Psyllid ID: psy366

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730----
MVHLISRLICSLCSETFKSKPRLRAHIWKCQMEPETILETLGHQFESQLFTGPMEKCDIMCDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFVCDLCGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHSTEEAGCKCNRQLLQCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQCPVCKLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKSFVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFHRNSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFKRSSHLKQHGKTHIKPEHDLKTKMNLFTCHQCQSTEEAGCKCNMMLMKCQLLHSHLNTQDNKINYSCEQCKVQFSCKSDMRKHAKTHLPAIGRSYTCDQCGKQLSYAKTLANHIKGVHLKIKKHSCENCAKSFFSLAELRQHSPVHSEQKSFVCELCGASFKQRTCLWSHKKWNHEELIYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPYLCTICSATFKTARALKQHGRTHIKSRT
cccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHcccccccccccccccHHcccccccHHHccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccc
ccccccccEccccccEEcccccHHHHcHcccccccccccHccccHHHcccEccccccccccccccccEccccHHHHHHHHHccccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEEEcccccccEccccHHHHHHHHccccccccccHccccEcccccHHHHHHHccccccccccHccccEccccHHHHHHHHccccccccccHcccHHHHHHcccccccccccccccEccccHHHHHHHHcccccccEEcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHHccccccccccHccccEccccHHHHHHHHccccccccccHccccEccccHHHHHHHHcccccccccccccccccEccccHHHHHHHHccccccccccHccccEccccHHHHHHHHHHcccccccccHccccEccccHHHHHHHHcccccccccccccccEEccccccccccccccccEccccHHHHHHHHcccccccccccccccEcccccHHHHHHHcccccccccEcccccccEccccHHHHHHHHHccccccccccHccccEcccccHHHHHHHccccccccccHccccEccccHHHHHHHHccccccEEEEcccccccEccccHHHHHHHHccccccccccHccccEccccHHHHHHHHEccccccccccHccccEccccHHHHHHHHcccccc
MVHLISRLICSLCsetfkskprlRAHIWKCQMEPETILETLGHQfesqlftgpmekcdimcdqcgkhftssqSLARHIKCVHLKIkhhwcdicgksffaaselkqhsfihseqkgfvcdlcgasfkqrsclwshkkwnheelsykFECTLCGKKFVKNYSLYEHMkrhsdvrpykcdicghgfkLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLtcdqchsteeagckcnrqllqcslcsetfkskpslRAHIWKcqmepqtiLETYnilsqcpvckltftdkRKLKSHLKthsiersytchhcgkqlcgasnlslHIKSVHLkikdhscdvcdksfvnraglrlhklihseergfvcdlcgasfkqrpaLWAHKKLHDAKLEYKFKCilcdrkfhrnsklnshmrthsdvrpykcdiceqhfkfnydiqmhkrcvhsnirpyqctlcsasfkrsshlkqhgkthikpehdlktkmnlftchqcqsteeagckcnmMLMKCQLLHSHlntqdnkinysceqckvqfscksdmrkhakthlpaigrsytcdqcgKQLSYAKTLANHIKGVHLKIKKHSCENCAKSFFSLAelrqhspvhseqkSFVCELcgasfkqrtclwshkkwnhEELIYKFECTLCGKKFVKNYSLYEHMkrhsdvrpykcdicghgfKLNYDMLRHkqdvhsttrpylctICSATFKTARALKQHGrthiksrt
MVHLISRLICSLcsetfkskprlRAHIWKCQMEPETILETLGHQFESQLFTGPMEKCDIMCDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFVCDLCGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHSTEEAGCKCNRQLLQCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQCPVCKLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKSFVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFhrnsklnshmrthsdvrpyKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFKRSSHLKQHGkthikpehdlkTKMNLFTCHQCQSTEEAGCKCNMMLMKCQLLHSHLNTQDNKINYSCEQCKVQFSCKSDMRKHAKThlpaigrsyTCDQCGKQLSYAKTLANHIKGVHLKIKKHSCENCAKSFFSLAELRQHSPVHSEQKSFVCELCGASFKQRTCLWSHKKWNHEELIYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPYLCTICSATFKTARALkqhgrthiksrt
MVHLISRLICSLCSETFKSKPRLRAHIWKCQMEPETILETLGHQFESQLFTGPMEKCDIMCDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFVCDLCGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHSTEEAGCKCNRQLLQCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQCPVCKLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKSFVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFHRNSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFKRSSHLKQHGKTHIKPEHDLKTKMNLFTCHQCQSTEEAGCKCNMMLMKCQLLHSHLNTQDNKINYSCEQCKVQFSCKSDMRKHAKTHLPAIGRSYTCDQCGKQLSYAKTLANHIKGVHLKIKKHSCENCAKSFFSLAELRQHSPVHSEQKSFVCELCGASFKQRTCLWSHKKWNHEELIYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPYLCTICSATFKTARALKQHGRTHIKSRT
**HLISRLICSLCSETFKSKPRLRAHIWKCQMEPETILETLGHQFESQLFTGPMEKCDIMCDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFVCDLCGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHSTEEAGCKCNRQLLQCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQCPVCKLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKSFVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFHRNSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFK******************LKTKMNLFTCHQCQSTEEAGCKCNMMLMKCQLLHSHLNTQDNKINYSCEQCKVQFSCKSDMRKHAKTHLPAIGRSYTCDQCGKQLSYAKTLANHIKGVHLKIKKHSCENCAKSFFSLAELRQHSPVHSEQKSFVCELCGASFKQRTCLWSHKKWNHEELIYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPYLCTICSATFKTARA*************
MVHLISRLICSLCSETFKSKPRLRAHIWKCQMEPETILETLGHQFESQLFTGPMEKCDIMCDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFVCDLCGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHSTEEAGCKCNRQLLQCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQCPVCKLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKSFVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFHRNSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFKRSSHLKQHGKTHIKPEHDLKTKMNLFTCHQCQSTEEAGCKCNMMLMKCQLLHSHLNTQDNKINYSCEQCKVQFSCKSDMRKHAKTHLPAIGRSYTCDQCGKQLSYAKTLANHIKGVHLKIKKHSCENCAKSFFSLAELRQHSPVHSEQKSFVCELCGASFKQRTCLWSHKKWNHEELIYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPYLCTICSATFKTARALKQHGRTHI****
MVHLISRLICSLCSETFKSKPRLRAHIWKCQMEPETILETLGHQFESQLFTGPMEKCDIMCDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFVCDLCGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHSTEEAGCKCNRQLLQCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQCPVCKLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKSFVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFHRNSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFK*************KPEHDLKTKMNLFTCHQCQSTEEAGCKCNMMLMKCQLLHSHLNTQDNKINYSCEQCKVQFSCKSDMRKHAKTHLPAIGRSYTCDQCGKQLSYAKTLANHIKGVHLKIKKHSCENCAKSFFSLAELR**********SFVCELCGASFKQRTCLWSHKKWNHEELIYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPYLCTICSATFKTAR**************
***LISRLICSLCSETFKSKPRLRAHIWKCQMEPETILETLGHQFESQLFTGPMEKCDIMCDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFVCDLCGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHSTEEAGCKCNRQLLQCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQCPVCKLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKSFVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFHRNSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFKRSSHLKQHGKTHIKPEHDLKTKMNLFTCHQCQSTEEAGCKCNMMLMKCQLLHSHLNTQDNKINYSCEQCKVQFSCKSDMRKHAKTHLPAIGRSYTCDQCGKQLSYAKTLANHIKGVHLKIKKHSCENCAKSFFSLAELRQHSPVHSEQKSFVCELCGASFKQRTCLWSHKKWNHEELIYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPYLCTICSATFKTARALKQHGRTH*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVHLISRLICSLCSETFKSKPRLRAHIWKCQMEPETILETLGHQFESQLFTGPMEKCDIMCDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFVCDLCGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHSTEEAGCKCNRQLLQCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQCPVCKLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKSFVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFHRNSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFKRSSHLKQHGKTHIKPEHDLKTKMNLFTCHQCQSTEEAGCKCNMMLMKCQLLHSHLNTQDNKINYSCEQCKVQFSCKSDMRKHAKTHLPAIGRSYTCDQCGKQLSYAKTLANHIKGVHLKIKKHSCENCAKSFFSLAELRQHSPVHSEQKSFVCELCGASFKQRTCLWSHKKWNHEELIYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPYLCTICSATFKTARALKQHGRTHIKSRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query734 2.2.26 [Sep-21-2011]
Q8NB50900 Zinc finger protein 62 ho yes N/A 0.927 0.756 0.316 3e-84
Q8C827914 Zinc finger protein 62 OS yes N/A 0.911 0.731 0.302 4e-82
A6NN141173 Zinc finger protein 729 O no N/A 0.884 0.553 0.316 2e-80
Q054811191 Zinc finger protein 91 OS no N/A 0.885 0.545 0.310 1e-79
Q6ZNA1936 Zinc finger protein 836 O no N/A 0.937 0.735 0.300 9e-79
A8MXY4 1036 Zinc finger protein 99 OS no N/A 0.839 0.594 0.307 3e-78
Q8TF20911 Zinc finger protein 721 O no N/A 0.886 0.714 0.279 1e-76
A8MQ14 1090 Zinc finger protein 850 O no N/A 0.885 0.596 0.300 2e-76
O43345 1167 Zinc finger protein 208 O no N/A 0.899 0.565 0.290 7e-76
Q8N4W9903 Zinc finger protein 808 O no N/A 0.824 0.669 0.309 8e-75
>sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=2 SV=3 Back     alignment and function desciption
 Score =  313 bits (802), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 234/739 (31%), Positives = 340/739 (46%), Gaps = 58/739 (7%)

