Psyllid ID: psy3661

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11

MRGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGVEVVPRWFQTLAKTLKNQNQIQKCPKL

ccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEccEEEEEEcccccHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHccccccccc

cccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHccccccEEEEEEccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcHHHHHccccc

MRGIGEVQEVIDICDYAVglsrtysgsilpserpghvllenwnplgvvgiisafnfpvavygwnaaialpgwqVLGQVALVGVEVVPRWFQTLAKTLKNqnqiqkcpkl

MRGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGVEVVPRWFQTLAktlknqnqiqkcpkl

MRGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGVEVVPRWFQTLAKTLKNQNQIQKCPKL

*****EVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGVEVVPRWFQTLAKTL************

MRGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGVEVVPRWFQTLAKTLKNQNQI******

MRGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGVEVVPRWFQTLAKTLK***********

**GIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGVEVVPRWFQTLAKTLKNQNQIQKCPKL

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGVEVVPRWFQTLAKTLKNQNQIQKCPKL

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		109	2.2.26 [Sep-21-2011]
P46562		531	Putative aldehyde dehydro	yes	N/A	0.623	0.128	0.764	6e-27
Q2KJC9		539	Alpha-aminoadipic semiald	yes	N/A	0.633	0.128	0.739	6e-26
Q64057		539	Alpha-aminoadipic semiald	yes	N/A	0.633	0.128	0.739	1e-25
Q41247		494	Aldehyde dehydrogenase fa	N/A	N/A	0.623	0.137	0.735	1e-25
Q9SYG7		508	Aldehyde dehydrogenase fa	yes	N/A	0.623	0.133	0.735	1e-25
P25795		508	Aldehyde dehydrogenase fa	N/A	N/A	0.642	0.137	0.714	3e-25
P49419		539	Alpha-aminoadipic semiald	yes	N/A	0.633	0.128	0.739	3e-25
Q9DBF1		539	Alpha-aminoadipic semiald	yes	N/A	0.889	0.179	0.578	3e-25
P83401		509	Putative aldehyde dehydro	yes	N/A	0.596	0.127	0.707	2e-24
Q9ZPB7		508	Aldehyde dehydrogenase fa	N/A	N/A	0.623	0.133	0.720	6e-24

>sp\|P46562\|AL7A1_CAEEL Putative aldehyde dehydrogenase family 7 member A1 homolog OS=Caenorhabditis elegans GN=alh-9 PE=3 SV=2	Back alignment and function desciption

 Score =  119 bits (298), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 57/68 (83%)

Query: 2   RGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVY 61
            G+GEVQE +DICDYA GLSR+  G I PSERPGH LLE WNPLGVVG+ISAFNFP AVY
Sbjct: 132 EGVGEVQEYVDICDYATGLSRSLEGKIFPSERPGHALLEQWNPLGVVGVISAFNFPCAVY 191

Query: 62  GWNAAIAL 69
           GWN A+AL
Sbjct: 192 GWNNALAL 199

Caenorhabditis elegans (taxid: 6239)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 3

>sp\|Q2KJC9\|AL7A1_BOVIN Alpha-aminoadipic semialdehyde dehydrogenase OS=Bos taurus GN=ALDH7A1 PE=2 SV=4	Back alignment and function description

>sp\|Q64057\|AL7A1_RAT Alpha-aminoadipic semialdehyde dehydrogenase OS=Rattus norvegicus GN=Aldh7a1 PE=1 SV=2	Back alignment and function description

>sp\|Q41247\|AL7A1_BRANA Aldehyde dehydrogenase family 7 member A1 OS=Brassica napus GN=BTG-26 PE=1 SV=3	Back alignment and function description

>sp\|Q9SYG7\|AL7B4_ARATH Aldehyde dehydrogenase family 7 member B4 OS=Arabidopsis thaliana GN=ALDH7B4 PE=2 SV=3	Back alignment and function description

>sp\|P25795\|AL7A1_PEA Aldehyde dehydrogenase family 7 member A1 OS=Pisum sativum PE=1 SV=3	Back alignment and function description

>sp\|P49419\|AL7A1_HUMAN Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens GN=ALDH7A1 PE=1 SV=5	Back alignment and function description

>sp\|Q9DBF1\|AL7A1_MOUSE Alpha-aminoadipic semialdehyde dehydrogenase OS=Mus musculus GN=Aldh7a1 PE=1 SV=4	Back alignment and function description

>sp\|P83401\|AL7A1_DICDI Putative aldehyde dehydrogenase family 7 member A1 homolog OS=Dictyostelium discoideum GN=DDB_G0276821 PE=3 SV=2	Back alignment and function description

>sp\|Q9ZPB7\|AL7A1_MALDO Aldehyde dehydrogenase family 7 member A1 OS=Malus domestica PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		109
242010586		534	aldehyde dehydrogenase, putative [Pedicu	0.623	0.127	0.852	7e-28
91095113		516	PREDICTED: similar to aldehyde dehydroge	0.752	0.158	0.701	2e-27
332373112		540	unknown [Dendroctonus ponderosae]	0.623	0.125	0.808	6e-27
21914366		514	aldehyde dehydrogenase [Steinernema felt	0.623	0.132	0.779	8e-27
324507573		613	Aldehyde dehydrogenase family 7 member A	0.614	0.109	0.820	1e-26
193599010		535	PREDICTED: putative aldehyde dehydrogena	0.623	0.127	0.794	2e-26
324507354		533	Aldehyde dehydrogenase family 7 member A	0.623	0.127	0.808	2e-26
324520885		341	Aldehyde dehydrogenase family 7 member A	0.623	0.199	0.808	2e-26
443714190		541	hypothetical protein CAPTEDRAFT_179534 [	0.623	0.125	0.779	3e-26
322796034		463	hypothetical protein SINV_80107 [Solenop	0.623	0.146	0.808	3e-26

>gi\|242010586\|ref\|XP_002426046.1\| aldehyde dehydrogenase, putative [Pediculus humanus corporis] gi\|212510056\|gb\|EEB13308.1\| aldehyde dehydrogenase, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%)

Query: 2   RGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVY 61
            G+GEVQE +DICDYA GLSRT+ G ILPSERPGHVLLE WNPLGVVG+ISAFNFPVAVY
Sbjct: 135 EGVGEVQEFVDICDYATGLSRTFGGPILPSERPGHVLLEVWNPLGVVGVISAFNFPVAVY 194

Query: 62  GWNAAIAL 69
           GWNAAIAL
Sbjct: 195 GWNAAIAL 202

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|91095113\|ref\|XP_969882.1\| PREDICTED: similar to aldehyde dehydrogenase 7 family, member A1 [Tribolium castaneum] gi\|270015550\|gb\|EFA11998.1\| hypothetical protein TcasGA2_TC005191 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|332373112\|gb\|AEE61697.1\| unknown [Dendroctonus ponderosae]	Back alignment and taxonomy information

