Psyllid ID: psy3689

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MIILIDSDVTLSRVAAALLNKHLQINGITASRLDLQDTSVELEDGIMHPISDSTPNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAFKKTLQSCCYALILRRSDMEK
cEEEEEcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHHHcccccccccccc
cccEEEEEEcccHHHHHHHHHHHHcccccccccHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHccccccccccccccc
MIILIDSDVTLSRVAAALLNKHLQIngitasrldlqdtsveledgimhpisdstpnmKRERKAARTLGIIMSAFLACWLPFFIWYLgsslcgpkcstprVIVVLVFWTgyfnsslnpliYAYFNREFRIAFKKTLQSCCYALILRRSDMEK
MIILIDSDVTLSRVAAALLNKHlqingitasrldLQDTSVELEDgimhpisdstpnmkRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAFKKTLQSCCYALILRRSDMEK
MIILIDSDVTLSRVAAALLNKHLQINGITASRLDLQDTSVELEDGIMHPISDSTPNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAFKKTLQSCCYALILRRSDMEK
*IILIDSDVTLSRVAAALLNKHLQINGITASRLDLQ***************************ARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAFKKTLQSCCYALILR******
MIILI**********************************************************ARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAFKKTLQSCCYA***RR*****
MIILIDSDVTLSRVAAALLNKHLQINGITASRLDLQDTSVELEDGIMHPISDSTPNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAFKKTLQSCCYALILRRSDMEK
MIILIDSDVTLSRVAAALLNKHLQ*******************************NMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAFKKTLQSCCYA**********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIILIDSDVTLSRVAAALLNKHLQINGITASRLDLQDTSVELEDGIMHPISDSTPNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAFKKTLQSCCYALILRRSDMEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
Q9VCZ3508 Octopamine receptor beta- no N/A 0.748 0.222 0.603 3e-36
Q4LBB61256 Octopamine receptor beta- no N/A 0.589 0.070 0.644 1e-30
Q4LBB9536 Octopamine receptor beta- no N/A 0.516 0.145 0.658 2e-26
P21917467 D(4) dopamine receptor OS yes N/A 0.529 0.171 0.530 7e-21
Q6TLJ0357 D(4) dopamine receptor OS N/A N/A 0.529 0.224 0.530 4e-20
Q25322484 Putative tyramine recepto N/A N/A 0.536 0.167 0.518 4e-20
Q25321484 Tyramine receptor 1 OS=Lo N/A N/A 0.536 0.167 0.518 4e-20
P28286617 5-hydroxytryptamine recep no N/A 0.509 0.124 0.576 1e-19
Q0EAB6422 5-hydroxytryptamine recep yes N/A 0.529 0.189 0.525 4e-19
Q64264421 5-hydroxytryptamine recep yes N/A 0.529 0.190 0.512 4e-19
>sp|Q9VCZ3|OCTB1_DROME Octopamine receptor beta-1R OS=Drosophila melanogaster GN=oa2 PE=2 SV=1 Back     alignment and function desciption
 Score =  150 bits (378), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (73%), Gaps = 13/126 (10%)

Query: 12  SRVAAALLNKHLQINGITASRLDLQDTSVELEDGIMHPISDSTPNMKRERKAARTLGIIM 71
           S+VAA LL KHLQI+ I   R      S+++E         +   M+RERKAARTLGIIM
Sbjct: 309 SKVAALLLEKHLQISQIPKPR-----PSIQVEQ-------STISTMRRERKAARTLGIIM 356

Query: 72  SAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAF 131
           SAFL CWLPFF+WY+ SSLC   C TPR++V ++FW GYFNS+LNP+IYAYFNR+FR AF
Sbjct: 357 SAFLICWLPFFLWYIVSSLCD-SCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAF 415