Query: 7   RLICSLCSETFKSKPRLRAHIWKCQMEPETILETLGHQFES------QLFTGPMEKCDIM 60
           R  C  C  TF+S   LR H      E     E  G  + S         T   EK +  
Sbjct: 168 RYECDDCGGTFRSSSSLRVHKRIHTGEKPYKCEECGKAYMSYSSLINHKSTHSGEK-NCK 226

Query: 61  CDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFVCDL 120
           CD+CGK F  S  L +H K +H   K + C  CGK+F  +S L+ H  IH+ +K + CD+
Sbjct: 227 CDECGKSFNYSSVLDQH-KRIHTGEKPYECGECGKAFRNSSGLRVHKRIHTGEKPYECDI 285

Query: 121 CGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICG 180
           CG +F   S L  HK+ +  E  Y  EC  CGK F+   +L  H   H   +PYKCD C 
Sbjct: 286 CGKTFSNSSGLRVHKRIHTGEKPY--ECDECGKAFITCRTLLNHKSIHFGDKPYKCDECE 343

Query: 181 HGFKLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHS--T 238
             F  +  +++HK        + C+ C   F+ + GL  H++ H       CD C    +
Sbjct: 344 KSFNYSSLLIQHKVIHTGEKPYECDECGKAFRNSSGLIVHKRIHTGEKPYKCDVCGKAFS 403