>gi\|21914366\|gb\|AAM81354.1\|AF522285_1 aldehyde dehydrogenase [Steinernema feltiae]	Back alignment and taxonomy information

>gi\|324507573\|gb\|ADY43210.1\| Aldehyde dehydrogenase family 7 member A1 [Ascaris suum]	Back alignment and taxonomy information

>gi\|193599010\|ref\|XP_001951859.1\| PREDICTED: putative aldehyde dehydrogenase family 7 member A1 homolog [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|324507354\|gb\|ADY43122.1\| Aldehyde dehydrogenase family 7 member A1 [Ascaris suum]	Back alignment and taxonomy information

>gi\|324520885\|gb\|ADY47734.1\| Aldehyde dehydrogenase family 7 member A1, partial [Ascaris suum]	Back alignment and taxonomy information

>gi\|443714190\|gb\|ELU06714.1\| hypothetical protein CAPTEDRAFT_179534 [Capitella teleta]	Back alignment and taxonomy information

>gi\|322796034\|gb\|EFZ18658.1\| hypothetical protein SINV_80107 [Solenopsis invicta]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		109
UNIPROTKB\|F1RKM1		438	ALDH7A1 "Uncharacterized prote	0.871	0.216	0.576	4.6e-26
ZFIN\|ZDB-GENE-030131-6129		541	aldh7a1 "aldehyde dehydrogenas	0.633	0.127	0.768	6.2e-26
UNIPROTKB\|J9NVL7		522	ALDH7A1 "Uncharacterized prote	0.697	0.145	0.675	1.9e-25
UNIPROTKB\|E1BFG0		539	ALDH7A1 "Alpha-aminoadipic sem	0.871	0.176	0.567	2.2e-25
UNIPROTKB\|Q2KJC9		539	ALDH7A1 "Alpha-aminoadipic sem	0.871	0.176	0.567	2.2e-25
UNIPROTKB\|E2RQ99		539	ALDH7A1 "Uncharacterized prote	0.697	0.141	0.675	2.2e-25
WB\|WBGene00000115		531	alh-9 [Caenorhabditis elegans	0.614	0.126	0.776	2.6e-25
UNIPROTKB\|P46562		531	alh-9 "Putative aldehyde dehyd	0.614	0.126	0.776	2.6e-25
UNIPROTKB\|H0YHM6		240	ALDH7A1 "Alpha-aminoadipic sem	0.697	0.316	0.675	2.9e-25
UNIPROTKB\|F8VS02		475	ALDH7A1 "Alpha-aminoadipic sem	0.697	0.16	0.675	7.3e-25

UNIPROTKB\|F1RKM1 ALDH7A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

 Score = 295 (108.9 bits), Expect = 4.6e-26, P = 4.6e-26
 Identities = 60/104 (57%), Positives = 75/104 (72%)

Query:     1 MRGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAV 60
             + G+GEVQE +DICDYAVGLSR   G ILPSERPGH L+E WNP+G+VGII+AFNFPVAV
Sbjct:    40 VEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAV 99

Query:    61 YGWNAAIALP-G----WQVLGQVALVGVEVVPRWFQTLAKTLKN 99
             YGWN AIA+  G    W+     +L+ V V     + +AK L++
Sbjct:   100 YGWNNAIAMICGNACLWKGAPTTSLISVAVT----KIIAKVLED 139

GO:0005739 "mitochondrion" evidence=IEA

GO:0004043 "L-aminoadipate-semialdehyde dehydrogenase activity" evidence=IEA

ZFIN\|ZDB-GENE-030131-6129 aldh7a1 "aldehyde dehydrogenase 7 family, member A1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|J9NVL7 ALDH7A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BFG0 ALDH7A1 "Alpha-aminoadipic semialdehyde dehydrogenase" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2KJC9 ALDH7A1 "Alpha-aminoadipic semialdehyde dehydrogenase" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RQ99 ALDH7A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

WB\|WBGene00000115 alh-9 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|P46562 alh-9 "Putative aldehyde dehydrogenase family 7 member A1 homolog" [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|H0YHM6 ALDH7A1 "Alpha-aminoadipic semialdehyde dehydrogenase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F8VS02 ALDH7A1 "Alpha-aminoadipic semialdehyde dehydrogenase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q2KJC9	AL7A1_BOVIN	1, ., 2, ., 1, ., 8	0.7391	0.6330	0.1280	yes	N/A
P46562	AL7A1_CAEEL	1, ., 2, ., 1, ., 3	0.7647	0.6238	0.1280	yes	N/A
Q9SYG7	AL7B4_ARATH	1, ., 2, ., 1, ., 3	0.7352	0.6238	0.1338	yes	N/A
P49419	AL7A1_HUMAN	1, ., 2, ., 1, ., 8	0.7391	0.6330	0.1280	yes	N/A
Q9DBF1	AL7A1_MOUSE	1, ., 2, ., 1, ., 8	0.5784	0.8899	0.1799	yes	N/A
Q64057	AL7A1_RAT	1, ., 2, ., 1, ., 8	0.7391	0.6330	0.1280	yes	N/A
P83401	AL7A1_DICDI	1, ., 2, ., 1, ., 3	0.7076	0.5963	0.1277	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		109
cd07130		474	cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin	2e-46
cd07086		478	cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha	2e-42
PLN02315		508	PLN02315, PLN02315, aldehyde dehydrogenase family	6e-36
cd07078		432	cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog	2e-16
cd06534		367	cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd	7e-16
pfam00171		459	pfam00171, Aldedh, Aldehyde dehydrogenase family	9e-15
cd07131		478	cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi	2e-14
cd07097		473	cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+	8e-14
cd07088		468	cd07088, ALDH_LactADH-AldA, Escherichia coli lacta	7e-13
COG1012		472	COG1012, PutA, NAD-dependent aldehyde dehydrogenas	2e-11
cd07104		431	cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)	9e-10
cd07152		443	cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde	6e-08
cd07085		478	cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd	2e-07
cd07150		451	cd07150, ALDH_VaniDH_like, Pseudomonas putida vani	8e-07
cd07124		512	cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-	2e-06
cd07151		465	cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb	7e-06
PRK10090		409	PRK10090, PRK10090, aldehyde dehydrogenase A; Prov	8e-06
cd07114		457	cd07114, ALDH_DhaS, Uncharacterized Candidatus pel	2e-05
cd07118		454	cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos	2e-05
cd07103		451	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina	3e-05
TIGR03374		472	TIGR03374, ABALDH, 1-pyrroline dehydrogenase	4e-05
cd07120		455	cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al	1e-04
cd07083		500	cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent	2e-04
PRK11905		1208	PRK11905, PRK11905, bifunctional proline dehydroge	2e-04
cd07125		518	cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car	3e-04
cd07142		476	cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen	5e-04
cd07090		457	cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy	6e-04
cd07133		434	cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd	6e-04
cd07091		476	cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH	7e-04
cd07099		453	cd07099, ALDH_DDALDH, Methylomonas sp	8e-04
PLN02466		538	PLN02466, PLN02466, aldehyde dehydrogenase family	0.001
COG4230		769	COG4230, COG4230, Delta 1-pyrroline-5-carboxylate	0.001
cd07115		453	cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens	0.001
TIGR01780		448	TIGR01780, SSADH, succinate-semialdehyde dehydroge	0.002
TIGR01804		467	TIGR01804, BADH, glycine betaine aldehyde dehydrog	0.002
PLN02278		498	PLN02278, PLN02278, succinic semialdehyde dehydrog	0.002
cd07101		454	cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul	0.003
cd07144		484	cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi	0.003
cd07110		456	cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy	0.004
TIGR01237		511	TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb	0.004