Query: 132 KKTLQS 137
           KKTL+S
Sbjct: 416 KKTLKS 421
Receptor for octopamine. Octopamine (OA) is a neurotransmitter, neurohormone, and neuromodulator in invertebrates. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Octopamine does not cause Ca(2+) release in oa2-expressing cells.
Drosophila melanogaster (taxid: 7227)
>sp|Q4LBB6|OCTB3_DROME Octopamine receptor beta-3R OS=Drosophila melanogaster GN=Octbeta3R PE=2 SV=4 Back     alignment and function description
>sp|Q4LBB9|OCTB2_DROME Octopamine receptor beta-2R OS=Drosophila melanogaster GN=Octbeta2R PE=2 SV=2 Back     alignment and function description
>sp|P21917|DRD4_HUMAN D(4) dopamine receptor OS=Homo sapiens GN=DRD4 PE=1 SV=2 Back     alignment and function description
>sp|Q6TLJ0|DRD4_MUSPF D(4) dopamine receptor OS=Mustela putorius furo GN=DRD4 PE=2 SV=1 Back     alignment and function description
>sp|Q25322|OAR2_LOCMI Putative tyramine receptor 2 OS=Locusta migratoria GN=GCR2 PE=2 SV=1 Back     alignment and function description
>sp|Q25321|OAR1_LOCMI Tyramine receptor 1 OS=Locusta migratoria GN=GCR1 PE=1 SV=1 Back     alignment and function description
>sp|P28286|5HT2B_DROME 5-hydroxytryptamine receptor 2B OS=Drosophila melanogaster GN=5-HT1B PE=2 SV=3 Back     alignment and function description
>sp|Q0EAB6|5HT1A_HORSE 5-hydroxytryptamine receptor 1A OS=Equus caballus GN=HTR1A PE=2 SV=1 Back     alignment and function description
>sp|Q64264|5HT1A_MOUSE 5-hydroxytryptamine receptor 1A OS=Mus musculus GN=Htr1a PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
91090658 527 PREDICTED: similar to GA19956-PA [Tribol 0.827 0.237 0.674 3e-43
242004158 400 class A rhodopsin-like G-protein coupled 0.860 0.325 0.671 1e-42
66548399 428 PREDICTED: octopamine receptor beta-1R [ 0.860 0.303 0.633 4e-41
380012226 474 PREDICTED: octopamine receptor beta-1R-l 0.860 0.274 0.633 6e-41
193605921 486 PREDICTED: octopamine receptor beta-1R-l 0.834 0.259 0.671 1e-40
357609920 356 hypothetical protein KGM_02182 [Danaus p 0.821 0.348 0.625 2e-40
383862143 428 PREDICTED: octopamine receptor beta-1R-l 0.834 0.294 0.625 5e-40
350413453 427 PREDICTED: octopamine receptor beta-1R-l 0.834 0.295 0.617 6e-39
195454037 489 GK12816 [Drosophila willistoni] gi|19417 0.788 0.243 0.609 4e-37
390177087 525 GA19956 [Drosophila pseudoobscura pseudo 0.788 0.226 0.616 5e-37
>gi|91090658|ref|XP_974265.1| PREDICTED: similar to GA19956-PA [Tribolium castaneum] gi|270014323|gb|EFA10771.1| hypothetical protein TcasGA2_TC012600 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 104/132 (78%), Gaps = 7/132 (5%)

Query: 12  SRVAAALLNKHLQINGITASRLDLQ---DTSVELEDGIMHPISDSTPNMKRERKAARTLG 68
           S+VAAALLNKHLQINGI+A    L+   D  +E E     P   ++  MKRERKAARTLG
Sbjct: 333 SKVAAALLNKHLQINGISAGLTALRQSVDAGLESEKT---PDPGTSSKMKRERKAARTLG 389

Query: 69  IIMSAFLACWLPFFIWYLGSSLCGPK-CSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREF 127
           II+SAFLACWLPFF+WY+ +SLCG K C +P  ++ LVFW GYFNS+LNPLIYAYFNREF
Sbjct: 390 IIVSAFLACWLPFFLWYVITSLCGSKRCYSPPSVITLVFWIGYFNSALNPLIYAYFNREF 449