Query: 239 EEAGCKCNRQLL------QCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQCPVC 292
             +G   ++ +       +C  C ++F     L  H           + T      C VC
Sbjct: 404 YSSGLAVHKSIHPGKKAHECKECGKSFSYNSLLLQH---------RTIHTGERPYVCDVC 454

Query: 293 KLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKS 352
             TF +   LK H + H+ E+ Y C  CGK     S+L  H K +HL  K + C  C+KS
Sbjct: 455 GKTFRNNAGLKVHRRLHTGEKPYKCDVCGKAYISRSSLKNH-KGIHLGEKPYKCSYCEKS 513

Query: 353 FVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFH 412
           F   + L  HK IH+ E+ F CD CG +F+    L  HK++H    E  +KC  C + + 
Sbjct: 514 FNYSSALEQHKRIHTREKPFGCDECGKAFRNNSGLKVHKRIHTG--ERPYKCEECGKAYI 571

Query: 413 RNSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFKRSS 472
             S L +H   H   +P+KCD CE+ F     +  HK+ VH   +PY+C +C  SF  +S
Sbjct: 572 SLSSLINHKSVHPGEKPFKCDECEKAFITYRTLTNHKK-VHLGEKPYKCDVCEKSFNYTS 630

Query: 473 HLKQHGKTHIKPEHDLKTKMNLFTCHQCQSTEEAGCKCNMMLMKCQLLHSHLNTQDNKIN 532
            L QH + H        T+   + C +C+           +      L  H      +  
Sbjct: 631 LLSQHRRVH--------TREKPYECDRCEK----------VFRNNSSLKVHKRIHTGERP 672

Query: 533 YSCEQCKVQFSCKSDMRKHAKTHLPAIGRS-YTCDQCGKQLSYAKTLANHIKGVHLKIKK 591
           Y C+ C   +   S +  H  TH    GR+ +TCD+CGK    ++TL +H K VHL  K 
Sbjct: 673 YECDVCGKAYISHSSLINHKSTHP---GRTPHTCDECGKAFFSSRTLISH-KRVHLGEKP 728

Query: 592 HSCENCAKSFFSLAELRQHSPVHSEQKSFVCELCGASFKQRTCLWSHKKWNHEELIYKFE 651
             C  C KSF   + L QH  +H+ +K +VC+ CG +F+  + L  HK+ +  E  Y  E
Sbjct: 729 FKCVECGKSFSYSSLLSQHKRIHTGEKPYVCDRCGKAFRNSSGLTVHKRIHTGEKPY--E 786

Query: 652 CTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPYLCTI 711
           C  CGK ++ + SL  H   H   +PY C+ CG  F     + +HK+ +H+  +PY C  
Sbjct: 787 CDECGKAYISHSSLINHKSVHQGKQPYNCE-CGKSFNYRSVLDQHKR-IHTGKKPYRCNE 844

Query: 712 CSATFKTARALKQHGRTHI 730
           C   F     L +H RTH 
Sbjct: 845 CGKAFNIRSNLTKHKRTHT 863
May play a role in differentiating skeletal muscle.
Homo sapiens (taxid: 9606)
>sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=2 SV=1 Back     alignment and function description
>sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=3 Back     alignment and function description
>sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 Back     alignment and function description
>sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 Back     alignment and function description
>sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=2 Back     alignment and function description
>sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 Back     alignment and function description
>sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 Back     alignment and function description
>sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=1 Back     alignment and function description
>sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query734
326667187 1365 PREDICTED: zinc finger protein 729-like 0.865 0.465 0.328 8e-91
328726602740 PREDICTED: zinc finger protein Xfin-like 0.926 0.918 0.293 3e-90
326667299 1069 PREDICTED: zinc finger protein 91-like, 0.870 0.597 0.315 5e-90
334328422 1257 PREDICTED: zinc finger protein 208-like 0.880 0.513 0.301 5e-89
358417009 1448 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.852 0.432 0.307 4e-87
296477336699 TPA: zinc finger protein 107 [Bos taurus 0.901 0.947 0.299 1e-86
327288682 1185 PREDICTED: zinc finger protein 850-like 0.866 0.536 0.318 6e-86
328706819818 PREDICTED: zinc finger protein 91-like [ 0.907 0.814 0.286 1e-85
326680667 1782 PREDICTED: zinc finger protein 729-like 0.941 0.387 0.3 1e-85
326667289 1202 PREDICTED: zinc finger protein 729-like 0.959 0.585 0.296 2e-85
>gi|326667187|ref|XP_001920997.3| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
 Score =  341 bits (875), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 226/687 (32%), Positives = 326/687 (47%), Gaps = 52/687 (7%)

Query: 58   DIMCDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFV 117
               C QCGK F+ S SL +H++ +H   K   C  CGK F  +S L QH  IH+ +K F+
Sbjct: 712  PFTCTQCGKSFSKSSSLNKHMR-IHTGEKPFTCTQCGKCFTCSSNLNQHMRIHTGEKPFI 770

Query: 118  CDLCGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCD 177
            C  CG SF Q S L  H K++  E    F CT CGK F ++  L +HM+ H+  +P+ C 
Sbjct: 771  CTQCGKSFSQSSSLNYHMKFHAGE--KPFTCTQCGKSFSQSSHLNKHMRIHTGEKPFTCT 828

Query: 178  ICGHGFKLNYDMLRHKQDVHSNIIHNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHS 237
             CG  F  + ++ +H +         C  C  +F  +  L  H K H      TC QC  
Sbjct: 829  QCGKCFTCSSNLNQHMRIHTGEKPFICTQCGKSFSQSTSLNYHMKIHTGEKPFTCTQCGK 888