>gnl\|CDD\|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B	Back alignment and domain information

 Score =  154 bits (392), Expect = 2e-46
 Identities = 51/67 (76%), Positives = 60/67 (89%)

Query: 3   GIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYG 62
           G+GEVQE+IDICD+AVGLSR   G  +PSERPGH ++E WNPLGVVG+I+AFNFPVAV+G
Sbjct: 91  GLGEVQEMIDICDFAVGLSRQLYGLTIPSERPGHRMMEQWNPLGVVGVITAFNFPVAVWG 150

Query: 63  WNAAIAL 69
           WNAAIAL
Sbjct: 151 WNAAIAL 157

Alpha-aminoadipic semialdehyde dehydrogenase (AASADH, EC=1.2.1.31), also known as ALDH7A1, Antiquitin-1, ALDH7B, or delta-1-piperideine-6-carboxylate dehydrogenase (P6CDH), is a NAD+-dependent ALDH. Human ALDH7A1 is involved in the pipecolic acid pathway of lysine catabolism, catalyzing the oxidation of alpha-aminoadipic semialdehyde to alpha-aminoadipate. Arabidopsis thaliana ALDH7B4 appears to be an osmotic-stress-inducible ALDH gene encoding a turgor-responsive or stress-inducible ALDH. The Streptomyces clavuligerus P6CDH appears to be involved in cephamycin biosynthesis, catalyzing the second stage of the two-step conversion of lysine to alpha-aminoadipic acid. The ALDH7A1 enzyme and others in this group have been observed as tetramers, yet the bacterial P6CDH enzyme has been reported as a monomer. Length = 474

>gnl\|CDD\|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins	Back alignment and domain information

>gnl\|CDD\|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member	Back alignment and domain information

>gnl\|CDD\|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family	Back alignment and domain information

>gnl\|CDD\|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily	Back alignment and domain information

>gnl\|CDD\|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family	Back alignment and domain information

>gnl\|CDD\|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like	Back alignment and domain information

>gnl\|CDD\|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like	Back alignment and domain information

>gnl\|CDD\|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like	Back alignment and domain information

>gnl\|CDD\|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins	Back alignment and domain information

>gnl\|CDD\|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like	Back alignment and domain information

>gnl\|CDD\|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2	Back alignment and domain information

>gnl\|CDD\|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like	Back alignment and domain information

>gnl\|CDD\|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA	Back alignment and domain information

>gnl\|CDD\|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like	Back alignment and domain information

>gnl\|CDD\|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional	Back alignment and domain information

>gnl\|CDD\|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like	Back alignment and domain information

>gnl\|CDD\|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like	Back alignment and domain information

>gnl\|CDD\|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like	Back alignment and domain information

>gnl\|CDD\|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like	Back alignment and domain information

>gnl\|CDD\|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like	Back alignment and domain information

>gnl\|CDD\|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA	Back alignment and domain information

>gnl\|CDD\|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like	Back alignment and domain information

>gnl\|CDD\|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1	Back alignment and domain information

>gnl\|CDD\|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like	Back alignment and domain information

>gnl\|CDD\|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins	Back alignment and domain information

>gnl\|CDD\|143417 cd07099, ALDH_DDALDH, Methylomonas sp	Back alignment and domain information

>gnl\|CDD\|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member	Back alignment and domain information

>gnl\|CDD\|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like	Back alignment and domain information

>gnl\|CDD\|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase	Back alignment and domain information

>gnl\|CDD\|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase	Back alignment and domain information

>gnl\|CDD\|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase	Back alignment and domain information

>gnl\|CDD\|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like	Back alignment and domain information

>gnl\|CDD\|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like	Back alignment and domain information

>gnl\|CDD\|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like	Back alignment and domain information

>gnl\|CDD\|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		109
KOG2451\|consensus		503		99.96
KOG2450\|consensus		501		99.96
COG1012		472	PutA NAD-dependent aldehyde dehydrogenases [Energy	99.94
cd07126		489	ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de	99.94
PLN02419		604	methylmalonate-semialdehyde dehydrogenase [acylati	99.94
PRK11241		482	gabD succinate-semialdehyde dehydrogenase I; Provi	99.93
PRK10090		409	aldehyde dehydrogenase A; Provisional	99.93
PRK13968		462	putative succinate semialdehyde dehydrogenase; Pro	99.92
PLN02315		508	aldehyde dehydrogenase family 7 member	99.92
PRK09406		457	gabD1 succinic semialdehyde dehydrogenase; Reviewe	99.92
PLN02467		503	betaine aldehyde dehydrogenase	99.92
PLN02278		498	succinic semialdehyde dehydrogenase	99.92
TIGR01780		448	SSADH succinate-semialdehyde dehydrogenase. SSADH	99.92
TIGR01237		511	D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy	99.92
cd07097		473	ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent	99.92
cd07128		513	ALDH_MaoC-N N-terminal domain of the monoamine oxi	99.92
cd07118		454	ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr	99.91
PLN02766		501	coniferyl-aldehyde dehydrogenase	99.91
cd07140		486	ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge	99.91
cd07083		500	ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-	99.91
PRK03137		514	1-pyrroline-5-carboxylate dehydrogenase; Provision	99.91
cd07124		512	ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl	99.91
cd07148		455	ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si	99.91
cd07113		477	ALDH_PADH_NahF Escherichia coli NAD+-dependent phe	99.91
cd07120		455	ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh	99.91
cd07100		429	ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi	99.91
cd07142		476	ALDH_F2BC Arabidosis aldehyde dehydrogenase family	99.91
PLN02466		538	aldehyde dehydrogenase family 2 member	99.91
cd07119		482	ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be	99.91
cd07109		454	ALDH_AAS00426 Uncharacterized Saccharopolyspora sp	99.91
cd07095		431	ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde	99.91
cd07086		478	ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip	99.91
cd07151		465	ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd	99.91
TIGR02278		663	PaaN-DH phenylacetic acid degradation protein paaN	99.91
cd07085		478	ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog	99.91
cd07105		432	ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l	99.91
PLN02174		484	aldehyde dehydrogenase family 3 member H1	99.91
cd07110		456	ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro	99.91
cd07090		457	ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty	99.91
PRK09457		487	astD succinylglutamic semialdehyde dehydrogenase;	99.91
TIGR03250		472	PhnAcAld_DH putative phosphonoacetaldehyde dehydro	99.91
cd07150		451	ALDH_VaniDH_like Pseudomonas putida vanillin dehyd	99.91
PRK13252		488	betaine aldehyde dehydrogenase; Provisional	99.91
cd07145		456	ALDH_LactADH_F420-Bios Methanocaldococcus jannasch	99.91
cd07143		481	ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh	99.9
TIGR03374		472	ABALDH 1-pyrroline dehydrogenase. Members of this	99.9
TIGR01722		477	MMSDH methylmalonic acid semialdehyde dehydrogenas	99.9
TIGR01804		467	BADH glycine betaine aldehyde dehydrogenase. Betai	99.9
cd07088		468	ALDH_LactADH-AldA Escherichia coli lactaldehyde de	99.9
TIGR02299		488	HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd	99.9
PRK11563		675	bifunctional aldehyde dehydrogenase/enoyl-CoA hydr	99.9
cd07146		451	ALDH_PhpJ Streptomyces putative phosphonoformaldeh	99.9
cd07131		478	ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen	99.9
PRK09847		494	gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen	99.9
cd07141		481	ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro	99.9
TIGR03216		481	OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy	99.9
cd07091		476	ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families	99.9
cd07112		462	ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent	99.9
cd07130		474	ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se	99.9
cd07116		479	ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen	99.9
cd07144		484	ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd	99.9
cd07117		475	ALDH_StaphAldA1 Uncharacterized Staphylococcus aur	99.9
PRK11904		1038	bifunctional proline dehydrogenase/pyrroline-5-car	99.9
PRK11903		521	aldehyde dehydrogenase; Provisional	99.9
cd07089		459	ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric	99.9
cd07102		452	ALDH_EDX86601 Uncharacterized aldehyde dehydrogena	99.9
cd07101		454	ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi	99.9
cd07152		443	ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen	99.9
TIGR01236		533	D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy	99.9
TIGR03240		484	arg_catab_astD succinylglutamic semialdehyde dehyd	99.9
PRK09407		524	gabD2 succinic semialdehyde dehydrogenase; Reviewe	99.9
cd07114		457	ALDH_DhaS Uncharacterized Candidatus pelagibacter	99.9
cd07139		471	ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy	99.9
cd07094		453	ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende	99.9
cd07125		518	ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d	99.89
cd07103		451	ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald	99.89
cd07115		453	ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy	99.89
cd07147		452	ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1	99.89
PF00171		462	Aldedh: Aldehyde dehydrogenase family; InterPro: I	99.89
cd07123		522	ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate	99.89
PRK11809		1318	putA trifunctional transcriptional regulator/proli	99.89
cd07559		480	ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep	99.89
cd07099		453	ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di	99.89
cd07107		456	ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde	99.89
cd07136		449	ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr	99.89
PLN00412		496	NADP-dependent glyceraldehyde-3-phosphate dehydrog	99.89
PLN02203		484	aldehyde dehydrogenase	99.89
PRK13473		475	gamma-aminobutyraldehyde dehydrogenase; Provisiona	99.89
cd07104		431	ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen	99.89
cd07082		473	ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat	99.88
cd07137		432	ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m	99.88
cd07138		466	ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac	99.88
cd07149		453	ALDH_y4uC Uncharacterized ALDH (y4uC) with similar	99.88
cd07133		434	ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l	99.88
cd07135		436	ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde	99.88
cd07108		457	ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a	99.88
cd07092		450	ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g	99.87
PLN02418		718	delta-1-pyrroline-5-carboxylate synthase	99.87
TIGR00407		398	proA gamma-glutamyl phosphate reductase. The prosi	99.87
PRK11905		1208	bifunctional proline dehydrogenase/pyrroline-5-car	99.87
TIGR02288		551	PaaN_2 phenylacetic acid degradation protein paaN.	99.87
PTZ00381		493	aldehyde dehydrogenase family protein; Provisional	99.87
TIGR01238		500	D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy	99.87
cd07081		439	ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh	99.87
COG4230		769	Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene	99.87
cd07093		455	ALDH_F8_HMSADH Human aldehyde dehydrogenase family	99.86
cd07122		436	ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr	99.86
cd07111		480	ALDH_F16 Aldehyde dehydrogenase family 16A1-like.	99.86
cd07106		446	ALDH_AldA-AAD23400 Streptomyces aureofaciens putat	99.86
cd07132		443	ALDH_F3AB Aldehyde dehydrogenase family 3 members	99.86
cd07121		429	ALDH_EutE Ethanolamine utilization protein EutE-li	99.85
cd07087		426	ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl	99.85
cd07129		454	ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr	99.85
cd07134		433	ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro	99.85
cd07077		397	ALDH-like NAD(P)+-dependent aldehyde dehydrogenase	99.85
cd07098		465	ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and	99.85
PRK15398		465	aldehyde dehydrogenase EutE; Provisional	99.84
cd07084		442	ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent	99.84
cd06534		367	ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s	99.83
TIGR01092		715	P5CS delta l-pyrroline-5-carboxylate synthetase. T	99.82
cd07078		432	ALDH NAD(P)+ dependent aldehyde dehydrogenase fami	99.82
cd07127		549	ALDH_PAD-PaaZ Phenylacetic acid degradation protei	99.82
PRK00197		417	proA gamma-glutamyl phosphate reductase; Provision	99.81
KOG2456\|consensus		477		99.81
cd07079		406	ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu	99.8
TIGR02518		488	EutH_ACDH acetaldehyde dehydrogenase (acetylating)	99.79
PRK13805		862	bifunctional acetaldehyde-CoA/alcohol dehydrogenas	99.77
KOG2455\|consensus		561		99.64
cd07080		422	ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC. Ac	99.59
KOG2454\|consensus		583		99.53
KOG2453\|consensus		507		99.44
KOG2452\|consensus		881		99.39
PRK11905		1208	bifunctional proline dehydrogenase/pyrroline-5-car	97.81
PF05893		399	LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR0086	97.66
COG0014		417	ProA Gamma-glutamyl phosphate reductase [Amino aci	96.9
KOG4165\|consensus		433		84.45
PRK11809		1318	putA trifunctional transcriptional regulator/proli	81.38
PRK13769		368	histidinol dehydrogenase; Provisional	80.81

>KOG2451\|consensus	Back alignment and domain information

Probab=99.96  E-value=3.5e-29  Score=185.49  Aligned_cols=102  Identities=27%  Similarity=0.331  Sum_probs=96.6

Q ss_pred             chHHHHHHHHHHHHHHHHhhhhhcCCccCCCCCCceeeEeeeeceeEEEEcccchhHHHHHHHHHHHHhcCCCCCcEEEe
Q psy3661           2 RGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALV   81 (109)
Q Consensus         2 ~a~~ev~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~P~GVv~~I~PwN~P~~~~~~k~~pAL~aGNt~~~vvlK   81 (109)
                      ||++|+..+..+++||++.+++..++..+...++.+..+.++|+||++.|+|||||..++.+|..+||++|||   ||+|
T Consensus       117 eA~gEv~y~a~f~eWyAeEA~RvyGdii~s~~~~rr~i~ikQPvGV~alItPWNFP~AMItRK~gAALAaGCT---vVvk  193 (503)
T KOG2451|consen  117 EAKGEVAYSAAFFEWYAEEARRVYGDIIPSLNPNRRLIVIKQPVGVVALITPWNFPAAMITRKAGAALAAGCT---VVVK  193 (503)
T ss_pred             hccceeehhHHHHHHHHHHhhhhhccccCCCCCCceEEEEeccceeEEEecCcCChHHHHHhHHHHHHhcCce---EEEc
Confidence            6788999999999999999999999987766667788999999999999999999999999999999999999   9999


Q ss_pred             cCCCchHHHHHHHHHHHhcCcccCC
Q psy3661          82 GVEVVPRWFQTLAKTLKNQNQIQKC  106 (109)
Q Consensus        82 pse~tp~~~~~l~~~~~~ag~~~~~  106 (109)
                      ||+.||++++.++++.++||+|.|-
T Consensus       194 Ps~~TPlsaLala~lA~~AGiP~Gv  218 (503)
T KOG2451|consen  194 PSEDTPLSALALAKLAEEAGIPAGV  218 (503)
T ss_pred             cCCCCchHHHHHHHHHHHcCCCCcc
Confidence            9999999999999999999999873

>KOG2450\|consensus	Back alignment and domain information

>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion]	Back alignment and domain information

>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12	Back alignment and domain information

>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating]	Back alignment and domain information

>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional	Back alignment and domain information

>PRK10090 aldehyde dehydrogenase A; Provisional	Back alignment and domain information

>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PLN02315 aldehyde dehydrogenase family 7 member	Back alignment and domain information

>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>PLN02467 betaine aldehyde dehydrogenase	Back alignment and domain information

>PLN02278 succinic semialdehyde dehydrogenase	Back alignment and domain information

>TIGR01780 SSADH succinate-semialdehyde dehydrogenase	Back alignment and domain information

>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative	Back alignment and domain information

>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like	Back alignment and domain information

>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase	Back alignment and domain information

>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like	Back alignment and domain information

>PLN02766 coniferyl-aldehyde dehydrogenase	Back alignment and domain information

>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L	Back alignment and domain information

>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like	Back alignment and domain information

>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional	Back alignment and domain information

>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA	Back alignment and domain information

>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1	Back alignment and domain information

>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like	Back alignment and domain information

>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like	Back alignment and domain information

>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like	Back alignment and domain information

>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like	Back alignment and domain information

>PLN02466 aldehyde dehydrogenase family 2 member	Back alignment and domain information

>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like	Back alignment and domain information

>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like	Back alignment and domain information

>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like	Back alignment and domain information

>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins	Back alignment and domain information

>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like	Back alignment and domain information

>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN	Back alignment and domain information

>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2	Back alignment and domain information

>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like	Back alignment and domain information

>PLN02174 aldehyde dehydrogenase family 3 member H1	Back alignment and domain information

>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like	Back alignment and domain information

>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1	Back alignment and domain information

>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase	Back alignment and domain information

>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like	Back alignment and domain information

>PRK13252 betaine aldehyde dehydrogenase; Provisional	Back alignment and domain information

>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like	Back alignment and domain information

>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like	Back alignment and domain information

>TIGR03374 ABALDH 1-pyrroline dehydrogenase	Back alignment and domain information

>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase	Back alignment and domain information

>TIGR01804 BADH glycine betaine aldehyde dehydrogenase	Back alignment and domain information

>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like	Back alignment and domain information

>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase	Back alignment and domain information

>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional	Back alignment and domain information

>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like	Back alignment and domain information

>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like	Back alignment and domain information

>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional	Back alignment and domain information

>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like	Back alignment and domain information

>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase	Back alignment and domain information

>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins	Back alignment and domain information

>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like	Back alignment and domain information

>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B	Back alignment and domain information

>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like	Back alignment and domain information

>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like	Back alignment and domain information

>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like	Back alignment and domain information

>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed	Back alignment and domain information

>PRK11903 aldehyde dehydrogenase; Provisional	Back alignment and domain information

>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins	Back alignment and domain information

>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp	Back alignment and domain information

>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like	Back alignment and domain information

>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like	Back alignment and domain information

>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1	Back alignment and domain information

>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase	Back alignment and domain information

>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like	Back alignment and domain information

>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like	Back alignment and domain information

>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins	Back alignment and domain information

>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA	Back alignment and domain information

>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like	Back alignment and domain information

>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like	Back alignment and domain information

>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like	Back alignment and domain information

>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1	Back alignment and domain information

>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17	Back alignment and domain information

>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed	Back alignment and domain information

>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like	Back alignment and domain information

>cd07099 ALDH_DDALDH Methylomonas sp	Back alignment and domain information

>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like	Back alignment and domain information

>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like	Back alignment and domain information

>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02203 aldehyde dehydrogenase	Back alignment and domain information

>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional	Back alignment and domain information

>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins	Back alignment and domain information

>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11	Back alignment and domain information

>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins	Back alignment and domain information

>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like	Back alignment and domain information

>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1	Back alignment and domain information

>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like	Back alignment and domain information

>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins	Back alignment and domain information

>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like	Back alignment and domain information

>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like	Back alignment and domain information

>PLN02418 delta-1-pyrroline-5-carboxylate synthase	Back alignment and domain information

>TIGR00407 proA gamma-glutamyl phosphate reductase	Back alignment and domain information

>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN	Back alignment and domain information

>PTZ00381 aldehyde dehydrogenase family protein; Provisional	Back alignment and domain information

>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain)	Back alignment and domain information

>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins	Back alignment and domain information

>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like	Back alignment and domain information

>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like	Back alignment and domain information

>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like	Back alignment and domain information

>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like	Back alignment and domain information

>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins	Back alignment and domain information

>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like	Back alignment and domain information

>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins	Back alignment and domain information

>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase	Back alignment and domain information

>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like	Back alignment and domain information

>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family	Back alignment and domain information

>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like	Back alignment and domain information

>PRK15398 aldehyde dehydrogenase EutE; Provisional	Back alignment and domain information

>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like	Back alignment and domain information

>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily	Back alignment and domain information

>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase	Back alignment and domain information

>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family	Back alignment and domain information

>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like	Back alignment and domain information

>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional	Back alignment and domain information

>KOG2456\|consensus	Back alignment and domain information

>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19	Back alignment and domain information

>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating)	Back alignment and domain information

>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional	Back alignment and domain information