Query: 128 RIAFKKTLQSCC 139
           R+AFKKTLQSCC
Sbjct: 450 RVAFKKTLQSCC 461

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242004158|ref|XP_002422997.1| class A rhodopsin-like G-protein coupled receptor GPRoar2, putative [Pediculus humanus corporis] gi|212505913|gb|EEB10259.1| class A rhodopsin-like G-protein coupled receptor GPRoar2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|66548399|ref|XP_397139.2| PREDICTED: octopamine receptor beta-1R [Apis mellifera] Back     alignment and taxonomy information
>gi|380012226|ref|XP_003690187.1| PREDICTED: octopamine receptor beta-1R-like [Apis florea] Back     alignment and taxonomy information
>gi|193605921|ref|XP_001947781.1| PREDICTED: octopamine receptor beta-1R-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357609920|gb|EHJ66744.1| hypothetical protein KGM_02182 [Danaus plexippus] Back     alignment and taxonomy information
>gi|383862143|ref|XP_003706543.1| PREDICTED: octopamine receptor beta-1R-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350413453|ref|XP_003489997.1| PREDICTED: octopamine receptor beta-1R-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|195454037|ref|XP_002074057.1| GK12816 [Drosophila willistoni] gi|194170142|gb|EDW85043.1| GK12816 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|390177087|ref|XP_001357862.3| GA19956 [Drosophila pseudoobscura pseudoobscura] gi|388858900|gb|EAL26997.3| GA19956 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
FB|FBgn0038980508 oa2 "octopamine receptor 2" [D 0.748 0.222 0.619 2.2e-34
FB|FBgn02509101256 Octbeta3R "Octbeta3R" [Drosoph 0.589 0.070 0.644 1.5e-29
FB|FBgn0038063536 Octbeta2R "Octbeta2R" [Drosoph 0.516 0.145 0.658 1.7e-25
UNIPROTKB|P21917467 DRD4 "D(4) dopamine receptor" 0.529 0.171 0.530 5.4e-20
UNIPROTKB|F1RYX4371 DRD4 "Uncharacterized protein" 0.529 0.215 0.518 1.1e-19
MGI|MGI:96273421 Htr1a "5-hydroxytryptamine (se 0.529 0.190 0.512 7.9e-19
UNIPROTKB|F1NAZ2422 HTR1A "Uncharacterized protein 0.529 0.189 0.512 7.9e-19
UNIPROTKB|F6Q2H9422 HTR1A "Uncharacterized protein 0.529 0.189 0.512 1e-18
UNIPROTKB|P08908422 HTR1A "5-hydroxytryptamine rec 0.529 0.189 0.512 1e-18
UNIPROTKB|F1SKV3422 HTR1A "Uncharacterized protein 0.529 0.189 0.512 1e-18
FB|FBgn0038980 oa2 "octopamine receptor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 373 (136.4 bits), Expect = 2.2e-34, P = 2.2e-34
 Identities = 78/126 (61%), Positives = 95/126 (75%)

Query:    12 SRVAAALLNKHLQINGITASRLDLQDTSVELEDGIMHPISDSTPNMKRERKAARTLGIIM 71
             S+VAA LL KHLQI+ I   R      S+++E   +     ST  M+RERKAARTLGIIM
Sbjct:   309 SKVAALLLEKHLQISQIPKPR-----PSIQVEQSTI-----ST--MRRERKAARTLGIIM 356

Query:    72 SAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAF 131
             SAFL CWLPFF+WY+ SSLC   C TPR++V ++FW GYFNS+LNP+IYAYFNR+FR AF
Sbjct:   357 SAFLICWLPFFLWYIVSSLCD-SCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAF 415

Query:   132 KKTLQS 137
             KKTL+S
Sbjct:   416 KKTLKS 421
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0008227 "G-protein coupled amine receptor activity" evidence=ISS
GO:0071875 "adrenergic receptor signaling pathway" evidence=IEA
GO:0004935 "adrenergic receptor activity" evidence=IEA
GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IDA
GO:0005887 "integral to plasma membrane" evidence=IC
GO:0004989 "octopamine receptor activity" evidence=IDA
GO:0051482 "elevation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway" evidence=IDA
GO:0045886 "negative regulation of synaptic growth at neuromuscular junction" evidence=IMP
FB|FBgn0250910 Octbeta3R "Octbeta3R" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038063 Octbeta2R "Octbeta2R" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P21917 DRD4 "D(4) dopamine receptor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYX4 DRD4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:96273 Htr1a "5-hydroxytryptamine (serotonin) receptor 1A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAZ2 HTR1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F6Q2H9 HTR1A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P08908 HTR1A "5-hydroxytryptamine receptor 1A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKV3 HTR1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9N2985HT1A_PANTRNo assigned EC number0.51250.52980.1895yesN/A
Q642645HT1A_MOUSENo assigned EC number0.51250.52980.1900yesN/A
P193275HT1A_RATNo assigned EC number0.51250.52980.1895yesN/A
Q6XXX95HT1A_CANFANo assigned EC number0.51250.52980.1891yesN/A
P21917DRD4_HUMANNo assigned EC number0.53080.52980.1713yesN/A
Q0EAB65HT1A_HORSENo assigned EC number0.5250.52980.1895yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 6e-12
PHA03087335 PHA03087, PHA03087, G protein-coupled chemokine re 9e-05
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score = 60.8 bits (148), Expect = 6e-12
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 47  MHPISDSTPNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVF 106
               + +  +  +ERKAA+ L +++  F+ CWLP+ I  L  SLC           +L+ 
Sbjct: 177 GASQARAKRSSSKERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIWRLLPTALLIT 236

Query: 107 -WTGYFNSSLNPLIY 120
            W  Y NS LNP+IY
Sbjct: 237 LWLAYVNSCLNPIIY 251

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251
>gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
KOG4219|consensus423 99.73
PHA03234338 DNA packaging protein UL33; Provisional 99.73
KOG4220|consensus503 99.7
PHA02834323 chemokine receptor-like protein; Provisional 99.67
PHA03235409 DNA packaging protein UL33; Provisional 99.64
PHA02638417 CC chemokine receptor-like protein; Provisional 99.55
PHA03087335 G protein-coupled chemokine receptor-like protein; 99.5
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.21
PF10324318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 98.72
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 98.18
KOG2087|consensus363 97.97
PF1197076 Git3_C: G protein-coupled glucose receptor regulat 97.52
PF05296303 TAS2R: Mammalian taste receptor protein (TAS2R); I 97.47
PF10321313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 97.26
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 97.13
PF05462303 Dicty_CAR: Slime mold cyclic AMP receptor 96.52
PF10328274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 96.38
PF10317292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 96.07
PF03402265 V1R: Vomeronasal organ pheromone receptor family, 95.32
PF02101405 Ocular_alb: Ocular albinism type 1 protein; InterP 94.35
PF10327303 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept 93.02
PF10318302 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemorecept 92.92
KOG4564|consensus473 89.0
KOG4193|consensus610 86.85
PF10319310 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemorecept 86.75
PF10326307 7TM_GPCR_Str: Serpentine type 7TM GPCR chemorecept 85.09
KOG2575|consensus 510 81.2
>KOG4219|consensus Back     alignment and domain information 
Probab=99.73  E-value=5.8e-18  Score=129.45  Aligned_cols=87  Identities=23%  Similarity=0.616  Sum_probs=73.8

Q ss_pred             CCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhcCCC--CCcHHHHHHHHHHHHHHhhhhhHHHhhhccHHHHHH
Q psy3689          53 STPNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPK--CSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIA  130 (151)
Q Consensus        53 ~~~~~~~~~k~~~~~~~iv~~f~vcw~P~~i~~~~~~~~~~~--~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~  130 (151)
                      ..+..+.++|++||++++++.|.+||+||++..++....++-  ......++....||+.+|+|+||+||+++|++||.+
T Consensus       249 ~~~~~kak~K~vkmliiVV~~FaicWlPyh~y~il~~~~~~i~~~k~i~~vyl~~~WLaMSst~yNPiIY~~lN~Rfr~g  328 (423)
T KOG4219|consen  249 KHEQLKAKKKVVKMLIIVVVIFAICWLPYHIYFILNATNPEINRKKFIQQVYLAIYWLAMSSTCYNPIIYCFLNKRFRGG  328 (423)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHhccChhHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhhhccHhhhhhHHHHHHH
Confidence            445667889999999999999999999999999987654431  123455788899999999999999999999999999


Q ss_pred             HHHHHHHhh
Q psy3689         131 FKKTLQSCC  139 (151)
Q Consensus       131 ~~~~~~~~~  139 (151)
                      +++.|++|-
T Consensus       329 f~~~fr~cp  337 (423)
T KOG4219|consen  329 FRRAFRWCP  337 (423)
T ss_pred             Hhhhhheee
Confidence            999998763

>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF11970 Git3_C: G protein-coupled glucose receptor regulating Gpa2 C-term; InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes Back     alignment and domain information
>PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10318 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemoreceptor Srh; InterPro: IPR019422 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG4564|consensus Back     alignment and domain information
>KOG4193|consensus Back     alignment and domain information
>PF10319 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemoreceptor Srj; InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10326 7TM_GPCR_Str: Serpentine type 7TM GPCR chemoreceptor Str; InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2575|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
3rze_A452 Structure Of The Human Histamine H1 Receptor In Com 2e-16
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 6e-14
2r4s_A342 Crystal Structure Of The Human Beta2 Adrenoceptor L 5e-13
2r4r_A365 Crystal Structure Of The Human Beta2 Adrenoceptor L 5e-13
3kj6_A366 Crystal Structure Of A Methylated Beta2 Adrenergic 6e-13
3sn6_R514 Crystal Structure Of The Beta2 Adrenergic Receptor- 6e-13
3p0g_A501 Structure Of A Nanobody-Stabilized Active State Of 5e-11
2rh1_A500 High Resolution Crystal Structure Of Human B2-Adren 5e-11
3d4s_A490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 6e-11
3pds_A458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 7e-11
4gbr_A309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 8e-11
2vt4_A313 Turkey Beta1 Adrenergic Receptor With Stabilising M 5e-10
2y00_B315 Turkey Beta1 Adrenergic Receptor With Stabilising M 5e-10
4eiy_A447 Crystal Structure Of The Chimeric Protein Of A2aar- 7e-10
2ydo_A325 Thermostabilised Human A2a Receptor With Adenosine 1e-09
3vg9_A326 Crystal Structure Of Human Adenosine A2a Receptor W 1e-09
3eml_A488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 1e-09
4daj_A479 Structure Of The M3 Muscarinic Acetylcholine Recept 2e-09
3uon_A467 Structure Of The Human M2 Muscarinic Acetylcholine 2e-09
3pwh_A329 Thermostabilised Adenosine A2a Receptor Length = 32 6e-09
4ea3_B434 Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WI 9e-07
3v2w_A520 Crystal Structure Of A Lipid G Protein-Coupled Rece 3e-05
3oe6_A508 Crystal Structure Of The Cxcr4 Chemokine Receptor I 8e-05
3odu_A502 The 2.5 A Structure Of The Cxcr4 Chemokine Receptor 8e-05
2lnl_A296 Structure Of Human Cxcr1 In Phospholipid Bilayers L 9e-05
4ej4_A461 Structure Of The Delta Opioid Receptor Bound To Nal 2e-04
2x72_A349 Crystal Structure Of The Constitutively Active E113 3e-04
2j4y_A349 Crystal Structure Of A Rhodopsin Stabilizing Mutant 4e-04
3c9m_A348 Structure Of A Mutant Bovine Rhodopsin In Hexagonal 4e-04
3oe0_A499 Crystal Structure Of The Cxcr4 Chemokine Receptor I 4e-04
3oax_A349 Crystal Structure Of Bovine Rhodopsin With Beta-Ion 6e-04
1jfp_A348 Structure Of Bovine Rhodopsin (Dark Adapted) Length 6e-04
4djh_A480 Structure Of The Human Kappa Opioid Receptor In Com 7e-04
4a4m_A349 Crystal Structure Of The Light-Activated Constituti 7e-04
>pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 Back     alignment and structure 
Iteration: 1

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 54/85 (63%), Gaps = 2/85 (2%)
Query: 52  DSTPNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYF 111
           D+  +M RERKAA+ LG IM+AF+ CW+P+FI+++  + C   C+    + +   W GY 
Sbjct: 360 DAYLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCKNCCNEH--LHMFTIWLGYI 417
Query: 112 NSSLNPLIYAYFNREFRIAFKKTLQ 136
           NS+LNPLIY   N  F+  FK+ L 
Sbjct: 418 NSTLNPLIYPLCNENFKKTFKRILH 442
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure
>pdb|4EIY|A Chain A, Crystal Structure Of The Chimeric Protein Of A2aar-Bril In Complex With Zm241385 At 1.8a Resolution Length = 447 Back     alignment and structure
>pdb|2YDO|A Chain A, Thermostabilised Human A2a Receptor With Adenosine Bound Length = 325 Back     alignment and structure
>pdb|3VG9|A Chain A, Crystal Structure Of Human Adenosine A2a Receptor With An Allosteric Inverse-Agonist Antibody At 2.7 A Resolution Length = 326 Back     alignment and structure
>pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 Back     alignment and structure
>pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 Back     alignment and structure
>pdb|3PWH|A Chain A, Thermostabilised Adenosine A2a Receptor Length = 329 Back     alignment and structure
>pdb|4EA3|B Chain B, Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WITH A PEPTIDE Mimetic Length = 434 Back     alignment and structure
>pdb|3V2W|A Chain A, Crystal Structure Of A Lipid G Protein-Coupled Receptor At 3.35a Length = 520 Back     alignment and structure
>pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 Back     alignment and structure
>pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 Back     alignment and structure
>pdb|2LNL|A Chain A, Structure Of Human Cxcr1 In Phospholipid Bilayers Length = 296 Back     alignment and structure
>pdb|4EJ4|A Chain A, Structure Of The Delta Opioid Receptor Bound To Naltrindole Length = 461 Back     alignment and structure
>pdb|2X72|A Chain A, Crystal Structure Of The Constitutively Active E113q,N2c, D282c Rhodopsin Mutant With Bound Galphact Peptide Length = 349 Back     alignment and structure
>pdb|2J4Y|A Chain A, Crystal Structure Of A Rhodopsin Stabilizing Mutant Expressed In Mammalian Cells Length = 349 Back     alignment and structure
>pdb|3C9M|A Chain A, Structure Of A Mutant Bovine Rhodopsin In Hexagonal Crystal Form Length = 348 Back     alignment and structure
>pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 Back     alignment and structure
>pdb|3OAX|A Chain A, Crystal Structure Of Bovine Rhodopsin With Beta-Ionone Length = 349 Back     alignment and structure
>pdb|1JFP|A Chain A, Structure Of Bovine Rhodopsin (Dark Adapted) Length = 348 Back     alignment and structure
>pdb|4DJH|A Chain A, Structure Of The Human Kappa Opioid Receptor In Complex With Jdtic Length = 480 Back     alignment and structure
>pdb|4A4M|A Chain A, Crystal Structure Of The Light-Activated Constitutively Active N2c,M257y,D282c Rhodopsin Mutant In Complex With A Peptide Resembling The C-Terminus Of The Galpha-Protein Subunit (Gact) Length = 349 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 2e-31
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 2e-30
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 5e-29
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 4e-28
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 5e-28
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 7e-28
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 1e-27
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 2e-27
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 6e-27
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 1e-17
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 4e-17
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 3e-14
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 7e-14
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 8e-13
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 7e-11
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
 Score =  115 bits (290), Expect = 2e-31
 Identities = 30/92 (32%), Positives = 44/92 (47%)

Query: 48  HPISDSTPNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFW 107
                    +++E  AA++L II+  F  CWLP  I    +  C      P  ++ L   
Sbjct: 378 GTWDAYRSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIV 437

Query: 108 TGYFNSSLNPLIYAYFNREFRIAFKKTLQSCC 139
             + NS +NP IYAY  REFR  F+K ++S  
Sbjct: 438 LSHTNSVVNPFIYAYRIREFRQTFRKIIRSHV 469
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
4grv_A510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.88
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.8
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.79
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.78
3vw7_A484 Proteinase-activated receptor 1, lysozyme; high re 99.77
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.76
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 99.76
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 99.74
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.74
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 99.74
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 99.74
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.72
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 99.71
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 99.71
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.71
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.68
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 99.64
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.64
2koe_A40 Human cannabinoid receptor 1 - helix 7/8 peptide; 99.1
2ki9_A33 Cannabinoid receptor 2; GPCR, G-protein coupled re 98.69
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.88  E-value=9.8e-24  Score=168.20  Aligned_cols=94  Identities=24%  Similarity=0.418  Sum_probs=64.9

Q ss_pred             CchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhcCCCCCc------HHHHHHHHHHHHHHhhhhhHHHhhhccHHH
Q psy3689          54 TPNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCST------PRVIVVLVFWTGYFNSSLNPLIYAYFNREF  127 (151)
Q Consensus        54 ~~~~~~~~k~~~~~~~iv~~f~vcw~P~~i~~~~~~~~~~~~~~------~~~~~~~~~~l~~~ns~~NPiiY~~~~~~f  127 (151)
                      ....++++|+++|+++|+++|++||+||+++.++..+.+.....      ..+++.++.+|+|+|||+|||||+++|++|
T Consensus       398 ~~~~~~erk~~k~L~iVv~~F~iCWlPf~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~Y~NS~iNPiIY~~~n~~F  477 (510)
T 4grv_A          398 SGSVQALRHGVLVARAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALAYASSAINPILYNLVSANF  477 (510)
T ss_dssp             TSTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCcccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHH
Confidence            33456789999999999999999999999999998876542221      234567888999999999999999999999


Q ss_pred             HHHHHHHHHHhhcccccCCC
Q psy3689         128 RIAFKKTLQSCCYALILRRS  147 (151)
Q Consensus       128 R~~~~~~~~~~~~~~~~~~~  147 (151)
                      |++|+++++|+|...+.+++
T Consensus       478 R~aFk~iL~C~C~~~r~RR~  497 (510)
T 4grv_A          478 RQVFLSTLACLCPGWRHRRK  497 (510)
T ss_dssp             CCC-----------------
T ss_pred             HHHHHHHHhhcCCCCCCCCc
Confidence            99999999877766555543
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>2koe_A Human cannabinoid receptor 1 - helix 7/8 peptide; GPCR, HCB1, membrane protein, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ki9_A Cannabinoid receptor 2; GPCR, G-protein coupled receptor, membrane protein; NMR {Synthetic} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 151
d1u19a_348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9e-16
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 70.4 bits (171), Expect = 9e-16
 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query: 55  PNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSS 114
              K E++  R + I++ AFL CWLP+                P  + +   +    ++ 
Sbjct: 242 TTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPA-FFAKTSAV 300

Query: 115 LNPLIYAYFNREFRIAFKKTLQSCC 139
            NP+IY   N++FR     TL  CC
Sbjct: 301 YNPVIYIMMNKQFRNCMVTTL--CC 323

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.74
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.74  E-value=1.5e-17  Score=123.61  Aligned_cols=84  Identities=25%  Similarity=0.403  Sum_probs=71.9

Q ss_pred             CCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhcCCCCCcHHHHHHHHHHHHHHhhhhhHHHhhhccHHHHHHH
Q psy3689          52 DSTPNMKRERKAARTLGIIMSAFLACWLPFFIWYLGSSLCGPKCSTPRVIVVLVFWTGYFNSSLNPLIYAYFNREFRIAF  131 (151)
Q Consensus        52 ~~~~~~~~~~k~~~~~~~iv~~f~vcw~P~~i~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fR~~~  131 (151)
                      ......++++|+++++++++++|++||+||.+..++....+. .........++.+++++||++||+||++++++||+++
T Consensus       239 ~~~~~~~~~~~~~~~~~~i~~~f~~~~~P~~i~~~~~~~~~~-~~~~~~~~~~~~~l~~~ns~iNPiIY~~~~~~fR~~~  317 (348)
T d1u19a_         239 ESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQG-SDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCM  317 (348)
T ss_dssp             SSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT-SCCCHHHHHHHHHHGGGGGTHHHHHHHHTCHHHHHHH
T ss_pred             hhhhhHHHHhhHhheEEEeehHHHHHhhHHHhhhheeeccCC-ccccHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHH
Confidence            344556778999999999999999999999998887766554 4455667778888999999999999999999999999


Q ss_pred             HHHHH
Q psy3689         132 KKTLQ  136 (151)
Q Consensus       132 ~~~~~  136 (151)
                      +++++
T Consensus       318 ~~~l~  322 (348)
T d1u19a_         318 VTTLC  322 (348)
T ss_dssp             HHHHT
T ss_pred             HHHhC
Confidence            99994