Query: 238  TEEAGCKCNRQL--------LQCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQC 289
            +       N  +          C+ C ++F    SL  H+          + T      C
Sbjct: 889  SFSQSSSLNLHMRIHTGEKPFTCTQCGKSFSQSSSLNLHVR---------IHTGEKPFTC 939

Query: 290  PVCKLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVC 349
            P C  +F+    L  H+K H+ E+ +TC HCGK    +S+L+ H+K +H   K  +C  C
Sbjct: 940  PQCGKSFSHSSHLNCHMKIHTGEKPFTCPHCGKSFSQSSHLNCHMK-IHTGEKPFTCPQC 998

Query: 350  DKSFVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDR 409
             KSF   + L  H  IH+ E+ F C  CG SF     L  H ++H    E  F C  C +
Sbjct: 999  GKSFSQSSNLNCHMTIHTGEKPFTCTQCGKSFTCSSHLHQHMRIHTG--EKPFTCTQCGK 1056

Query: 410  KFHRNSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFK 469
             F+++S LN HMR H+  +PY C  C + F  +  +  H   +H+  +P+ CT C  SF 
Sbjct: 1057 AFNKSSNLNLHMRIHTGEKPYTCTQCGKSFSHSSHLNQHMM-IHTGEKPFACTQCGKSFS 1115

Query: 470  RSSHLKQHGKTHI--KPEHDLKTKMNLFTCHQCQSTEEAGCKCNMMLMKCQLLHSHLNTQ 527
             SS L +H K HI  KP          FTC QC  +               LL+ H+   
Sbjct: 1116 LSSSLYRHMKVHIGKKP----------FTCTQCGKSFSLS----------SLLYRHMKIH 1155

Query: 528  DNKINYSCEQCKVQFSCKSDMRKHAKTHLPAIGRSYTCDQCGKQLSYAKTLANHIKGVHL 587
              +  ++C QC   F   S + KH + H     RS+TC QCGK  + +  L  H++ +H 
Sbjct: 1156 TGEKPFTCTQCGKSFRQSSYLNKHIRIHTGK--RSFTCTQCGKSFNKSSNLNLHMR-IHT 1212

Query: 588  KIKKHSCENCAKSFFSLAELRQHSPVHSEQKSFVCELCGASFKQRTCLWSHKKWNHEELI 647
              K  +C  C KSF   + L QH  +H+ +K F C  CG SF Q + L  H + +  E  
Sbjct: 1213 GEKPFTCTQCGKSFSHSSHLNQHMMIHTGEKPFTCTQCGKSFSQSSSLNKHMRIHTGE-- 1270

Query: 648  YKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPY 707
              F CT CGK F  + SLY HMK H+  +P+ C  CG  F     + RH  ++H+  +P+
Sbjct: 1271 KPFTCTQCGKSFSLSSSLYRHMKIHTGKKPFTCTQCGKSFSQLSSLYRH-MNIHTGEKPF 1329

Query: 708  LCTICSATFKTARALKQHGRTHIKSRT 734
             CT C  +F  +  L +H R H+  R+
Sbjct: 1330 TCTKCGKSFNQSSYLNKHIRIHMGKRS 1356

Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|328726602|ref|XP_003248963.1| PREDICTED: zinc finger protein Xfin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|326667299|ref|XP_002661787.2| PREDICTED: zinc finger protein 91-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|334328422|ref|XP_001374290.2| PREDICTED: zinc finger protein 208-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|358417009|ref|XP_002702020.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 91, partial [Bos taurus] Back     alignment and taxonomy information
>gi|296477336|tpg|DAA19451.1| TPA: zinc finger protein 107 [Bos taurus] Back     alignment and taxonomy information
>gi|327288682|ref|XP_003229055.1| PREDICTED: zinc finger protein 850-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|328706819|ref|XP_003243211.1| PREDICTED: zinc finger protein 91-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|326680667|ref|XP_003201586.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667289|ref|XP_003198555.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query734
UNIPROTKB|F1MX341053 F1MX34 "Uncharacterized protei 0.873 0.608 0.319 1.5e-99
UNIPROTKB|H9L0F1900 ZNF555 "Uncharacterized protei 0.949 0.774 0.309 8.4e-97
UNIPROTKB|A6NN141173 ZNF729 "Zinc finger protein 72 0.944 0.590 0.315 1.4e-96
ZFIN|ZDB-GENE-110914-1601003 si:dkey-240n22.7 "si:dkey-240n 0.948 0.693 0.296 1.2e-95
UNIPROTKB|H9L2G0736 ZNF555 "Uncharacterized protei 0.847 0.845 0.324 1.2e-95
UNIPROTKB|J9NSQ51029 ZNF197 "Uncharacterized protei 0.944 0.673 0.321 2e-95
ZFIN|ZDB-GENE-110913-157981 si:ch211-245n8.1 "si:ch211-245 0.945 0.707 0.289 2e-95
UNIPROTKB|J3QSW3840 ZFP62 "Zinc finger protein 62 0.944 0.825 0.318 1.1e-94
UNIPROTKB|Q8NB50900 ZFP62 "Zinc finger protein 62 0.944 0.77 0.318 1.1e-94
UNIPROTKB|F1RH10904 ZFP62 "Uncharacterized protein 0.944 0.766 0.319 2.3e-94
UNIPROTKB|F1MX34 F1MX34 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 988 (352.9 bits), Expect = 1.5e-99, P = 1.5e-99
 Identities = 220/689 (31%), Positives = 340/689 (49%)

Query:    61 CDQCGKHFTSSQSLARHIKCVHLKIKHHWCDICGKSFFAASELKQHSFIHSEQKGFVCDL 120
             CD CGK F  ++ LA H + +H   K H CD+CGK F   + L  H  IH+ +K + C++
Sbjct:   320 CDVCGKAFNQTRKLAIHWR-IHTGEKPHKCDVCGKVFNQTANLAVHQRIHTGEKPYKCNV 378

Query:   121 CGASFKQRSCLWSHKKWNHEELSYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICG 180
             CG +F   + L  H++ +  E  YK  C +CGK F +   L  H K H+  +PYKCD+CG
Sbjct:   379 CGKAFNHSANLTVHRRLHTGEKPYK--CDVCGKAFNQTAKLRLHQKIHTGEKPYKCDVCG 436

Query:   181 HGFKLNYDMLRHKQDVHSNII-HNCNLCSATFKTARGLKQHEKKHMTSILLTCDQCHSTE 239
               F    ++  H Q VH+    + CN+C   F     L  H + H       CD C  T 
Sbjct:   437 KAFSQTANLAVH-QRVHTGEKPYKCNVCDKAFSDTSSLTVHRRVHTGEKPYKCDICVVT- 494

Query:   240 EAGCKCNRQL------LQCSLCSETFKSKPSLRAHIWKCQMEPQTILETYNILSQCPVCK 293
              A    +R++       +C +C + F     L+ H         T  + Y    +C VC+
Sbjct:   495 -ASLAVHRRIHTGEKPYKCDVCGKAFNHTTRLQLH-----QRIHTGEKPY----KCNVCE 544

Query:   294 LTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKSF 353
               F+    L  H + H+  + Y C  CG+     ++L+LH +S+H   K + CDVC K+F
Sbjct:   545 RAFSHTSSLSVHRRLHTGVKPYKCDICGRAFSQTASLALH-RSIHTGEKPYKCDVCGKAF 603

Query:   354 VNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFHR 413
                A LRLH+ IH+ E+ + C +CG +F     L  H+++H  +  YK  C +CD+ F  
Sbjct:   604 NQTAKLRLHRRIHTGEKPYKCCVCGKAFSHTTGLELHQRIHTGEKPYK--CNVCDKAFSH 661

Query:   414 NSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFKRSSH 473
             +S L  H R H+  +PYKCDIC + F  +  + +H+R VH+  +PY+C  C  +F +++ 
Sbjct:   662 SSNLTVHRRLHAGEKPYKCDICGKGFSVSSSLAVHQR-VHTGEKPYKCDTCGKAFNQTAK 720

Query:   474 LKQHGKTHIKPEH---DLKTKM-----NLFTCHQCQSTEEAGCKCNM----MLMKCQL-L 520
             L  H K H   +    D+  K      NL T H+   T E   KC+M      +   L +
Sbjct:   721 LGLHQKIHTGEKSYKCDVCGKAFSRTGNL-TVHRRVHTGEKPYKCDMCGKAFRVSSNLAV 779

Query:   521 HSHLNTQDNKINYSCEQCKVQFSCKSDMRKHAKTHLPAIGRSYTCDQCGKQLSYAKTLAN 580
             H  ++T +    Y C+ C   FS  + +  H + H     + Y CD CGK  ++   L  
Sbjct:   780 HQRVHTGEKP--YKCDVCGKAFSQATGLAVHQRIHTGE--KPYKCDVCGKAFNHTTRLQL 835

Query:   581 HIKGVHLKIKKHSCENCAKSFFSLAELRQHSPVHSEQKSFVCELCGASFKQRTCLWSHKK 640
             H + +H   K + C  C K+F S A L  H  +H+ +K + C++CG  F+  + L  H+ 
Sbjct:   836 HQR-IHTGEKPYKCNVCDKAFISAANLSVHRKLHTGEKPYKCDICGKGFRVSSNLGIHRS 894

Query:   641 WNHEELIYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDV 700
              +  E  YK  C +CGK F    +L  H + H+  +PYKCD+CG  F    ++  H++ +
Sbjct:   895 VHTGEKPYK--CDVCGKAFSHTGNLAVHRRVHTGEKPYKCDVCGKAFSCTGNLAVHRR-L 951

Query:   701 HSTTRPYLCTICSATFKTARALKQHGRTH 729
             H+  +PY C +C   F     L  H R H
Sbjct:   952 HTGEKPYKCDVCGKAFSRTGNLAVHRRLH 980
GO:0008270 "zinc ion binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|H9L0F1 ZNF555 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6NN14 ZNF729 "Zinc finger protein 729" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-160 si:dkey-240n22.7 "si:dkey-240n22.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9L2G0 ZNF555 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSQ5 ZNF197 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-157 si:ch211-245n8.1 "si:ch211-245n8.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J3QSW3 ZFP62 "Zinc finger protein 62 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NB50 ZFP62 "Zinc finger protein 62 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RH10 ZFP62 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8NB50ZFP62_HUMANNo assigned EC number0.31660.92770.7566yesN/A
Q8C827ZFP62_MOUSENo assigned EC number0.30220.91140.7319yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 734
KOG1074|consensus958 99.96
KOG1074|consensus958 99.96
KOG3608|consensus467 99.95
KOG2462|consensus279 99.94
KOG3608|consensus467 99.94
KOG2462|consensus279 99.94
KOG3623|consensus 1007 99.88
KOG3623|consensus 1007 99.87
KOG3576|consensus267 99.72
KOG3576|consensus267 99.69
PLN03086567 PRLI-interacting factor K; Provisional 99.18
PLN03086567 PRLI-interacting factor K; Provisional 99.16
PHA00733128 hypothetical protein 99.04
KOG1146|consensus 1406 99.03
PHA00733128 hypothetical protein 99.01
PHA0276855 hypothetical protein; Provisional 98.9
KOG3993|consensus500 98.75
KOG3993|consensus500 98.73
PHA0276855 hypothetical protein; Provisional 98.71
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.63
KOG1146|consensus 1406 98.54
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.47
PHA0061644 hypothetical protein 98.35
PHA0061644 hypothetical protein 98.27
PHA0073279 hypothetical protein 98.26
PHA0073279 hypothetical protein 98.11
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.1
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.04
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.78
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.62
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.53
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.42
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.3
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.24
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.22
COG5189423 SFP1 Putative transcriptional repressor regulating 97.12
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.12
COG5189423 SFP1 Putative transcriptional repressor regulating 97.08
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.07
KOG2231|consensus 669 96.88
smart0035526 ZnF_C2H2 zinc finger. 96.65
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.64
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.38
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.32
smart0035526 ZnF_C2H2 zinc finger. 96.31
KOG2231|consensus 669 96.12
PRK04860160 hypothetical protein; Provisional 95.86
COG5236493 Uncharacterized conserved protein, contains RING Z 95.86
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.65
KOG2482|consensus423 95.65
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.62
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.6
KOG2785|consensus390 95.25
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.24
KOG2785|consensus390 95.21
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.87
KOG2482|consensus423 94.77
PRK04860160 hypothetical protein; Provisional 94.69
COG5048467 FOG: Zn-finger [General function prediction only] 94.54
COG5048467 FOG: Zn-finger [General function prediction only] 93.76
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.14
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.28
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.98
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 90.72
KOG2893|consensus341 90.0
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 89.59
KOG4173|consensus253 88.25
KOG4173|consensus253 87.96
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 87.32
KOG2893|consensus341 85.68
COG404965 Uncharacterized protein containing archaeal-type C 80.52
>KOG1074|consensus Back     alignment and domain information 
Probab=99.96  E-value=1.1e-30  Score=267.86  Aligned_cols=234  Identities=22%  Similarity=0.468  Sum_probs=159.6

Q ss_pred             ccccccccccccChHHHHhHHhhhccCCCccccCcchhhhcCcHhHHHHhhhcCCCCcccccccCccccccccccccchh
Q psy366          429 PYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFKRSSHLKQHGKTHIKPEHDLKTKMNLFTCHQCQSTEEAGC  508 (734)
Q Consensus       429 ~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~  508 (734)
                      |.+|-+|-++..-+..|+.|++ .|+|++||+|.+||+.|.++.+|+.|+-.|-..         +              
T Consensus       605 PNqCiiC~rVlSC~saLqmHyr-tHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~---------p--------------  660 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYR-THTGERPFKCKICGRAFTTKGNLKAHMSVHKAK---------P--------------  660 (958)
T ss_pred             ccceeeeeecccchhhhhhhhh-cccCcCccccccccchhccccchhhcccccccC---------c--------------
Confidence            4679999999999999999999 999999999999999999999999998887311         0              


Q ss_pred             hhhhhhhhhHhhhhcccccCCCCccccc---cccccccchhHHHHHhhhhCC-----------CCCCcccccccccccCC
Q psy366          509 KCNMMLMKCQLLHSHLNTQDNKINYSCE---QCKVQFSCKSDMRKHAKTHLP-----------AIGRSYTCDQCGKQLSY  574 (734)
Q Consensus       509 ~~~~~~~~~~~l~~h~~~~~~~~~~~C~---~C~~~f~~~~~l~~H~~~h~~-----------~~~~~~~C~~C~~~f~~  574 (734)
                                         .-...+.|+   +|-+.|...-.|..|+++|..           .+.-.-+|..|.+.|..
T Consensus       661 -------------------~~R~q~ScP~~~ic~~kftn~V~lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~  721 (958)
T KOG1074|consen  661 -------------------PARVQFSCPSTFICQKKFTNAVTLPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSD  721 (958)
T ss_pred             -------------------cccccccCCchhhhcccccccccccceEEeecCCCCCCCcccccccchhcccchhhhcccc
Confidence                               111346777   777778877788888777752           11223568888888877


Q ss_pred             hHHHHhHhhhhc----------------CCCC----cccccchhHhhcCHHHHHhHhh----------------------
Q psy366          575 AKTLANHIKGVH----------------LKIK----KHSCENCAKSFFSLAELRQHSP----------------------  612 (734)
Q Consensus       575 ~~~L~~H~~~~H----------------~~~~----~~~C~~C~~~f~~~~~l~~H~~----------------------  612 (734)
                      ...+..++. .|                +++.    +..+..|+..+.....+..+-.                      
T Consensus       722 a~~f~~~~s-e~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~  800 (958)
T KOG1074|consen  722 ARSFSQQIS-EQPSPESEPDEQMDERTETEELDVTPPPPENSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGE  800 (958)
T ss_pred             cccchhhhh-ccCCcccCCcccccccccccccccCCCccccccccccCcccccccccchhhhhcChhhhcCccccchhhh
Confidence            777777765 23                2222    5678888888776555444321                      


Q ss_pred             -hcCCCCcc-ccccccccccChhHHh----hhhhh--------hcc----------------------------cccccc
Q psy366          613 -VHSEQKSF-VCELCGASFKQRTCLW----SHKKW--------NHE----------------------------ELIYKF  650 (734)
Q Consensus       613 -~h~~~~~~-~C~~C~~~f~~~~~l~----~H~~~--------h~~----------------------------~~~~~~  650 (734)
                       .++++++. .+..++..-.......    .-...        -..                            ......
T Consensus       801 ~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h  880 (958)
T KOG1074|consen  801 EDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAH  880 (958)
T ss_pred             hcccCCCCcccccCCCcCCccccccCchhhcccccccccccccccccccCCCcchhhhhhccccccCCCCCCCCcccchh
Confidence             23455666 6666665443322111    00000        000                            000126


Q ss_pred             ccccccccccCchhHHHHhhhccCCccccCCCcCCcCCcchHHHhhhhhccCCCCCc
Q psy366          651 ECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPY  707 (734)
Q Consensus       651 ~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~  707 (734)
                      .|.+||+.|.+.++|++|||+|+|++||.|.+|++.|+.+.+|+.||. .|.+..|+
T Consensus       881 ~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMg-tH~w~q~~  936 (958)
T KOG1074|consen  881 VCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMG-THMWVQPP  936 (958)
T ss_pred             hhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhc-cccccCCC
Confidence            788888888888888888888888888888888888888888888884 67666554

>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query734
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-26
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 5e-24
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 5e-23
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-13
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-10
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 4e-10
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 4e-10
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 5e-05
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 6e-10
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-09
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 3e-05
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 1e-04
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-09
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-05
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-04
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-09
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 1e-04
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-06
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 5e-09
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 6e-09
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-04
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 7e-09
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-04
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 9e-09
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-04
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-08
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-05
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 8e-08
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-04
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-07
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-05
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-04
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-07
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-07
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-05
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-07
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-04
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 5e-07
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-05
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 9e-07
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 9e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-06
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-06
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 5e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 2e-04
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 4e-04
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 4e-04
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 4e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 5e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 5e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure 
Iteration: 1

 Score =  116 bits (291), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 87/174 (50%), Gaps = 3/174 (1%)
Query: 277 QTILETYNILSQCPVCKLTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKS 336
           Q  LE       CP C  +F+    L  H +TH+ E+ Y C  CGK      +L+ H + 
Sbjct: 12  QAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQR- 70
Query: 337 VHLKIKDHSCDVCDKSFVNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDA 396
            H   K + C  C KSF  RA LR H+  H+ E+ + C  CG SF Q   L AH++ H  
Sbjct: 71  THTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTG 130
Query: 397 KLEYKFKCILCDRKFHRNSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKR 450
             E  +KC  C + F R   L++H RTH+  +PYKC  C + F     + +H+R
Sbjct: 131 --EKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQR 182
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query734
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-32
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-19
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-16
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-15
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-14
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-19
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-15
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-15
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-14
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-16
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 9e-16
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-16
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-15
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-13
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-12
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-12
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-15
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-10
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-10
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-09
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-13
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-11
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-11
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 9e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 8e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 9e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 6e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 9e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 4e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  121 bits (306), Expect = 7e-32
 Identities = 59/188 (31%), Positives = 91/188 (48%), Gaps = 4/188 (2%)

Query: 294 LTFTDKRKLKSHLKTHSIERSYTCHHCGKQLCGASNLSLHIKSVHLKIKDHSCDVCDKSF 353
           ++        +       E+ Y C  CGK    + +L+ H +  H   K + C  C KSF
Sbjct: 1   ISEFGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEH-QRTHTGEKPYKCPECGKSF 59

Query: 354 VNRAGLRLHKLIHSEERGFVCDLCGASFKQRPALWAHKKLHDAKLEYKFKCILCDRKFHR 413
            ++  L  H+  H+ E+ + C  CG SF QR  L AH++ H    E  + C  C + F +
Sbjct: 60  SDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTG--EKPYACPECGKSFSQ 117

Query: 414 NSKLNSHMRTHSDVRPYKCDICEQHFKFNYDIQMHKRCVHSNIRPYQCTLCSASFKRSSH 473
            + L +H RTH+  +PYKC  C + F    ++  H+R  H+  +PY+C  C  SF R   
Sbjct: 118 LAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQR-THTGEKPYKCPECGKSFSRRDA 176

Query: 474 LKQHGKTH 481
           L  H +TH
Sbjct: 177 LNVHQRTH 184
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query734
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.77
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.77
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.76
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.75
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.75
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.74
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.73
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.72
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.71
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.7
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.69
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.68
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.67
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.66
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.64
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.61
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.61
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.6
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.6
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.59
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.57
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.57
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.57
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.55
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.52
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.52
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.52
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.51
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.51
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.51
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.5
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.49
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.49
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.49
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.49
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.48
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.48
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.47
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.46
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.45
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.45
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.45
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.43
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.42
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.42
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.4
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.4
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.36
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.35
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.35
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.34
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.33
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.31
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.31
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.31
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.27
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.23
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.2
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.18
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.17
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.16
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.1
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.03
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.01
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.01
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.0
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.0
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.0
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.98
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.98
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.97
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.96
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.95
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.94
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.94
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.92
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.92
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.92
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.91
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.9
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.89
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.89
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.87
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.87
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.86
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.86
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.84
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.84
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.84
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.81
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.79
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.79
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.79
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.78
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.76
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.76
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.74
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.7
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.69
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.64
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.63
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.62
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.62
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.57
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.56
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.55
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.49
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.49
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.45
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.43
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.41
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.4
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.4
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.33
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.32
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.3
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.27
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.26
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.26
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.25
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.24
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.23
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.23
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.22
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.51
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.2
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.2
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.19
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.16
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.15
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.43
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.14
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.13
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.08
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.06
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.05
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.02
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.0
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.96
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.2
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.95
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.18
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.93
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.9
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.9
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.88
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.86
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.85
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.83
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.83
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.04
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.8
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.79
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.79
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.76
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.9
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.48
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.23
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.1
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.78
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.73
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.41
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.27
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.88
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.16
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.57
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.47
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.16
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 90.7
2k5c_A95 Uncharacterized protein PF0385; structural genomic 81.6
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=3.8e-38  Score=295.44  Aligned_cols=184  Identities=33%  Similarity=0.663  Sum_probs=143.0

Q ss_pred             hhHHHHHhhhhCCCCCCcccccccccccCChHHHHhHhhhhcCCCCcccccchhHhhcCHHHHHhHhhhcCCCCcccccc
Q psy366          545 KSDMRKHAKTHLPAIGRSYTCDQCGKQLSYAKTLANHIKGVHLKIKKHSCENCAKSFFSLAELRQHSPVHSEQKSFVCEL  624 (734)
Q Consensus       545 ~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  624 (734)
                      ...|..|+.+|  .++++|.|++|++.|.+...|..|++ .|.++++|.|+.|++.|.+...|..|+++|+++++|.|++
T Consensus         6 ~~~l~~h~~~~--~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~   82 (190)
T 2i13_A            6 SSSSVAQAALE--PGEKPYACPECGKSFSRSDHLAEHQR-THTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPE   82 (190)
T ss_dssp             ---------------------------CCSSHHHHHGGG-CC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTT
T ss_pred             hccchhhhhhc--CCCCCCcCCCCccccCCHHHHHHHHH-HcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcc
Confidence            34577787777  56788999999999999999999988 7888999999999999999999999999999999999999


Q ss_pred             ccccccChhHHhhhhhhhccccccccccccccccccCchhHHHHhhhccCCccccCCCcCCcCCcchHHHhhhhhccCCC
Q psy366          625 CGASFKQRTCLWSHKKWNHEELIYKFECTLCGKKFVKNYSLYEHMKRHSDVRPYKCDICGHGFKLNYDMLRHKQDVHSTT  704 (734)
Q Consensus       625 C~~~f~~~~~l~~H~~~h~~~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~  704 (734)
                      |++.|.+..+|..|++.|+++  ++|.|++|++.|.+...|..|+++|++++||.|++|++.|.+...|..|+ ..|.++
T Consensus        83 C~~~f~~~~~l~~H~~~h~~~--~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~-~~H~~~  159 (190)
T 2i13_A           83 CGKSFSQRANLRAHQRTHTGE--KPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQ-RTHTGE  159 (190)
T ss_dssp             TCCEESCHHHHHHHHHHHHTC--CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHH-HHHHCC
T ss_pred             cCCccCCHHHHHHHHHhcCCC--CCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHH-HhcCCC
Confidence            999999999999999999988  88999999999999999999999999999999999999999999999998 579999


Q ss_pred             CCcccCcchhhcCChHHHHHHHhhccCCCC
Q psy366          705 RPYLCTICSATFKTARALKQHGRTHIKSRT  734 (734)
Q Consensus       705 ~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~  734 (734)
                      +||.|++||+.|.+...|+.|+++|+|++|
T Consensus       160 ~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~  189 (190)
T 2i13_A          160 KPYKCPECGKSFSRRDALNVHQRTHTGKKT  189 (190)
T ss_dssp             CCEECTTTCCEESSHHHHHHHHTTC-----
T ss_pred             CCeECCCCCCccCCHHHHHHHHHhcCCCCC
Confidence            999999999999999999999999999987
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 734
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.7 bits (88), Expect = 1e-04
 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 402 FKCILCDRKFHRNSKLNSHMR-THSDVRPYKCDI 434
           + C  C + F R   LN H++  H+  RP+KC +
Sbjct: 6   YICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query734
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.53
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.27
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.25
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.17
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.17
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.16
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.15
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.1
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.09
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.09
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.06
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.05
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.04
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.03
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.01
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.97
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.97
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.93
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.92
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.91
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.85
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.84
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.83
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.82
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.79
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.74
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.7
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.65
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.64
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.62
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.57
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.53
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.53
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.46
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.44
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.31
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.21
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.18
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.17
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.16
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.05
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.0
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.84
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.84
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.8
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.76
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.74
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.72
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.64
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.54
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.47
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.43
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.4
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.36
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.35
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.34
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.27
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.17
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.14
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.04
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.03
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.01
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.98
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.96
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.89
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.87
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.85
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.75
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.74
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.72
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.52
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.5
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.43
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.32
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.32
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.74
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.58
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.46
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.27
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.27
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.12
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.08
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.46
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.28
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.05
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.76
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.64
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.21
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.74
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.29
d1y0jb136 U-shaped transcription factor, different fingers { 92.1
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.08
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.59
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.78
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 89.94
d1y0jb136 U-shaped transcription factor, different fingers { 89.71
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.35
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.27
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 87.65
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 86.7
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 86.1
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 85.88
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 85.22
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 85.06
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 85.04
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 84.79
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 83.27
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 82.9
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 82.88
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 82.42
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 81.98
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 81.3
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 80.02
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.60  E-value=1.3e-16  Score=109.72  Aligned_cols=53  Identities=34%  Similarity=0.693  Sum_probs=38.1

Q ss_pred             CccccCCCcCCcCCcchHHHhhhhhccCCCCCcccCcchhhcCChHHHHHHHhhc
Q psy366          675 VRPYKCDICGHGFKLNYDMLRHKQDVHSTTRPYLCTICSATFKTARALKQHGRTH  729 (734)
Q Consensus       675 ~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~H  729 (734)
                      ||||.|+ ||++|....+|.+|+ ++|+|++||.|++||++|.+.+.|..||++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~-~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHM-SMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHH-HHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHh-hccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            5677774 777777777777776 5677777777777777777777777777766
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure