semialdehyde dehydrogenase [Xenopus (Silurana) tropicalis] gi|89266774|emb|CAJ83722.1| aldehyde dehydrogenase 7 family, member A1 [Xenopus (Silurana) tropicalis] gi|170284491|gb|AAI61027.1| aldehyde dehydrogenase 7 family, member A1 [Xenopus (Silurana) tropicalis] gi|213625564|gb|AAI70873.1| aldehyde dehydrogenase 7 family, member A1 [Xenopus (Silurana) tropicalis] gi|213627169|gb|AAI70848.1| aldehyde dehydrogenase 7 family, member A1 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|224073640|ref|XP_002304124.1| predicted protein [Populus trichocarpa] gi|222841556|gb|EEE79103.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|322796034|gb|EFZ18658.1| hypothetical protein SINV_80107 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383764383|ref|YP_005443365.1| piperideine-6-carboxylate dehydrogenase [Caldilinea aerophila DSM 14535 = NBRC 104270] gi|381384651|dbj|BAM01468.1| piperideine-6-carboxylate dehydrogenase [Caldilinea aerophila DSM 14535 = NBRC 104270] Back     alignment and taxonomy information
>gi|426349812|ref|XP_004042480.1| PREDICTED: alpha-aminoadipic semialdehyde dehydrogenase [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|423316779|ref|ZP_17294684.1| hypothetical protein HMPREF9699_01255 [Bergeyella zoohelcum ATCC 43767] gi|405582870|gb|EKB56852.1| hypothetical protein HMPREF9699_01255 [Bergeyella zoohelcum ATCC 43767] Back     alignment and taxonomy information
>gi|406673541|ref|ZP_11080762.1| hypothetical protein HMPREF9700_01304 [Bergeyella zoohelcum CCUG 30536] gi|405586006|gb|EKB59798.1| hypothetical protein HMPREF9700_01304 [Bergeyella zoohelcum CCUG 30536] Back     alignment and taxonomy information
>gi|363582410|ref|ZP_09315220.1| l-aminoadipate-semialdehyde dehydrogenase [Flavobacteriaceae bacterium HQM9] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query394
WB|WBGene00000115 531 alh-9 [Caenorhabditis elegans 0.441 0.327 0.630 1.7e-133
UNIPROTKB|P46562 531 alh-9 "Putative aldehyde dehyd 0.441 0.327 0.630 1.7e-133
ZFIN|ZDB-GENE-030131-6129541 aldh7a1 "aldehyde dehydrogenas 0.355 0.258 0.742 1e-131
UNIPROTKB|E1BFG0539 ALDH7A1 "Alpha-aminoadipic sem 0.355 0.259 0.735 1e-131
UNIPROTKB|Q2KJC9539 ALDH7A1 "Alpha-aminoadipic sem 0.355 0.259 0.735 1e-131
UNIPROTKB|E2RQ99539 ALDH7A1 "Uncharacterized prote 0.355 0.259 0.721 2.8e-131
UNIPROTKB|P49419539 ALDH7A1 "Alpha-aminoadipic sem 0.355 0.259 0.721 2.4e-130
UNIPROTKB|E1C4W4536 ALDH7A1 "Uncharacterized prote 0.355 0.261 0.714 1.5e-128
UNIPROTKB|F8VS02475 ALDH7A1 "Alpha-aminoadipic sem 0.492 0.408 0.693 5.5e-128
MGI|MGI:108186539 Aldh7a1 "aldehyde dehydrogenas 0.355 0.259 0.714 3.5e-127
WB|WBGene00000115 alh-9 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 563 (203.2 bits), Expect = 1.7e-133, Sum P(3) = 1.7e-133
 Identities = 111/176 (63%), Positives = 130/176 (73%)

Query:    21 SKYPFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIES 80
             SKY FLKELGL+ + N GV+ G  W A+G+++ S  P+    IA+VQ GNVQDY   I  
Sbjct:    27 SKYGFLKELGLTEN-NAGVFHG-KWAASGQVVQSFAPANNSPIANVQNGNVQDYEIAISE 84

Query:    81 SRXXXXXXXXXXXPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDIC 140
             ++           PRRGEIVRQIGD LR +L  LG+LVSLEMGKI AEG+GEVQE++DIC
Sbjct:    85 AKKAYNDWCEVPAPRRGEIVRQIGDKLRTQLQNLGKLVSLEMGKISAEGVGEVQEYVDIC 144

Query:   141 DYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALV 196
             DYA GLSR+  G I PSERPGH LLE WNPLGVVG+ISAFNFP AVYGWN A+ALV
Sbjct:   145 DYATGLSRSLEGKIFPSERPGHALLEQWNPLGVVGVISAFNFPCAVYGWNNALALV 200


GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
UNIPROTKB|P46562 alh-9 "Putative aldehyde dehydrogenase family 7 member A1 homolog" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6129 aldh7a1 "aldehyde dehydrogenase 7 family, member A1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BFG0 ALDH7A1 "Alpha-aminoadipic semialdehyde dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJC9 ALDH7A1 "Alpha-aminoadipic semialdehyde dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQ99 ALDH7A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P49419 ALDH7A1 "Alpha-aminoadipic semialdehyde dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4W4 ALDH7A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F8VS02 ALDH7A1 "Alpha-aminoadipic semialdehyde dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:108186 Aldh7a1 "aldehyde dehydrogenase family 7, member A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P46562AL7A1_CAEEL1, ., 2, ., 1, ., 30.54020.50760.3766yesN/A
Q9SYG7AL7B4_ARATH1, ., 2, ., 1, ., 30.57950.44410.3444yesN/A
Q9DBF1AL7A1_MOUSE1, ., 2, ., 1, ., 80.52710.50500.3692yesN/A
Q2KJC9AL7A1_BOVIN1, ., 2, ., 1, ., 80.62850.43900.3209yesN/A
Q64057AL7A1_RAT1, ., 2, ., 1, ., 80.52320.50500.3692yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.10.921

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
cd07130474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 0.0
cd07086478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 1e-178
PLN02315508 PLN02315, PLN02315, aldehyde dehydrogenase family 1e-84
PLN02315 508 PLN02315, PLN02315, aldehyde dehydrogenase family 2e-80
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 1e-51
pfam00171 459 pfam00171, Aldedh, Aldehyde dehydrogenase family 5e-42
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 9e-42
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 6e-37
cd07088 468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 6e-36
cd07131 478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 8e-36
cd07097 473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 3e-34
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 6e-34
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 2e-32
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 1e-30
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 2e-29
cd07131478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 1e-26
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 1e-26
cd07103 451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 5e-25
cd07146451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 1e-24
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 2e-24
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 3e-24
cd07094453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 1e-23
cd07149453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 2e-23
TIGR01804 467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 9e-23
cd07108 457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 4e-22
cd07124 512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 7e-22
cd07114 457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 2e-21
cd07100429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 3e-21
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 3e-21
cd07106446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 5e-21
PLN02278 498 PLN02278, PLN02278, succinic semialdehyde dehydrog 6e-21
cd07106 446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 8e-21
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 3e-20
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 4e-20
cd07147452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 6e-20
cd07095431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 7e-20
cd07119 482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 4e-19
cd07151465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 5e-19
cd07141481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 7e-19
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 7e-19
cd07150 451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 8e-19
cd07107 456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 9e-19
cd07092450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 1e-18
PRK13252 488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 2e-18
cd07125 518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 5e-18
PRK13968462 PRK13968, PRK13968, putative succinate semialdehyd 7e-18
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 8e-18
cd07097473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 9e-18
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 1e-17
cd07110 456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 1e-17
cd07152 443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 2e-17
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 3e-17
PRK13473475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 3e-17
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 5e-17
PRK11905 1208 PRK11905, PRK11905, bifunctional proline dehydroge 7e-17
cd07112462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 8e-17
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 9e-17
cd07120 455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 2e-16
TIGR03216481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 2e-16
cd07089459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 2e-16
PRK11241 482 PRK11241, gabD, succinate-semialdehyde dehydrogena 3e-16
cd07090 457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 4e-16
TIGR01780448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 4e-16
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 5e-16
TIGR01722 477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 5e-16
cd07149 453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 7e-16
cd07113477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 7e-16
cd07151 465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 9e-16
PRK11904 1038 PRK11904, PRK11904, bifunctional proline dehydroge 1e-15
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 1e-15
cd07104 431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 2e-15
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 2e-15
cd07093 455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 2e-15
COG4230 769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 2e-15
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 3e-15
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 3e-15
cd07099 453 cd07099, ALDH_DDALDH, Methylomonas sp 4e-15
cd07091 476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 4e-15
TIGR01237 511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 4e-15
cd07147 452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 5e-15
TIGR02299 488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 5e-15
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 1e-14
cd07144 484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 1e-14
cd07101 454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 1e-14
cd07082473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 1e-14
TIGR03374 472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 2e-14
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 3e-14
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 3e-14
cd07118 454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 3e-14
cd07140486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 3e-14
cd07139 471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 4e-14
PRK09407 524 PRK09407, gabD2, succinic semialdehyde dehydrogena 4e-14
cd07138 466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 6e-14
cd07143481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 8e-14
PLN02467503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 9e-14
cd07113 477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 1e-13
cd07083 500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 1e-13
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 2e-13
TIGR01780 448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 2e-13
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 2e-13
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 2e-13
PLN02766501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 3e-13
PLN02467 503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 4e-13
TIGR01238 500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 4e-13
cd07111 480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 4e-13
PLN02278498 PLN02278, PLN02278, succinic semialdehyde dehydrog 6e-13
cd07100 429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 8e-13
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 8e-13
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 8e-13
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 9e-13
PRK10090409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 9e-13
PRK03137 514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 9e-13
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 1e-12
cd07107456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 2e-12
cd07112 462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 2e-12
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 2e-12
TIGR04284480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 2e-12
PLN00412 496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 2e-12
cd07559 480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 3e-12
TIGR03240 484 TIGR03240, arg_catab_astD, succinylglutamic semial 3e-12
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 3e-12
cd07117475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 3e-12
PRK09457 487 PRK09457, astD, succinylglutamic semialdehyde dehy 3e-12
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 4e-12
cd07089 459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 5e-12
cd07559480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 7e-12
cd07117 475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 8e-12
cd07097473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 1e-11
TIGR01804467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 1e-11
cd07111480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 1e-11
cd07131478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 2e-11
cd07102 452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 2e-11
PLN02419 604 PLN02419, PLN02419, methylmalonate-semialdehyde de 2e-11
cd07098465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 3e-11
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 5e-11
cd07092 450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 9e-11
cd07119482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 1e-10
PRK13473 475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 1e-10
PRK11241482 PRK11241, gabD, succinate-semialdehyde dehydrogena 1e-10
TIGR03374472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 2e-10
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 2e-10
PRK11809 1318 PRK11809, putA, trifunctional transcriptional regu 2e-10
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 3e-10
cd07082 473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 4e-10
cd07116 479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 5e-10
cd07120455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 8e-10
TIGR01237511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 1e-09
cd07095 431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 2e-09
cd07140 486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 4e-09
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 4e-09
cd07110456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 5e-09
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 6e-09
cd07143 481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 7e-09
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 8e-09
PRK10090 409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 1e-08
cd07138466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 2e-08
cd07116479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 2e-08
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 2e-08
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 4e-08
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 1e-07
cd07110456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 1e-07
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 1e-07
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 2e-07
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 2e-07
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 3e-07
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 3e-07
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 4e-07
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 5e-07
PTZ00381493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 6e-07
TIGR01722477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 1e-06
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 1e-06
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 2e-06
PRK09457487 PRK09457, astD, succinylglutamic semialdehyde dehy 2e-06
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 2e-06
PRK09847 494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 2e-06
PRK09847494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 2e-06
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 2e-06
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 3e-06
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 3e-06
TIGR04284 480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 4e-06
cd07148455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 4e-06
cd07128513 cd07128, ALDH_MaoC-N, N-terminal domain of the mon 8e-06
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 1e-05
PLN02419604 PLN02419, PLN02419, methylmalonate-semialdehyde de 1e-05
TIGR03216 481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 2e-05
cd07148 455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 2e-05
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3e-05
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 4e-05
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 4e-05
cd07105 432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 4e-05
PRK10090409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 5e-05
PRK09406 457 PRK09406, gabD1, succinic semialdehyde dehydrogena 7e-05
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 8e-05
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 9e-05
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 1e-04
TIGR01236532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 1e-04
PLN00412496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 2e-04
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 2e-04
PRK13968462 PRK13968, PRK13968, putative succinate semialdehyd 3e-04
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 4e-04
cd07123522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 4e-04
cd07098465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 5e-04
TIGR01236 532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 5e-04
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 8e-04
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 9e-04
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 0.002
cd07112462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 0.002
PLN00412496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 0.002
PRK09457487 PRK09457, astD, succinylglutamic semialdehyde dehy 0.002
PRK11241482 PRK11241, gabD, succinate-semialdehyde dehydrogena 0.003
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 0.003
cd07098 465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 0.003
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 0.003
cd07084442 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+ 0.004
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
 Score =  540 bits (1393), Expect = 0.0
 Identities = 213/475 (44%), Positives = 263/475 (55%), Gaps = 131/475 (27%)

Query: 38  GVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRAAYAAWAALPAPRRG 97
           GVYDG  W   G ++ SI+P+ GE IA V+Q   +DY   I++++ A+  W  +PAP+RG
Sbjct: 1   GVYDGE-WGGGGGVVTSISPANGEPIARVRQATPEDYESTIKAAQEAFKEWRDVPAPKRG 59

Query: 98  EIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICDYAVGLSRTYSGSILPS 157
           EIVRQIGDALR K   LG+LVSLEMGKIL EG+GEVQE IDICD+AVGLSR   G  +PS
Sbjct: 60  EIVRQIGDALRKKKEALGKLVSLEMGKILPEGLGEVQEMIDICDFAVGLSRQLYGLTIPS 119

Query: 158 ERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALV----------------GVAVQ 201
           ERPGH ++E WNPLGVVG+I+AFNFPVAV+GWNAAIALV                 +AV 
Sbjct: 120 ERPGHRMMEQWNPLGVVGVITAFNFPVAVWGWNAAIALVCGNVVVWKPSPTTPLTAIAVT 179

Query: 202 SRFGKLLLELGGNNAI------------IVNEDADLNL---------------------- 227
               ++L + G   AI             + +D  + L                      
Sbjct: 180 KIVARVLEKNGLPGAIASLVCGGADVGEALVKDPRVPLVSFTGSTAVGRQVGQAVAARFG 239

Query: 228 ----------------------AQQCLVFACCGTAGQRCTTTRRLFLHKKKIDR------ 259
                                 A + ++FA  GTAGQRCTTTRRL +H+   D       
Sbjct: 240 RSLLELGGNNAIIVMEDADLDLAVRAVLFAAVGTAGQRCTTTRRLIVHESIYDEVLERLK 299

Query: 260 -------------PGYFVEP----------------------TIVTG------------- 271
                         G  V P                      T++ G             
Sbjct: 300 KAYKQVRIGDPLDDGTLVGPLHTKAAVDNYLAAIEEAKSQGGTVLFGGKVIDGPGNYVEP 359

Query: 272 ----LPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNLFKWLG 327
                  ++ +V  ETFAPI+YV  FD+L+EAI WNNEV QGLSSSIFT D+ N F+WLG
Sbjct: 360 TIVEGLSDAPIVKEETFAPILYVLKFDTLEEAIAWNNEVPQGLSSSIFTTDLRNAFRWLG 419

Query: 328 PQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWKQYCRRSTVTINHG 382
           P+GSDCG++NVNI T+GAEIGGAFGGEK TGGGRESGSD+WKQY RRST TIN+ 
Sbjct: 420 PKGSDCGIVNVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKQYMRRSTCTINYS 474


Alpha-aminoadipic semialdehyde dehydrogenase (AASADH, EC=1.2.1.31), also known as ALDH7A1, Antiquitin-1, ALDH7B, or delta-1-piperideine-6-carboxylate dehydrogenase (P6CDH), is a NAD+-dependent ALDH. Human ALDH7A1 is involved in the pipecolic acid pathway of lysine catabolism, catalyzing the oxidation of alpha-aminoadipic semialdehyde to alpha-aminoadipate. Arabidopsis thaliana ALDH7B4 appears to be an osmotic-stress-inducible ALDH gene encoding a turgor-responsive or stress-inducible ALDH. The Streptomyces clavuligerus P6CDH appears to be involved in cephamycin biosynthesis, catalyzing the second stage of the two-step conversion of lysine to alpha-aminoadipic acid. The ALDH7A1 enzyme and others in this group have been observed as tetramers, yet the bacterial P6CDH enzyme has been reported as a monomer. Length = 474

>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143446 cd07128, ALDH_MaoC-N, N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|143403 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 394
PLN02315508 aldehyde dehydrogenase family 7 member 100.0
KOG2450|consensus501 100.0
KOG2451|consensus503 100.0
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 100.0
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 100.0
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 100.0
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 100.0
PLN02278498 succinic semialdehyde dehydrogenase 100.0
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 100.0
PLN02466538 aldehyde dehydrogenase family 2 member 100.0
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 100.0
PLN02766501 coniferyl-aldehyde dehydrogenase 100.0
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 100.0
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 100.0
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 100.0
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 100.0
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 100.0
PRK13252488 betaine aldehyde dehydrogenase; Provisional 100.0
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 100.0
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 100.0
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 100.0
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 100.0
PLN02467503 betaine aldehyde dehydrogenase 100.0
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 100.0
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 100.0
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 100.0
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 100.0
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 100.0
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 100.0
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 100.0
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 100.0
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 100.0
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 100.0
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 100.0
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 100.0
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 100.0
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 100.0
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 100.0
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 100.0
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 100.0
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 100.0
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 100.0
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 100.0
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 100.0
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 100.0
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 100.0
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 100.0
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 100.0
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 100.0
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 100.0
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 100.0
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 100.0
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 100.0
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 100.0
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 100.0
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 100.0
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 100.0
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 100.0
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 100.0
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 100.0
PRK11903521 aldehyde dehydrogenase; Provisional 100.0
PLN02174484 aldehyde dehydrogenase family 3 member H1 100.0
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 100.0
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 100.0
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 100.0
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 100.0
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 100.0
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 100.0
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 100.0
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 100.0
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 100.0
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 100.0
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 100.0
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 100.0
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 100.0
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 100.0
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 100.0
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 100.0
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 100.0
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 100.0
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 100.0
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 100.0
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 100.0
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 100.0
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 100.0
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 100.0
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 100.0
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 100.0
PLN02203484 aldehyde dehydrogenase 100.0
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 100.0
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 100.0
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 100.0
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 100.0
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 100.0
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 100.0
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 100.0
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 100.0
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 100.0
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 100.0
KOG2452|consensus881 100.0
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 100.0
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 100.0
KOG2453|consensus507 100.0
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
PRK10090409 aldehyde dehydrogenase A; Provisional 100.0
PRK11809 1318 putA trifunctional transcriptional regulator/proli 100.0
KOG2454|consensus583 100.0
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 100.0
KOG2456|consensus477 100.0
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 100.0
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 100.0
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 100.0
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 100.0
PRK15398465 aldehyde dehydrogenase EutE; Provisional 100.0
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 100.0
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 100.0
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 100.0
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 100.0
cd07127549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 100.0
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 100.0
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 100.0
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 100.0
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 100.0
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 100.0
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 100.0
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 100.0
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 100.0
KOG2455|consensus561 100.0
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 99.94
KOG4165|consensus433 99.85
cd07080422 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC. Ac 99.81
KOG2449|consensus157 99.46
PF05893399 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR0086 98.3
PF07368215 DUF1487: Protein of unknown function (DUF1487); In 98.27
PF00815412 Histidinol_dh: Histidinol dehydrogenase; InterPro: 94.64
PRK00877425 hisD bifunctional histidinal dehydrogenase/ histid 91.01
PRK12447426 histidinol dehydrogenase; Reviewed 89.73
PLN02926431 histidinol dehydrogenase 89.54
cd06572390 Histidinol_dh Histidinol dehydrogenase, HisD, E.C 89.23
TIGR00069393 hisD histidinol dehydrogenase. This model describe 88.53
COG0141425 HisD Histidinol dehydrogenase [Amino acid transpor 87.15
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
Probab=100.00  E-value=1.9e-79  Score=625.72  Aligned_cols=372  Identities=64%  Similarity=1.087  Sum_probs=341.3

Q ss_pred             CcchhhhhcCCCCCCCCCceeCCeeccCCCeeeeecCCCCCeEEEEeCCCHHHHHHHHHHHHHHHHHhhcCChhhHHHHH
Q psy3652          21 SKYPFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRAAYAAWAALPAPRRGEIV  100 (394)
Q Consensus        21 ~~~~~~~~~~~~~~~~~~~~i~G~~~~~~~~~~v~nP~tg~~i~~v~~a~~~~v~~av~aA~~A~~~w~~~~~~~R~~~L  100 (394)
                      ++|++|.+.... ++..++||||+|+.++.+++++||.||+++++++.++.+|+++|+++|++||+.|+++|.++|.++|
T Consensus         6 ~~~~~~~~~~~~-~~~~~~~I~G~~~~~~~~~~~~nP~t~~~i~~~~~a~~~~v~~av~~A~~A~~~W~~~~~~~R~~~L   84 (508)
T PLN02315          6 KEYEFLSEIGLS-SRNLGCYVGGEWRANGPLVSSVNPANNQPIAEVVEASLEDYEEGLRACEEAAKIWMQVPAPKRGEIV   84 (508)
T ss_pred             HHHHHHHHHhcC-ccccCceECCEEecCCCeeeeECCCCCCEEEEEeCCCHHHHHHHHHHHHHHHHHHhcCCHHHHHHHH
Confidence            467888887766 8889999999998667889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhCHHHHHHHHHHHcCCChHHhHHHHHHHHHHHHHHHHhhhhccCcccCCCCCCceeEeeeccceeEEEEccC
Q psy3652         101 RQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQEFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAF  180 (394)
Q Consensus       101 ~~~a~~l~~~~~~l~~~~~~e~Gk~~~~a~~ev~~~~~~l~~~a~~~~~~~~~~~~~~~~~~~~~~~~~P~GVV~~I~p~  180 (394)
                      ++++++|++++++|++++++|+|||..+++.|+..+++.++|+++.++.+.++..+...++...+..++|+|||++|+||
T Consensus        85 ~~~a~~l~~~~~~la~~~~~e~GK~~~~a~~ev~~~i~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~P~GVV~~I~Pw  164 (508)
T PLN02315         85 RQIGDALRAKLDYLGRLVSLEMGKILAEGIGEVQEIIDMCDFAVGLSRQLNGSIIPSERPNHMMMEVWNPLGIVGVITAF  164 (508)
T ss_pred             HHHHHHHHhHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCccccCCCCCceeEEEEecceEEEEECCC
Confidence            99999999999999999999999999999999999999999999988887766555433344556789999999999999


Q ss_pred             CchhHhHHHHHHHHh-----------------------------------------------------------------
Q psy3652         181 NFPVAVYGWNAAIAL-----------------------------------------------------------------  195 (394)
Q Consensus       181 N~P~~~~~~~~~~aL-----------------------------------------------------------------  195 (394)
                      |||+.++++++++||                                                                 
T Consensus       165 N~P~~~~~~~~~~ALaaGN~VVlKPs~~tp~~~~~~~~l~~~~~~~aGlP~gvv~~v~g~~~~~~~l~~~~~v~~v~fTG  244 (508)
T PLN02315        165 NFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKLVAEVLEKNNLPGAIFTSFCGGAEIGEAIAKDTRIPLVSFTG  244 (508)
T ss_pred             cchHHHHHHHHhHHHHcCCEEEeeCCCcChHHHHHHHHHHHHHHHHcCCCcccEEEecCChHHHHHHhcCCCCCEEEEEC
Confidence            999999999999999                                                                 


Q ss_pred             ---hHHHHHh----hhhhhccccCCCCeEEEecCCCHHHHHHHHHHHhhCcCCCcccCCceEEEecc-------------
Q psy3652         196 ---VGVAVQS----RFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHKK-------------  255 (394)
Q Consensus       196 ---~g~~i~~----~~~~~~lElgGk~p~iV~~dADl~~aa~~i~~~~~~~~GQ~C~a~~rv~V~~~-------------  255 (394)
                         +|+.|++    +++|+++|+|||||+||++|||++.|++.+++++|.|+||.|++++|||||++             
T Consensus       245 S~~~G~~v~~~aa~~~~~~~lElgGknp~iV~~dADl~~Aa~~i~~~~f~~~GQ~C~a~~rv~V~~~i~d~f~~~l~~~~  324 (508)
T PLN02315        245 SSKVGLMVQQTVNARFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQRCTTCRRLLLHESIYDDVLEQLLTVY  324 (508)
T ss_pred             CHHHHHHHHHHHHhcCCCEEEecCCCCeEEECCCCCHHHHHHHHHHHHHHhcCCCCCCCeEEEEeHHHHHHHHHHHHHHH
Confidence               6777765    45799999999999999999999999999999999999999999999999999             


Q ss_pred             ----------------------------------------------cCCCCCceecCeEEEcCCCCCcccccccccceEE
Q psy3652         256 ----------------------------------------------KIDRPGYFVEPTIVTGLPHNSRVVHRETFAPIVY  289 (394)
Q Consensus       256 ----------------------------------------------~~~~~g~~~~Ptvl~~v~~~~~i~~eE~FGPvl~  289 (394)
                                                                    ..+..|+|+.|||+ +++++|++++||+||||++
T Consensus       325 ~~l~vG~p~~~~~~~Gpli~~~~~~~v~~~i~~a~~~Ga~vl~gG~~~~~~g~~~~Ptvl-~v~~~~~i~~eE~FGPVl~  403 (508)
T PLN02315        325 KQVKIGDPLEKGTLLGPLHTPESKKNFEKGIEIIKSQGGKILTGGSAIESEGNFVQPTIV-EISPDADVVKEELFGPVLY  403 (508)
T ss_pred             HhcCCCCCCCCCCCCCCCcCHHHHHHHHHHHHHHHHCCCEEEECCCcCCCCCeEEecEEE-ecCCCChHHhCCCcCCEEE
Confidence                                                          01124889999999 6999999999999999999


Q ss_pred             EEeeCCHHHHHHHHhcCCCCcEEEEEcCCHHHHHHhhcccccceeEEEEcCCCCCCCCCCCccCCCCCCCCCCchHHHHH
Q psy3652         290 VFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWK  369 (394)
Q Consensus       290 v~~~~~~~eAi~~~n~~~~gLsa~v~t~d~~~a~~~~~~~~~~~g~V~iN~~~~~~~~~~pfGG~~~SG~G~~~g~~~l~  369 (394)
                      |++|+|+||||+++|+++|||+++|||+|.+.+++++++.++++|+||||.++....+.+||||+|.||+|+++|.++++
T Consensus       404 V~~~~~~deai~~aN~~~~gL~a~Vft~d~~~a~~~~~~~~l~~G~v~iN~~~~~~~~~~PfGG~k~SG~G~~~G~~~l~  483 (508)
T PLN02315        404 VMKFKTLEEAIEINNSVPQGLSSSIFTRNPETIFKWIGPLGSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGSDSWK  483 (508)
T ss_pred             EEEeCCHHHHHHHHhCCCCCCeEEEEcCCHHHHHHHhhhcccceeEEEEcCCCCCCCCCCCCCccccccCCccchHHHHH
Confidence            99999999999999999999999999999999999984447999999999865555677899999999999999999999


Q ss_pred             hhhheeEEEEecCCcccccccccCC
Q psy3652         370 QYCRRSTVTINHGKEITLAQGIKFE  394 (394)
Q Consensus       370 ~f~~~k~v~~~~~~~~~~~~~~~~~  394 (394)
                      +|++.|+++++++..+|++|+++|+
T Consensus       484 ~ft~~k~v~~~~~~~~~~~~~~~~~  508 (508)
T PLN02315        484 QYMRRSTCTINYGNELPLAQGINFG  508 (508)
T ss_pred             HHhhEEEEEEecCCCCCcccCCCCC
Confidence            9999999999987888999999996



>KOG2450|consensus Back     alignment and domain information
>KOG2451|consensus Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>KOG2452|consensus Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>KOG2453|consensus Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2454|consensus Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>KOG2456|consensus Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>KOG2455|consensus Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4165|consensus Back     alignment and domain information
>cd07080 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC Back     alignment and domain information
>KOG2449|consensus Back     alignment and domain information
>PF05893 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR008670 This family consists of several bacterial Acyl-CoA reductase (LuxC) proteins Back     alignment and domain information
>PF07368 DUF1487: Protein of unknown function (DUF1487); InterPro: IPR009961 This family consists of several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>PF00815 Histidinol_dh: Histidinol dehydrogenase; InterPro: IPR012131 Histidinol dehydrogenase (HDH) catalyzes the terminal step in the biosynthesis of histidine in bacteria, fungi, and plants, the four-electron oxidation of L-histidinol to histidine Back     alignment and domain information
>PRK00877 hisD bifunctional histidinal dehydrogenase/ histidinol dehydrogenase; Reviewed Back     alignment and domain information
>PRK12447 histidinol dehydrogenase; Reviewed Back     alignment and domain information
>PLN02926 histidinol dehydrogenase Back     alignment and domain information
>cd06572 Histidinol_dh Histidinol dehydrogenase, HisD, E Back     alignment and domain information
>TIGR00069 hisD histidinol dehydrogenase Back     alignment and domain information
>COG0141 HisD Histidinol dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
2jg7_A510 Crystal Structure Of Seabream Antiquitin And Elucid 8e-72
2j6l_A500 Structure Of Aminoadipate-Semialdehyde Dehydrogenas 3e-62
1bi9_A499 Retinal Dehydrogenase Type Two With Nad Bound Lengt 5e-15
1nzw_A500 Cys302ser Mutant Of Human Mitochondrial Aldehyde De 2e-13
2wme_A 490 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-13
2wme_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-08
2wox_A 489 Betaine Aldehyde Dehydrogenase From Pseudomonas Aer 2e-13
2wox_A489 Betaine Aldehyde Dehydrogenase From Pseudomonas Aer 3e-08
2xdr_A 489 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-13
2xdr_A489 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-08
2wme_C 490 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-13
2wme_C490 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-08
3n80_A500 Human Mitochondrial Aldehyde Dehydrogenase, Apo For 3e-13
3zqa_A 490 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-13
3zqa_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-08
3n81_A500 T244a Mutant Of Human Mitochondrial Aldehyde Dehydr 4e-13
1o05_A500 Apo Form Of Human Mitochondrial Aldehyde Dehydrogen 4e-13
4dal_A498 Crystal Structure Of Putative Aldehyde Dehydrogenas 6e-13
2onn_A500 Arg475gln Mutant Of Human Mitochondrial Aldehyde De 1e-12
3inl_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 7e-12
1zum_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 1e-11
3efv_A462 Crystal Structure Of A Putative Succinate-Semialdeh 5e-11
3efv_A462 Crystal Structure Of A Putative Succinate-Semialdeh 7e-06
1wnb_A495 Escherichia Coli Ydcw Gene Product Is A Medium-Chai 5e-11
2o2p_A517 Crystal Structure Of The C-Terminal Domain Of Rat 1 6e-11
1ag8_A499 Aldehyde Dehydrogenase From Bovine Mitochondria Len 6e-11
4dng_A485 Crystal Structure Of Putative Aldehyde Dehydrogenas 7e-11
3rhm_A517 Crystal Structure Of The E673q Mutant Of C-Terminal 7e-11
3rhj_A517 Crystal Structure Of The E673a Mutant Of The C-Term 7e-11
3rhr_A517 Crystal Structure Of The C707a Mutant Of The C-Term 8e-11
3rhl_A517 Crystal Structure Of The E673aC707A DOUBLE MUTANT O 8e-11
4gnz_A517 Crystal Structure Of The C707s Mutant Of C-terminal 8e-11
1bxs_A501 Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad 1e-10
3rjl_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 1e-10
2opx_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 2e-10
1o9j_A501 The X-Ray Crystal Structure Of Eta-Crystallin Lengt 2e-10
1uzb_A516 1-pyrroline-5-carboxylate Dehydrogenase Length = 51 3e-10
1a4s_A503 Betaine Aldehyde Dehydrogenase From Cod Liver Lengt 3e-10
2hg2_A 479 Structure Of Lactaldehyde Dehydrogenase Length = 47 3e-10
2hg2_A479 Structure Of Lactaldehyde Dehydrogenase Length = 47 2e-09
3r31_A517 Crystal Structure Of Betaine Aldehyde Dehydrogenase 4e-10
2imp_A 479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 4e-10
2imp_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 2e-09
3ed6_A 520 1.7 Angstrom Resolution Crystal Structure Of Betain 4e-10
3ed6_A520 1.7 Angstrom Resolution Crystal Structure Of Betain 4e-09
3k2w_A497 Crystal Structure Of Betaine-Aldehyde Dehydrogenase 4e-10
3i44_A497 Crystal Structure Of Aldehyde Dehydrogenase From Ba 6e-10
2bja_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 8e-10
2bhp_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 8e-10
3ty7_A478 Crystal Structure Of Aldehyde Dehydrogenase Family 1e-09
3b4w_A495 Crystal Structure Of Mycobacterium Tuberculosis Ald 1e-09
3jz4_C481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 1e-09
3jz4_A481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 1e-09
4a0m_A496 Crystal Structure Of Betaine Aldehyde Dehydrogenase 2e-09
4fr8_A500 Crystal Structure Of Human Aldehyde Dehydrogenase-2 2e-09
1cw3_A494 Human Mitochondrial Aldehyde Dehydrogenase Complexe 2e-09
3iwk_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 1 4e-09
1t90_A 486 Crystal Structure Of Methylmalonate Semialdehyde De 4e-09
1t90_A486 Crystal Structure Of Methylmalonate Semialdehyde De 2e-05
3ifg_A484 Crystal Structure Of Succinate-Semialdehyde Dehydro 7e-09
4i8q_A 514 Structure Of The Aminoaldehyde Dehydrogenase 1 E260 2e-08
4i8q_A514 Structure Of The Aminoaldehyde Dehydrogenase 1 E260 3e-08
4i9b_A517 Structure Of Aminoaldehyde Dehydrogenase 1 From Sol 2e-08
4i8p_A520 Crystal Structure Of Aminoaldehyde Dehydrogenase 1a 5e-08
3ek1_A504 Crystal Structure Of Aldehyde Dehydrogenase From Br 5e-08
3iwj_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 2 9e-08
3rh9_A 506 The Crystal Structure Of Oxidoreductase From Marino 9e-08
3rh9_A506 The Crystal Structure Of Oxidoreductase From Marino 2e-06
3pqa_A486 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-07
2d4e_A515 Crystal Structure Of The Hpcc From Thermus Thermoph 2e-07
3ros_A484 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 2e-07
4h7n_A474 The Structure Of Putative Aldehyde Dehydrogenase Pu 3e-07
3qan_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 3e-07
3qan_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 2e-04
4f9i_A1026 Crystal Structure Of Proline Utilization A (Puta) F 4e-07
3u4j_A528 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 2e-06
2id2_A475 Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 2e-06
2id2_A475 Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 6e-05
1euh_A475 Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase 2e-06
1euh_A475 Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase 6e-05
3prl_A505 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 2e-06
2esd_A475 Crystal Structure Of Thioacylenzyme Intermediate Of 1e-05
2esd_A475 Crystal Structure Of Thioacylenzyme Intermediate Of 6e-05
3ju8_A490 Crystal Structure Of Succinylglutamic Semialdehyde 2e-05
1qi1_A475 Ternary Complex Of An Nadp Dependent Aldehyde Dehyd 2e-05
1qi1_A475 Ternary Complex Of An Nadp Dependent Aldehyde Dehyd 6e-05
3r64_A508 Crystal Structure Of A Nad-Dependent Benzaldehyde D 3e-05
3lv1_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 6e-05
3v9h_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 1e-04
3v9g_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 1e-04
3v9i_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 1e-04
1uxv_A501 Structural Basis For Allosteric Regulation And Subs 1e-04
1ad3_A452 Class 3 Aldehyde Dehydrogenase Complex With Nicotin 1e-04
1ky8_A501 Crystal Structure Of The Non-Phosphorylating Glycer 1e-04
2w8n_A487 The Crytal Structure Of The Oxidized Form Of Human 2e-04
4e4g_A 521 Crystal Structure Of Putative Methylmalonate-Semial 2e-04
2w8p_A487 The Crystal Structure Of Human C340a Ssadh Length = 2e-04
1uxn_A501 Structural Basis For Allosteric Regulation And Subs 2e-04
3sza_A469 Crystal Structure Of Human Aldh3a1 - Apo Form Lengt 2e-04
3v9j_A563 Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylat 9e-04
>pdb|2JG7|A Chain A, Crystal Structure Of Seabream Antiquitin And Elucidation Of Its Substrate Specificity Length = 510 Back     alignment and structure

Iteration: 1

Score = 267 bits (682), Expect = 8e-72, Method: Compositional matrix adjust. Identities = 141/259 (54%), Positives = 167/259 (64%), Gaps = 59/259 (22%) Query: 195 LVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRC-TTTRRLF-- 251 +V + VQ RFG+ LLELGGNNAIIV EDADLNL VFA GTAGQRC TT R + Sbjct: 252 MVAMMVQERFGRKLLELGGNNAIIVFEDADLNLVVPSAVFASVGTAGQRCTTTRRLMLHE 311 Query: 252 -------------------------------LHKKK------------------------ 256 LH K+ Sbjct: 312 SVHDAVVERIAKAYKQVRIGDPWDPSTLYGPLHTKQAVDQYLAAIEQAKQQGGTLVCGGK 371 Query: 257 -IDRPGYFVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIF 315 +DRPG +VEPTI+TGL H++ +VH ETF PI+YV F + +EA WNNEV+QGLSSSIF Sbjct: 372 VMDRPGNYVEPTIITGLAHDAPIVHTETFVPILYVLKFKTEEEAFAWNNEVQQGLSSSIF 431 Query: 316 TKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWKQYCRRS 375 TKD+ +F+WLGP+GSDCG++NVNIPT+GAEIGGAFGGEK+TGGGRESGSDSWKQY RRS Sbjct: 432 TKDLGRVFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKQYMRRS 491 Query: 376 TVTINHGKEITLAQGIKFE 394 T TIN+ K++ LAQGIKFE Sbjct: 492 TCTINYSKDLPLAQGIKFE 510
>pdb|2J6L|A Chain A, Structure Of Aminoadipate-Semialdehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|1BI9|A Chain A, Retinal Dehydrogenase Type Two With Nad Bound Length = 499 Back     alignment and structure
>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nadh And Mg2+ Length = 500 Back     alignment and structure
>pdb|2WME|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2WME|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2WOX|A Chain A, Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa With Nad(P)h-Catalytic Thiol Adduct. Length = 489 Back     alignment and structure
>pdb|2WOX|A Chain A, Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa With Nad(P)h-Catalytic Thiol Adduct. Length = 489 Back     alignment and structure
>pdb|2XDR|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant E252a From Pseudomonas Aeruginosa Length = 489 Back     alignment and structure
>pdb|2XDR|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant E252a From Pseudomonas Aeruginosa Length = 489 Back     alignment and structure
>pdb|2WME|C Chain C, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2WME|C Chain C, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|3ZQA|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant C286a From Pseudomonas Aeruginosa In Complex With Nadph Length = 490 Back     alignment and structure
>pdb|3ZQA|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant C286a From Pseudomonas Aeruginosa In Complex With Nadph Length = 490 Back     alignment and structure
>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|4DAL|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 498 Back     alignment and structure
>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Complexed With Agonist Alda-1 Length = 500 Back     alignment and structure
>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Apo Form Length = 500 Back     alignment and structure
>pdb|3EFV|A Chain A, Crystal Structure Of A Putative Succinate-Semialdehyde Dehydrogenase From Salmonella Typhimurium Lt2 With Bound Nad Length = 462 Back     alignment and structure
>pdb|3EFV|A Chain A, Crystal Structure Of A Putative Succinate-Semialdehyde Dehydrogenase From Salmonella Typhimurium Lt2 With Bound Nad Length = 462 Back     alignment and structure
>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495 Back     alignment and structure
>pdb|2O2P|A Chain A, Crystal Structure Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|1AG8|A Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria Length = 499 Back     alignment and structure
>pdb|4DNG|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Bacillus Subtilis Subsp. Subtilis Str. 168 Length = 485 Back     alignment and structure
>pdb|3RHM|A Chain A, Crystal Structure Of The E673q Mutant Of C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3RHJ|A Chain A, Crystal Structure Of The E673a Mutant Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|3RHR|A Chain A, Crystal Structure Of The C707a Mutant Of The C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadph Length = 517 Back     alignment and structure
>pdb|3RHL|A Chain A, Crystal Structure Of The E673aC707A DOUBLE MUTANT OF THE C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|4GNZ|A Chain A, Crystal Structure Of The C707s Mutant Of C-terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadp Length = 517 Back     alignment and structure
>pdb|1BXS|A Chain A, Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad Bound Length = 501 Back     alignment and structure
>pdb|3RJL|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Licheniformis (Target Nysgrc-000337) Length = 538 Back     alignment and structure
>pdb|2OPX|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From Escherichia Coli Length = 479 Back     alignment and structure
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin Length = 501 Back     alignment and structure
>pdb|1UZB|A Chain A, 1-pyrroline-5-carboxylate Dehydrogenase Length = 516 Back     alignment and structure
>pdb|1A4S|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver Length = 503 Back     alignment and structure
>pdb|2HG2|A Chain A, Structure Of Lactaldehyde Dehydrogenase Length = 479 Back     alignment and structure
>pdb|2HG2|A Chain A, Structure Of Lactaldehyde Dehydrogenase Length = 479 Back     alignment and structure
>pdb|3R31|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Agrobacterium Tumefaciens Length = 517 Back     alignment and structure
>pdb|2IMP|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From E. Coli: The Ternary Complex With Product Bound (L)-Lactate And Nadh. Length = 479 Back     alignment and structure
>pdb|2IMP|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From E. Coli: The Ternary Complex With Product Bound (L)-Lactate And Nadh. Length = 479 Back     alignment and structure
>pdb|3ED6|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of Betaine Aldehyde Dehydrogenase (Betb) From Staphylococcus Aureus Length = 520 Back     alignment and structure
>pdb|3ED6|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of Betaine Aldehyde Dehydrogenase (Betb) From Staphylococcus Aureus Length = 520 Back     alignment and structure
>pdb|3K2W|A Chain A, Crystal Structure Of Betaine-Aldehyde Dehydrogenase From Pseudoalteromonas Atlantica T6c Length = 497 Back     alignment and structure
>pdb|3I44|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Bartonella Henselae At 2.0a Resolution Length = 497 Back     alignment and structure
>pdb|2BJA|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nadh Length = 516 Back     alignment and structure
>pdb|2BHP|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nad. Length = 516 Back     alignment and structure
>pdb|3TY7|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase Family Protein From Staphylococcus Aureus Length = 478 Back     alignment and structure
>pdb|3B4W|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Aldehyde Dehydrogenase Complexed With Nad+ Length = 495 Back     alignment and structure
>pdb|3JZ4|C Chain C, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3JZ4|A Chain A, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Spinach In Complex With Nad Length = 496 Back     alignment and structure
>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In Complex With Nitroglycerin Length = 500 Back     alignment and structure
>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nad+ And Mn2+ Length = 494 Back     alignment and structure
>pdb|3IWK|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1 From Pisum Sativum (Psamadh1) Length = 503 Back     alignment and structure
>pdb|1T90|A Chain A, Crystal Structure Of Methylmalonate Semialdehyde Dehydrogenase From Bacillus Subtilis Length = 486 Back     alignment and structure
>pdb|1T90|A Chain A, Crystal Structure Of Methylmalonate Semialdehyde Dehydrogenase From Bacillus Subtilis Length = 486 Back     alignment and structure
>pdb|3IFG|A Chain A, Crystal Structure Of Succinate-Semialdehyde Dehydrogenase From Burkholderia Pseudomallei, Part 1 Of 2 Length = 484 Back     alignment and structure
>pdb|4I8Q|A Chain A, Structure Of The Aminoaldehyde Dehydrogenase 1 E260a Mutant From Solanum Lycopersicum (slamadh1-e260a) Length = 514 Back     alignment and structure
>pdb|4I8Q|A Chain A, Structure Of The Aminoaldehyde Dehydrogenase 1 E260a Mutant From Solanum Lycopersicum (slamadh1-e260a) Length = 514 Back     alignment and structure
>pdb|4I9B|A Chain A, Structure Of Aminoaldehyde Dehydrogenase 1 From Solanum Lycopersium (slamadh1) With A Thiohemiacetal Intermediate Length = 517 Back     alignment and structure
>pdb|4I8P|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1a From Zea Mays (zmamadh1a) Length = 520 Back     alignment and structure
>pdb|3EK1|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Brucella Melitensis Biovar Abortus 2308 Length = 504 Back     alignment and structure
>pdb|3IWJ|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From Pisum Sativum (Psamadh2) Length = 503 Back     alignment and structure
>pdb|3RH9|A Chain A, The Crystal Structure Of Oxidoreductase From Marinobacter Aquaeolei Length = 506 Back     alignment and structure
>pdb|3RH9|A Chain A, The Crystal Structure Of Oxidoreductase From Marinobacter Aquaeolei Length = 506 Back     alignment and structure
>pdb|3PQA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Gapn From Methanocaldococcus Jannaschii Dsm 2661 Length = 486 Back     alignment and structure
>pdb|2D4E|A Chain A, Crystal Structure Of The Hpcc From Thermus Thermophilus Hb8 Length = 515 Back     alignment and structure
>pdb|3ROS|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Lactobacillus Acidophilus Length = 484 Back     alignment and structure
>pdb|4H7N|A Chain A, The Structure Of Putative Aldehyde Dehydrogenase Puta From Anabaena Variabilis. Length = 474 Back     alignment and structure
>pdb|3QAN|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Halodurans Length = 538 Back     alignment and structure
>pdb|3QAN|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Halodurans Length = 538 Back     alignment and structure
>pdb|4F9I|A Chain A, Crystal Structure Of Proline Utilization A (Puta) From Geobacter Sulfurreducens Pca Length = 1026 Back     alignment and structure
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Sinorhizobium Meliloti Length = 528 Back     alignment and structure
>pdb|2ID2|A Chain A, Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 475 Back     alignment and structure
>pdb|2ID2|A Chain A, Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 475 Back     alignment and structure
>pdb|1EUH|A Chain A, Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase From Streptococcus Mutans Length = 475 Back     alignment and structure
>pdb|1EUH|A Chain A, Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase From Streptococcus Mutans Length = 475 Back     alignment and structure
>pdb|3PRL|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Halodurans C-125 Length = 505 Back     alignment and structure
>pdb|2ESD|A Chain A, Crystal Structure Of Thioacylenzyme Intermediate Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|2ESD|A Chain A, Crystal Structure Of Thioacylenzyme Intermediate Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|3JU8|A Chain A, Crystal Structure Of Succinylglutamic Semialdehyde Dehydrogenase From Pseudomonas Aeruginosa. Length = 490 Back     alignment and structure
>pdb|1QI1|A Chain A, Ternary Complex Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|1QI1|A Chain A, Ternary Complex Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|3R64|A Chain A, Crystal Structure Of A Nad-Dependent Benzaldehyde Dehydrogenase From Corynebacterium Glutamicum Length = 508 Back     alignment and structure
>pdb|3LV1|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ Length = 457 Back     alignment and structure
>pdb|3V9H|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352a Length = 566 Back     alignment and structure
>pdb|3V9G|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Length = 566 Back     alignment and structure
>pdb|3V9I|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352l Length = 566 Back     alignment and structure
>pdb|1UXV|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|1AD3|A Chain A, Class 3 Aldehyde Dehydrogenase Complex With Nicotinamide- Adenine-Dinucleotide Length = 452 Back     alignment and structure
>pdb|1KY8|A Chain A, Crystal Structure Of The Non-Phosphorylating Glyceraldehyde-3- Phosphate Dehydrogenase Length = 501 Back     alignment and structure
>pdb|2W8N|A Chain A, The Crytal Structure Of The Oxidized Form Of Human Ssadh Length = 487 Back     alignment and structure
>pdb|4E4G|A Chain A, Crystal Structure Of Putative Methylmalonate-Semialdehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 521 Back     alignment and structure
>pdb|2W8P|A Chain A, The Crystal Structure Of Human C340a Ssadh Length = 487 Back     alignment and structure
>pdb|1UXN|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|3SZA|A Chain A, Crystal Structure Of Human Aldh3a1 - Apo Form Length = 469 Back     alignment and structure
>pdb|3V9J|A Chain A, Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylate Dehydrogenase Complexed With Sulfate Ion Length = 563 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
2j6l_A 500 Aldehyde dehydrogenase family 7 member A1; NAD, re 7e-87
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 1e-69
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 6e-25
4f9i_A 1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 3e-35
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 8e-25
1uzb_A 516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 4e-35
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 1e-23
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 2e-12
3r64_A 508 NAD dependent benzaldehyde dehydrogenase; structur 1e-34
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 2e-25
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 9e-11
3qan_A 538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 3e-34
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 6e-28
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 6e-33
1euh_A 475 NADP dependent non phosphorylating glyceraldehyde- 8e-32
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 3e-32
3prl_A 505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 8e-31
3ju8_A 490 Succinylglutamic semialdehyde dehydrogenase; alpha 4e-32
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 2e-21
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 3e-11
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 2e-29
3haz_A 1001 Proline dehydrogenase; proline utilization A, PUTA 3e-25
3pqa_A 486 Lactaldehyde dehydrogenase; structural genomics, p 8e-28
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 6e-23
2imp_A 479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 4e-27
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 3e-18
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 1e-05
4dng_A 485 Uncharacterized aldehyde dehydrogenase ALDY; struc 9e-27
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 4e-21
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 2e-08
1ez0_A 510 ALDH, aldehyde dehydrogenase; nucleotide binding d 2e-26
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 5e-17
1uxt_A 501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 4e-26
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 2e-17
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 6e-10
2y53_A 534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 4e-26
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 1e-14
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 3e-09
3k2w_A 497 Betaine-aldehyde dehydrogenase; structural genomic 9e-25
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 2e-16
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 2e-05
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 2e-24
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 7e-07
2w8n_A 487 Succinate-semialdehyde dehydrogenase, mitochondria 2e-24
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 2e-16
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 2e-05
3ed6_A 520 Betaine aldehyde dehydrogenase; structural genomic 3e-24
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 9e-17
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 5e-08
1a4s_A 503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 4e-24
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 2e-16
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 4e-07
2ve5_A 490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 8e-24
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 1e-15
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 7e-07
3ros_A 484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 8e-24
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 1e-16
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 9e-08
3ek1_A 504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 1e-23
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 1e-19
3jz4_A 481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 1e-23
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 1e-16
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 2e-05
3rh9_A 506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 1e-23
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 1e-15
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 2e-05
3ifg_A 484 Succinate-semialdehyde dehydrogenase (NADP+); niai 2e-23
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 1e-16
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 2e-05
1wnd_A 495 Putative betaine aldehyde dehydrogenase; NADH, flu 2e-23
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 1e-21
3etf_A 462 Putative succinate-semialdehyde dehydrogenase; cen 3e-23
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 4e-17
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 2e-07
3b4w_A 495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 3e-23
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 7e-14
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 7e-08
4e4g_A 521 Methylmalonate-semialdehyde dehydrogenase; structu 5e-23
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 3e-06
3r31_A 517 BADH, betaine aldehyde dehydrogenase; structural g 1e-22
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 1e-16
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 5e-07
3i44_A 497 Aldehyde dehydrogenase; oxidoreductase, structural 2e-22
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 8e-13
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 5e-06
3v4c_A 528 Aldehyde dehydrogenase (NADP+); structural genomic 3e-22
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 2e-15
2d4e_A 515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 4e-22
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 2e-17
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 3e-07
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 4e-22
4f3x_A 498 Putative aldehyde dehydrogenase; structural genomi 1e-21
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 6e-07
3iwj_A 503 Putative aminoaldehyde dehydrogenase; rossmann fol 4e-22
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 8e-17
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 4e-08
3u4j_A 528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 5e-22
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 1e-16
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 7e-07
3ty7_A 478 Putative aldehyde dehydrogenase SAV2122; structura 2e-21
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 1e-12
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 5e-07
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 3e-21
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 4e-18
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 6e-21
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 1e-17
3k9d_A 464 LMO1179 protein, aldehyde dehydrogenase; structura 2e-20
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 2e-15
3my7_A 452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 6e-20
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 5e-16
2o2p_A 517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 8e-20
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 9e-17
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 9e-07
4e3x_A 563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 7e-16
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 5e-10
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 7e-10
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
 Score =  271 bits (695), Expect = 7e-87
 Identities = 111/182 (60%), Positives = 137/182 (75%), Gaps = 2/182 (1%)

Query: 15  SYSDSVSKYPFLKELGLSGSVNPGVYDGTSWKANGEIIPSINPSTGETIASVQQGNVQDY 74
           +   +  +Y +LKELGL    N GVY+G SW   GE+I +  P+  E IA V+Q +V DY
Sbjct: 4   TLLINQPQYAWLKELGLR-EENEGVYNG-SWGGRGEVITTYCPANNEPIARVRQASVADY 61

Query: 75  HRCIESSRAAYAAWAALPAPRRGEIVRQIGDALRHKLVPLGQLVSLEMGKILAEGIGEVQ 134
              ++ +R A+  WA +PAP+RGEIVRQIGDALR K+  LG LVSLEMGKIL EG+GEVQ
Sbjct: 62  EETVKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQ 121

Query: 135 EFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIA 194
           E++DICDYAVGLSR   G ILPSER GH L+E WNP+G+VGII+AFNFPVAVYGWN AIA
Sbjct: 122 EYVDICDYAVGLSRMIGGPILPSERSGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIA 181

Query: 195 LV 196
           ++
Sbjct: 182 MI 183


>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query394
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 100.0
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 100.0
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 100.0
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 100.0
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 100.0
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 100.0
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 100.0
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 100.0
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 100.0
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 100.0
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 100.0
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 100.0
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 100.0
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 100.0
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 100.0
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 100.0
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 100.0
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 100.0
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 100.0
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 100.0
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 100.0
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 100.0
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 100.0
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 100.0
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 100.0
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 100.0
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 100.0
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 100.0
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 100.0
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 100.0
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 100.0
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 100.0
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 100.0
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 100.0
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 100.0
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 100.0
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 100.0
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 100.0
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 100.0
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 100.0
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 100.0
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 100.0
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 100.0
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 100.0
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 100.0
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 100.0
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 100.0
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 100.0
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 100.0
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 100.0
4gic_A423 HDH, histidinol dehydrogenase; protein structure i 94.44
1kae_A434 HDH, histidinol dehydrogenase; L-histidinol dehydr 90.17
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-82  Score=646.51  Aligned_cols=344  Identities=31%  Similarity=0.525  Sum_probs=319.7

Q ss_pred             CCCceeCCeec--cCCCeeeeecCCCCCeEEEEeCCCHHHHHHHHHHHHHHHHHhhcCChhhHHHHHHHHHHHHhhCHHH
Q psy3652          36 NPGVYDGTSWK--ANGEIIPSINPSTGETIASVQQGNVQDYHRCIESSRAAYAAWAALPAPRRGEIVRQIGDALRHKLVP  113 (394)
Q Consensus        36 ~~~~~i~G~~~--~~~~~~~v~nP~tg~~i~~v~~a~~~~v~~av~aA~~A~~~w~~~~~~~R~~~L~~~a~~l~~~~~~  113 (394)
                      ..++||||+|+  .++++++++||+||+++++++.++.+|+++||++|++||+.|+.+|+++|.++|++++++|++++++
T Consensus         6 ~~kl~I~G~~~~~~~~~~~~v~nP~tg~~i~~v~~a~~~dv~~Av~aA~~A~~~W~~~~~~~R~~~L~~~a~~l~~~~~e   85 (490)
T 2wme_A            6 EQKLYIGGRYVEASSGATFETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDE   85 (490)
T ss_dssp             CBCEECSSSEECCSSSCEEEEECTTTCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHTHHH
T ss_pred             CCcEEECCeeeCCCCCCEEEeeCCCCCCEEEEEeCCCHHHHHHHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHHHHhHHH
Confidence            45799999998  4678999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCChHHhHH-HHHHHHHHHHHHHHhhhhccCcccCCCCCCceeEeeeccceeEEEEccCCchhHhHHHHHH
Q psy3652         114 LGQLVSLEMGKILAEGIG-EVQEFIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAA  192 (394)
Q Consensus       114 l~~~~~~e~Gk~~~~a~~-ev~~~~~~l~~~a~~~~~~~~~~~~~~~~~~~~~~~~~P~GVV~~I~p~N~P~~~~~~~~~  192 (394)
                      |++++++|+|||+.+++. |+..+++.++|++++++++.++..+.. ++...+++++|+|||++|+|||||+.+.+++++
T Consensus        86 la~~~~~e~Gk~~~ea~~~~v~~~~~~~~~~a~~~~~~~~~~~~~~-~~~~~~~~~~P~GVv~~I~PwNfP~~~~~~~~a  164 (490)
T 2wme_A           86 LAALETLDTGKPLAETRSVDIVTGADVLEYYAGLVPAIEGEQIPLR-ETSFVYTRREPLGVVAGIGAWNYPVQIALWKSA  164 (490)
T ss_dssp             HHHHHHHHHCCCHHHHTTTHHHHHHHHHHHHHHHGGGCCEEEEEEE-TTEEEEEEEEECSEEEEECCSSSHHHHHHHHHH
T ss_pred             HHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHhccccccCcccccc-CCcceeEEecceeEEEEeccccCcchhhhhhHH
Confidence            999999999999999975 799999999999999998877665543 456678899999999999999999999999999


Q ss_pred             HHh-----------------------------------------------------------------hHHHHHh-----
Q psy3652         193 IAL-----------------------------------------------------------------VGVAVQS-----  202 (394)
Q Consensus       193 ~aL-----------------------------------------------------------------~g~~i~~-----  202 (394)
                      +||                                                                 +|+.+.+     
T Consensus       165 ~ALaaGNtVVlKPse~tp~ta~~l~~l~~eaGlP~gv~~vv~g~g~~~g~~L~~~p~v~~I~FTGS~~~G~~i~~~~a~~  244 (490)
T 2wme_A          165 PALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTEHPLIEKISFTGGTSTGKKVMASASSS  244 (490)
T ss_dssp             HHHHTTCEEEEECCTTSCHHHHHHHHHHHHHTCCTTSEEECCSCTTTHHHHHHHCTTCCEEEEESCHHHHHHHHHHHHHH
T ss_pred             HHHHcCCeEEEECCcCCHHHHHHHHHHHHHhCCCCCcEEEEeCChHHHHHHHHhCCCCCEEEEECChHHHHHHHHhhhcc
Confidence            999                                                                 7766643     


Q ss_pred             hhhhhccccCCCCeEEEecCCCHHHHHHHHHHHhhCcCCCcccCCceEEEecc---------------------------
Q psy3652         203 RFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHKK---------------------------  255 (394)
Q Consensus       203 ~~~~~~lElgGk~p~iV~~dADl~~aa~~i~~~~~~~~GQ~C~a~~rv~V~~~---------------------------  255 (394)
                      ++||++||||||||+||++|||++.|++.+++++|.|+||.|++++|||||++                           
T Consensus       245 ~lk~v~lELGGk~p~iV~~dAdl~~A~~~~~~~~~~n~GQ~C~a~~rv~V~~~i~d~f~~~l~~~~~~l~vGdp~~~~~~  324 (490)
T 2wme_A          245 SLKEVTMELGGKSPLIIFPDADLDRAADIAVMANFFSSGQVCTNGTRVFIHRSQQARFEAKVLERVQRIRLGDPQDENTN  324 (490)
T ss_dssp             HCCEEEEECCCCCEEEECTTSCHHHHHHHHHHHHHGGGGCCTTCCCEEEEEGGGHHHHHHHHHHHHHTCCBSCTTSTTCC
T ss_pred             CCceEEEEcCCcCeEEEccCccHHHHHHHHHHHHhccCCCcCCCceeeccchhHHHHHHHHHHHHHHhCcCCCCccccCc
Confidence            56899999999999999999999999999999999999999999999999999                           


Q ss_pred             --------------------------------cC----CCCCceecCeEEEcCCCCCcccccccccceEEEEeeCCHHHH
Q psy3652         256 --------------------------------KI----DRPGYFVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEA  299 (394)
Q Consensus       256 --------------------------------~~----~~~g~~~~Ptvl~~v~~~~~i~~eE~FGPvl~v~~~~~~~eA  299 (394)
                                                      ..    ...|+|++|||+.+++++|++++||+||||++|++|+|+|||
T Consensus       325 ~Gpli~~~~~~rv~~~i~~a~~~Ga~v~~gG~~~~~~~~~~G~~~~Ptvl~~v~~~~~i~~eEiFGPVl~v~~~~~~deA  404 (490)
T 2wme_A          325 FGPLVSFPHMESVLGYIESGKAQKARLLCGGERVTDGAFGKGAYVAPTVFTDCRDDMTIVREEIFGPVMSILVYDDEDEA  404 (490)
T ss_dssp             BCCCSCHHHHHHHHHHHHHHHHTTCEEEECCSBCCTTTGGGTTCBCCEEEESCCTTSHHHHSCCCSSEEEEEEESCHHHH
T ss_pred             cCCcCCHHHHHHHHHHHHHHHhcCCEEEECCcccCcccccCCCccCCEEEEcCCCCChhhhccccCCEEEEEEeCCHHHH
Confidence                                            00    125899999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCcEEEEEcCCHHHHHHhhcccccceeEEEEcCCCCCCCCCCCccCCCCCCCCCCchHHHHHhhhheeEEEE
Q psy3652         300 ITWNNEVKQGLSSSIFTKDVTNLFKWLGPQGSDCGLINVNIPTNGAEIGGAFGGEKYTGGGRESGSDSWKQYCRRSTVTI  379 (394)
Q Consensus       300 i~~~n~~~~gLsa~v~t~d~~~a~~~~~~~~~~~g~V~iN~~~~~~~~~~pfGG~~~SG~G~~~g~~~l~~f~~~k~v~~  379 (394)
                      |+++|+++|||++||||+|.+++++++  .++++|+|+||+.. ...+.+||||+|.||+|+++|.+++++|++.|+|++
T Consensus       405 i~~aN~~~yGL~a~v~t~d~~~a~~~~--~~l~aG~v~iN~~~-~~~~~~PFGG~k~SG~Gre~G~~gl~~ft~~K~v~i  481 (490)
T 2wme_A          405 IRRANDTEYGLAAGVVTQDLARAHRAI--HRLEAGICWINTWG-ESPAEMPVGGYKQSGVGRENGLTTLAHYTRIKSVQV  481 (490)
T ss_dssp             HHHHHCSSCCSEEEEECSBHHHHHHHH--HHSCCSEEEESCCS-CCCTTSCBCCSGGGEESCBSHHHHHHTTEEEEEEEE
T ss_pred             HHHHhcCCCCCeEEEEcCCHHHHHHHH--HHCCeeEEEEeCCC-CCCCCCCcccccccccCchhHHHHHHHhhceeEEEE
Confidence            999999999999999999999999999  88999999999754 455779999999999999999999999999999999


Q ss_pred             ecCC
Q psy3652         380 NHGK  383 (394)
Q Consensus       380 ~~~~  383 (394)
                      +++.
T Consensus       482 ~~g~  485 (490)
T 2wme_A          482 ELGD  485 (490)
T ss_dssp             ECSC
T ss_pred             ECCC
Confidence            9743



>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>4gic_A HDH, histidinol dehydrogenase; protein structure initiative, STR genomics, PSI-biology, NEW YORK structural genomics researc consortium; 2.05A {Methylococcus capsulatus} Back     alignment and structure
>1kae_A HDH, histidinol dehydrogenase; L-histidinol dehydrogenase, homodimer, rossman fold, 4 domai L-histidine biosynthesis, NAD cofactor; HET: HSO NAD; 1.70A {Escherichia coli} SCOP: c.82.1.2 PDB: 1k75_A* 1kah_A* 1kar_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 394
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 9e-33
d1ad3a_ 446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-13
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-32
d1bxsa_ 494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-24
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 8e-07
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-32
d1o04a_ 494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-24
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-31
d1a4sa_ 503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 5e-19
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-07
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 1e-30
d1uzba_ 516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 2e-15
d1euha_474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-28
d1euha_ 474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-22
d1wnda_474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 6e-25
d1wnda_ 474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 1e-22
d1wnda_474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 2e-04
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 3e-24
d1ky8a_ 499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 6e-18
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 1e-04
d1ez0a_ 504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 5e-23
d1ez0a_504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-17
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 2e-18
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 1e-08
d1vlua_436 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 6e-09
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  125 bits (315), Expect = 9e-33
 Identities = 43/239 (17%), Positives = 84/239 (35%), Gaps = 55/239 (23%)

Query: 195 LVGVAVQSRFGKLLLELGGNNAIIVNEDADLNLAQQCLVFACCGTAGQRCTTTRRLFLHK 254
           +V  A       + LELGG +   V++D DL++A + + +     +GQ C     +    
Sbjct: 193 IVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSGQTCVAPDYILCDP 252

Query: 255 ----------------------------------------------------KKIDRPGY 262
                                                                  D+   
Sbjct: 253 SIQNQIVEKLKKSLKDFYGEDAKQSRDYGRIINDRHFQRVKGLIDNQKVAHGGTWDQSSR 312

Query: 263 FVEPTIVTGLPHNSRVVHRETFAPIVYVFPFDSLDEAITWNNEVKQGLSSSIFTKDVTNL 322
           ++ PTI+  +   S V+  E F P++ +    SL+EAI + N+ ++ L+  +F+ +   +
Sbjct: 313 YIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNEKVI 372

Query: 323 FKWLGPQGSDCGLINVNIPTNGAEIGGA-FGGEKYTGGGRESGSDSWKQYCRRSTVTIN 380
            K +    +  G +  N       +    FGG   +G G   G  S++ +  R +  + 
Sbjct: 373 KKMI--AETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVK 429


>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 436 Back     information, alignment and structure