>KOG2455\|consensus	Back alignment and domain information

>cd07080 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC	Back alignment and domain information

>KOG2454\|consensus	Back alignment and domain information

>KOG2453\|consensus	Back alignment and domain information

>KOG2452\|consensus	Back alignment and domain information

>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed	Back alignment and domain information

>PF05893 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR008670 This family consists of several bacterial Acyl-CoA reductase (LuxC) proteins	Back alignment and domain information

>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG4165\|consensus	Back alignment and domain information

>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed	Back alignment and domain information

>PRK13769 histidinol dehydrogenase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		109
2jg7_A		510	Crystal Structure Of Seabream Antiquitin And Elucid		4e-27
2j6l_A		500	Structure Of Aminoadipate-Semialdehyde Dehydrogenas		2e-26
1wnb_A		495	Escherichia Coli Ydcw Gene Product Is A Medium-Chai		3e-04

>pdb|2JG7|A Chain A, Crystal Structure Of Seabream Antiquitin And Elucidation Of Its Substrate Specificity Length = 510

Back alignment and structure

Iteration: 1

Score = 116 bits (290), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 51/69 (73%), Positives = 60/69 (86%) Query: 1 MRGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAV 60 + G+GEVQE +D+CDYAVGLSR G +LPSERPGH L+E WNP+G+VGII+AFNFPVAV Sbjct: 112 VEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALIEQWNPVGLVGIITAFNFPVAV 171 Query: 61 YGWNAAIAL 69 YGWN AIAL Sbjct: 172 YGWNNAIAL 180

PyMOL of 2jg7

>pdb|2J6L|A Chain A, Structure Of Aminoadipate-Semialdehyde Dehydrogenase Length = 500

Back alignment and structure

>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		109
2j6l_A		500	Aldehyde dehydrogenase family 7 member A1; NAD, re	3e-36
4f9i_A		1026	Proline dehydrogenase/delta-1-pyrroline-5-carboxy	3e-14
3qan_A		538	1-pyrroline-5-carboxylate dehydrogenase 1; proline	5e-12
3r64_A		508	NAD dependent benzaldehyde dehydrogenase; structur	2e-11
1uzb_A		516	1-pyrroline-5-carboxylate dehydrogenase; oxidoredu	2e-11
3haz_A		1001	Proline dehydrogenase; proline utilization A, PUTA	3e-11
3k9d_A		464	LMO1179 protein, aldehyde dehydrogenase; structura	5e-07
1euh_A		475	NADP dependent non phosphorylating glyceraldehyde-	5e-07
1t90_A		486	MMSDH, probable methylmalonate-semialdehyde dehydr	7e-07
1ez0_A		510	ALDH, aldehyde dehydrogenase; nucleotide binding d	8e-07
3prl_A		505	NADP-dependent glyceraldehyde-3-phosphate dehydro;	8e-07
4dng_A		485	Uncharacterized aldehyde dehydrogenase ALDY; struc	9e-07
3ju8_A		490	Succinylglutamic semialdehyde dehydrogenase; alpha	1e-06
4e4g_A		521	Methylmalonate-semialdehyde dehydrogenase; structu	2e-06
3pqa_A		486	Lactaldehyde dehydrogenase; structural genomics, p	9e-06
3v4c_A		528	Aldehyde dehydrogenase (NADP+); structural genomic	1e-05
3ed6_A		520	Betaine aldehyde dehydrogenase; structural genomic	2e-05
3b4w_A		495	Aldehyde dehydrogenase; RV0223C-NAD complex, struc	3e-05
1uxt_A		501	Glyceraldehyde-3-phosphate dehydrogenase (NADP+);	4e-05
3u4j_A		528	NAD-dependent aldehyde dehydrogenase; PSI-biology,	4e-05
2y53_A		534	Aldehyde dehydrogenase (BOX pathway); oxidoreducta	6e-05
1a4s_A		503	ALDH, betaine aldehyde dehydrogenase; oxidoreducta	6e-05
1wnd_A		495	Putative betaine aldehyde dehydrogenase; NADH, flu	7e-05
3my7_A		452	Alcohol dehydrogenase/acetaldehyde dehydrogenase;	9e-05
3lns_A		457	Benzaldehyde dehydrogenase; oxidoreductase, NADP+,	2e-04
2imp_A		479	Lactaldehyde dehydrogenase; protein-lactate-NADH t	2e-04
2ve5_A		490	BADH, betaine aldehyde dehydrogenase; aldehyde oxi	3e-04
4f3x_A		498	Putative aldehyde dehydrogenase; structural genomi	3e-04
3sza_A		469	Aldehyde dehydrogenase, dimeric NADP-preferring; A	3e-04
1bxs_A		501	Aldehyde dehydrogenase; retinal, class 1, tetramer	5e-04
2w8n_A		487	Succinate-semialdehyde dehydrogenase, mitochondria	6e-04
1o04_A		500	Aldehyde dehydrogenase, mitochondrial precursor; A	6e-04
3k2w_A		497	Betaine-aldehyde dehydrogenase; structural genomic	7e-04
4e3x_A		563	Delta-1-pyrroline-5-carboxylate dehydrogenase, mit	7e-04
3jz4_A		481	Succinate-semialdehyde dehydrogenase [NADP+]; tetr	9e-04
3ek1_A		504	Aldehyde dehydrogenase; ssgcid, oxidoreductase, st	9e-04

>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500	Back alignment and structure

 Score =  127 bits (321), Expect = 3e-36
 Identities = 51/67 (76%), Positives = 58/67 (86%)

Query: 3   GIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYG 62
           G+GEVQE +DICDYAVGLSR   G ILPSER GH L+E WNP+G+VGII+AFNFPVAVYG
Sbjct: 116 GVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIEQWNPVGLVGIITAFNFPVAVYG 175

Query: 63  WNAAIAL 69
           WN AIA+
Sbjct: 176 WNNAIAM 182

PyMOL of 2j6l

>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026	Back alignment and structure

>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538	Back alignment and structure

>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508	Back alignment and structure

>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516	Back alignment and structure

>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001	Back alignment and structure

>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464	Back alignment and structure

>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475	Back alignment and structure

>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486	Back alignment and structure

>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510	Back alignment and structure

>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505	Back alignment and structure

>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485	Back alignment and structure

>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490	Back alignment and structure

>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521	Back alignment and structure

>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486	Back alignment and structure

>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528	Back alignment and structure

>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520	Back alignment and structure

>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495	Back alignment and structure

>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501	Back alignment and structure

>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528	Back alignment and structure

>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534	Back alignment and structure

>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503	Back alignment and structure

>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495	Back alignment and structure

>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452	Back alignment and structure

>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457	Back alignment and structure

>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479	Back alignment and structure

>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498	Back alignment and structure

>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469	Back alignment and structure

>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501	Back alignment and structure

>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487	Back alignment and structure

>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500	Back alignment and structure

>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497	Back alignment and structure

>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563	Back alignment and structure

>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481	Back alignment and structure

>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		109
3ed6_A		520	Betaine aldehyde dehydrogenase; structural genomic	99.94
3ifg_A		484	Succinate-semialdehyde dehydrogenase (NADP+); niai	99.94
2d4e_A		515	5-carboxymethyl-2-hydroxymuconate semialdehyde deh	99.94
3ek1_A		504	Aldehyde dehydrogenase; ssgcid, oxidoreductase, st	99.94
1uzb_A		516	1-pyrroline-5-carboxylate dehydrogenase; oxidoredu	99.94
2o2p_A		517	Formyltetrahydrofolate dehydrogenase; aldehyde deh	99.94
2wme_A		490	BADH, betaine aldehyde dehydrogenase; aldehyde oxi	99.94
3u4j_A		528	NAD-dependent aldehyde dehydrogenase; PSI-biology,	99.94
1a4s_A		503	ALDH, betaine aldehyde dehydrogenase; oxidoreducta	99.94
2w8n_A		487	Succinate-semialdehyde dehydrogenase, mitochondria	99.93
3k2w_A		497	Betaine-aldehyde dehydrogenase; structural genomic	99.93
3ros_A		484	NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-	99.93
2imp_A		479	Lactaldehyde dehydrogenase; protein-lactate-NADH t	99.93
3rh9_A		506	Succinate-semialdehyde dehydrogenase (NAD(P)(+));	99.93
3iwj_A		503	Putative aminoaldehyde dehydrogenase; rossmann fol	99.93
3qan_A		538	1-pyrroline-5-carboxylate dehydrogenase 1; proline	99.93
3prl_A		505	NADP-dependent glyceraldehyde-3-phosphate dehydro;	99.93
4e4g_A		521	Methylmalonate-semialdehyde dehydrogenase; structu	99.93
1euh_A		475	NADP dependent non phosphorylating glyceraldehyde-	99.93
1uxt_A		501	Glyceraldehyde-3-phosphate dehydrogenase (NADP+);	99.93
3jz4_A		481	Succinate-semialdehyde dehydrogenase [NADP+]; tetr	99.93
1bxs_A		501	Aldehyde dehydrogenase; retinal, class 1, tetramer	99.93
1o04_A		500	Aldehyde dehydrogenase, mitochondrial precursor; A	99.93
3b4w_A		495	Aldehyde dehydrogenase; RV0223C-NAD complex, struc	99.93
4f3x_A		498	Putative aldehyde dehydrogenase; structural genomi	99.93
1t90_A		486	MMSDH, probable methylmalonate-semialdehyde dehydr	99.93
3pqa_A		486	Lactaldehyde dehydrogenase; structural genomics, p	99.92
3etf_A		462	Putative succinate-semialdehyde dehydrogenase; cen	99.92
1wnd_A		495	Putative betaine aldehyde dehydrogenase; NADH, flu	99.92
4f9i_A		1026	Proline dehydrogenase/delta-1-pyrroline-5-carboxy	99.92
4dng_A		485	Uncharacterized aldehyde dehydrogenase ALDY; struc	99.92
2j6l_A		500	Aldehyde dehydrogenase family 7 member A1; NAD, re	99.92
2ve5_A		490	BADH, betaine aldehyde dehydrogenase; aldehyde oxi	99.92
3r31_A		517	BADH, betaine aldehyde dehydrogenase; structural g	99.92
3r64_A		508	NAD dependent benzaldehyde dehydrogenase; structur	99.92
3i44_A		497	Aldehyde dehydrogenase; oxidoreductase, structural	99.91
3ju8_A		490	Succinylglutamic semialdehyde dehydrogenase; alpha	99.91
3haz_A		1001	Proline dehydrogenase; proline utilization A, PUTA	99.91
4e3x_A		563	Delta-1-pyrroline-5-carboxylate dehydrogenase, mit	99.91
2y53_A		534	Aldehyde dehydrogenase (BOX pathway); oxidoreducta	99.9
4h7n_A		474	Aldehyde dehydrogenase; structural genomics, PSI-b	99.9
3lns_A		457	Benzaldehyde dehydrogenase; oxidoreductase, NADP+,	99.9
3ty7_A		478	Putative aldehyde dehydrogenase SAV2122; structura	99.9
1ez0_A		510	ALDH, aldehyde dehydrogenase; nucleotide binding d	99.9
3sza_A		469	Aldehyde dehydrogenase, dimeric NADP-preferring; A	99.89
3v4c_A		528	Aldehyde dehydrogenase (NADP+); structural genomic	99.89
2h5g_A		463	Delta 1-pyrroline-5-carboxylate synthetase; dehydr	99.88
1vlu_A		468	Gamma-glutamyl phosphate reductase; YOR323C, struc	99.85
1o20_A		427	Gamma-glutamyl phosphate reductase; TM0293, struct	99.85
4ghk_A		444	Gamma-glutamyl phosphate reductase; structural gen	99.85
3k9d_A		464	LMO1179 protein, aldehyde dehydrogenase; structura	99.83
3my7_A		452	Alcohol dehydrogenase/acetaldehyde dehydrogenase;	99.82
4gic_A		423	HDH, histidinol dehydrogenase; protein structure i	80.39

>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A*	Back alignment and structure

Probab=99.94  E-value=6.9e-27  Score=180.44  Aligned_cols=102  Identities=19%  Similarity=0.289  Sum_probs=91.2

Q ss_pred             chHHHHHHHHHHHHHHHHhhhhhcCCccCCCCCCceeeEeeeeceeEEEEcccchhHHHHHHHHHHHHhcCCCCCcEEEe
Q psy3661           2 RGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALV   81 (109)
Q Consensus         2 ~a~~ev~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~P~GVv~~I~PwN~P~~~~~~k~~pAL~aGNt~~~vvlK   81 (109)
                      +++.|+..+++.++||+++++++.++..+....+...++.++|+|||++|+|||||+.+.++|++|||++||+   ||+|
T Consensus       128 ea~~ev~~~~~~~~~~a~~~~~~~g~~~~~~~~~~~~~~~~~P~GVV~~I~PwN~P~~~~~~~~apALaaGNt---VVlK  204 (520)
T 3ed6_A          128 ESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTESKIVKEPVGVVTQITPWNYPLLQASWKIAPALATGCS---LVMK  204 (520)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSCCEEEECCSSTTEEEEEEEEECCEEEEECCSSSHHHHHHHHHHHHHHHTCE---EEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcCeecccCCCCCcccccccCccEEEEECCCccHHHHHHHHHHHHHHcCCE---EEEE
Confidence            4567899999999999999988776544432235577899999999999999999999999999999999999   9999


Q ss_pred             cCCCchHHHHHHHHHHHhcCcccCC
Q psy3661          82 GVEVVPRWFQTLAKTLKNQNQIQKC  106 (109)
Q Consensus        82 pse~tp~~~~~l~~~~~~ag~~~~~  106 (109)
                      |||.+|+++..+++++.++|+|.|+
T Consensus       205 Ps~~tp~t~~~l~~l~~eaGlP~gv  229 (520)
T 3ed6_A          205 PSEITPLTTIRVFELMEEVGFPKGT  229 (520)
T ss_dssp             CCTTCCHHHHHHHHHHHHHCCCTTS
T ss_pred             cCCcchHHHHHHHHHHHHhCCCCCe
Confidence            9999999999999999999999875

PyMOL of 3ed6

>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q	Back alignment and structure

>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308}	Back alignment and structure

>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A*	Back alignment and structure

>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A*	Back alignment and structure

>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A*	Back alignment and structure

>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti}	Back alignment and structure

>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A*	Back alignment and structure

>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A*	Back alignment and structure

>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C}	Back alignment and structure

>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus}	Back alignment and structure

>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A*	Back alignment and structure

>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei}	Back alignment and structure

>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A*	Back alignment and structure

>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A	Back alignment and structure

>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A*	Back alignment and structure

>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti}	Back alignment and structure

>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A*	Back alignment and structure

>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A*	Back alignment and structure

>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli}	Back alignment and structure

>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A*	Back alignment and structure

>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ...	Back alignment and structure

>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis}	Back alignment and structure

>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A*	Back alignment and structure

>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis}	Back alignment and structure

>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A*	Back alignment and structure

>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A	Back alignment and structure

>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A	Back alignment and structure

>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens}	Back alignment and structure

>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis}	Back alignment and structure

>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A*	Back alignment and structure

>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum}	Back alignment and structure

>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae}	Back alignment and structure

>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa}	Back alignment and structure

>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110}	Back alignment and structure

>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A	Back alignment and structure

>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A*	Back alignment and structure

>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis}	Back alignment and structure

>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A*	Back alignment and structure

>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus}	Back alignment and structure

>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A*	Back alignment and structure

>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A*	Back alignment and structure

>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti}	Back alignment and structure

>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens}	Back alignment and structure

>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1	Back alignment and structure

>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1	Back alignment and structure

>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis}	Back alignment and structure

>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes}	Back alignment and structure

>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus}	Back alignment and structure

>4gic_A HDH, histidinol dehydrogenase; protein structure initiative, STR genomics, PSI-biology, NEW YORK structural genomics researc consortium; 2.05A {Methylococcus capsulatus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		109
d1bxsa_		494	c.82.1.1 (A:) Aldehyde reductase (dehydrogenase),	1e-05
d1o04a_		494	c.82.1.1 (A:) Aldehyde reductase (dehydrogenase),	9e-05

>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]

 Score = 40.0 bits (93), Expect = 1e-05
 Identities = 16/69 (23%), Positives = 27/69 (39%), Gaps = 1/69 (1%)

Query: 1   MRGIGEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAV 60
              + ++   I    Y  G +    G  +P +           P+GV G I  +NFP+ +
Sbjct: 110 NAYLMDLGGCIKTLRYCAGWADKIQGRTIPMD-GNFFTYTRSEPVGVCGQIIPWNFPLLM 168

Query: 61  YGWNAAIAL 69
           + W    AL
Sbjct: 169 FLWKIGPAL 177

PyMOL of d1bxsa_

>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		109
d1bxsa_		494	Aldehyde reductase (dehydrogenase), ALDH {Sheep (O	99.92
d1o04a_		494	Aldehyde reductase (dehydrogenase), ALDH {Human (H	99.91
d1a4sa_		503	Aldehyde reductase (dehydrogenase), ALDH {Baltic c	99.91
d1uzba_		516	1-pyrroline-5-carboxylate dehydrogenase {Thermus t	99.9
d1ky8a_		499	Non-phosphorylating glyceraldehyde-3-phosphate deh	99.87
d1ez0a_		504	Aldehyde reductase (dehydrogenase), ALDH {Vibrio h	99.87
d1wnda_		474	Putative betaine aldehyde dehydrogenase YdcW {Esch	99.86
d1euha_		474	Aldehyde reductase (dehydrogenase), ALDH {Streptoc	99.84
d1ad3a_		446	Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat	99.82
d1o20a_		414	Gamma-glutamyl phosphate reductase {Thermotoga mar	99.79
d1vlua_		436	Gamma-glutamyl phosphate reductase {Baker's yeast	99.25

>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]

Probab=99.92  E-value=2.8e-25  Score=168.33  Aligned_cols=98  Identities=20%  Similarity=0.336  Sum_probs=88.9

Q ss_pred             HHHHHHHHHHHHHHHhhhhhcCCccCCCCCCceeeEeeeeceeEEEEcccchhHHHHHHHHHHHHhcCCCCCcEEEecCC
Q psy3661           5 GEVQEVIDICDYAVGLSRTYSGSILPSERPGHVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGVE   84 (109)
Q Consensus         5 ~ev~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~P~GVv~~I~PwN~P~~~~~~k~~pAL~aGNt~~~vvlKpse   84 (109)
                      .|+..+++.++|++++.+++.++..+.+ .+...++.++|+|||++|+|||||+.+.++++++||++||+   ||+||||
T Consensus       114 ~ev~~~~~~~~~~a~~~~~~~~~~~~~~-~~~~~~~~~~P~GVv~~I~PwN~P~~~~~~~i~~ALaaGN~---VVlKpse  189 (494)
T d1bxsa_         114 MDLGGCIKTLRYCAGWADKIQGRTIPMD-GNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIGPALSCGNT---VVVKPAE  189 (494)
T ss_dssp             THHHHHHHHHHHHHHHGGGCCEEEECCS-SSEEEEEEEEECCEEEEECCSSSHHHHHHHHHHHHHHTTCE---EEEECCT
T ss_pred             hhhhhhhHHHHHHhhhhhhhcceeecCC-CCceeEEEEccEEEEEEEeCccchhHHHHHHHHHHHHcCCe---EEEECCC
Confidence            3678889999999999998877655543 35677899999999999999999999999999999999999   9999999


Q ss_pred             CchHHHHHHHHHHHhcCcccCC
Q psy3661          85 VVPRWFQTLAKTLKNQNQIQKC  106 (109)
Q Consensus        85 ~tp~~~~~l~~~~~~ag~~~~~  106 (109)
                      .+|+++..++++++++|+|.++
T Consensus       190 ~tp~~a~~l~~~~~~aglP~gv  211 (494)
T d1bxsa_         190 QTPLTALHMGSLIKEAGFPPGV  211 (494)
T ss_dssp             TCCHHHHHHHHHHHHHTCCTTS
T ss_pred             CChHHHHHHHHHHHHhCCCcCe
Confidence            9999999999999999999875

PyMOL of d1bxsa_

>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]}	Back information, alignment and structure

>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]}	Back information, alignment and structure

>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]}	Back information, alignment and structure

>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]}	Back information, alignment and structure

>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure