Psyllid ID: psy3725

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760
MSLLASKAGQEFRVSDEKDARSYLQALTTKTTQELEYLKHASSLGGPGVGTVPGVGGPGDKNWRDRRSQKLEKMELLNLQSSLNSEIQAKTQISEELSKTRSELIAAQKEICDFRLKMESVSMDLRRKDSQLKELQSRLESGDILERPASQISYLDHFLKESRHTGSVESEDGDIEDNRVPSIASSRSNLSELTIDQMNNMLRHDRSSKHHQFITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVPPDQTKRPLGIDPTRGIGTAYEGYVKVPKTGGVKKGWVRQFVVVCDFKLFLYDISPDRNALPAVYVSLVLDMRDEDFAVSGVRESDVIHATKKDIPCIFRITTSLMDPPGTKNHTLMLADSDTEKTKWVVALSELHRILKRNNLPNHTVSTPKIARVGDTKKIYQMDYIPKEQLLVVLAGKQRYVQIARVGDTKKIYQMDYIPEEQLLVVLAGKQRYVRLVPVRALDGDEVEWVKIPETKGCLSFTTGPLTHTRTQHCLALAVKRQNSSQIILYEITRTKTRHKRLHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIPLIHQDNPLVSLLTYSPVDALLAIELPRGEFLLVFHSLAAYVDSQGHKSREKEIMYPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFSLANDIPYVVYLANIHQRELINLMTGGDMRQPRPKRRFSMREGQRAPRAVDTKKSSSPSSSYPI
ccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcEEEEEccccccccccccEEEEEEccccccccccccccccccccccccccccEEEEEccccccccccccEEcccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccccccccccccccccEEEEEEcccccccEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEccccccccccccccccccccEEEEEEEEccccccEEEEEEEEcccccEEEEEEEcccccccEEEEEEEcccccEEEEEccccEEEEEEcccEEEEEccccccccccccccccHHHHccccccccEEEEEEcccEEEEccccEEEEEcccccccccccEEEccccccEEEcccEEEEEEcccEEEEEcccccEEEEEcccccccccccccccccccccccEEEEEEEcccccEEEEcccccccccccccEEEEEEcccccccccccccccccccccc
ccHHHHccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccEccccccEcccccccEEEEcccccEEcHHHHccccccccccHHHcccccccccccccccEEEEEEEcccccccccccEEEEEEEEccEEEEEEcccccccccccEEEEEEEcccccEEEcccccccHHccccccccEEEEEEEccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccccEEEEHHHccccccEEEEEEEccccEEEEEccccEEEEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEHHHcccccccccccccccccEEEEEEEEEcccccEEEEEEEEEcccEEEEEEEcccccccEEEEEEEEcccccEEEEEEcccEEEEEccccEEEEEccccccccHccccccccHHHHHccccccEEEEEEcccEEEEEEcEEEEEEccccccccHHHccccccccEEEEcccEEEEEccccEEEEEcccccEEEEccccccccccccccccccccccccEEEEEEcccccEEEEEccccccEEccccEEEEEEccccccHHcccHccccccccccc
msllaskagqefrvsdEKDARSYLQALTTKTTQELEYLKhasslggpgvgtvpgvggpgdknwrdRRSQKLEKMELLNLQSSLNSEIQAKTQISEELSKTRSELIAAQKEICDFRLKMESVSMDLRRKDSQLKELQSRLesgdilerpasqiSYLDHFLKesrhtgsvesedgdiednrvpsiassrsnlsELTIDQMNNmlrhdrsskhhqfitrtftsptkcnhctslmvgltrqgvvcdicgfachlsccdkvppscpvppdqtkrplgidptrgigtayegyvkvpktggvkkgwVRQFVVVCDFKlflydispdrnalpAVYVSLVLDMrdedfavsgvresdvihatkkdipcifrittslmdppgtknhtlmladsdtekTKWVVALSELHRILkrnnlpnhtvstpkiarvgdtkkiyqmdyipkEQLLVVLAGKQRYVQIARVgdtkkiyqmdyipeEQLLVVLAGKqryvrlvpvraldgdevewvkipetkgclsfttgplthtrTQHCLALAVKRQNSSQIILYEITRTKTRHKRLHEVILPTLAQCIHIFsegrlcvgyqsgfsiykfsqdnrpiplihqdnplvslltyspVDALLAIELPRGEFLLVFHSLAAYVdsqghksrekeimypalptgasymdgqllIFSETHvdvfnaesgdwlqtVNIRralpldtrgsLCFSLANDIPYVVYLANIHQRELInlmtggdmrqprpkrrfsmregqrapravdtkkssspsssypi
msllaskagqefrvsdekdaRSYLQALTTKTTQELEYLKHasslggpgvgtvpgvggpgdknWRDRRSQKLEKMELLNLQSSLNSEIQAKTQISEELSKTRSELIAAQKEICDFRLKMESVSMDLRRKDSQLKELQSrlesgdilerpaSQISYLDHFLKESrhtgsvesedgdiednrvpsiassrsnlsELTIDQMNNMLRHDRSSKHHQFITRtftsptkcnHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVPPDQTKRPLGIDPTRGIGTAYEGYVKvpktggvkkgwvRQFVVVCDFKLFlydispdrnaLPAVYVSLVLDMRDEDFAVsgvresdvihatkkdipcIFRIttslmdppgtKNHTLMLADSDTEKTKWVVALSELHRilkrnnlpnhtvstpkiarvgdtKKIYQMDYIPKEQLLVVLAGKQRYVQIARVGDTKKIYQMDYIPEEQLLVVLAGKQRYVRLVPvraldgdevewvkipetkgclsfTTGPLTHTRTQHCLALavkrqnssqiiLYEITRTKTRHKRLHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIPLIHQDNPLVSLLTYSPVDALLAIELPRGEFLLVFHSLAAYVdsqghksrekEIMYPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFSLANDIPYVVYLANIHQRELInlmtggdmrqprpkrrfsmregqrapravdtkkssspsssypi
MSLLASKAGQEFRVSDEKDARSYLQALTTKTTQELEYLKHASSLggpgvgtvpgvggpgDKNWRDRRSQKLEKMEllnlqsslnsEIQAKTQISEELSKTRSELIAAQKEICDFRLKMESVSMDLRRKDSQLKELQSRLESGDILERPASQISYLDHFLKESRHTGSVESEDGDIEDNRVPSIASSRSNLSELTIDQMNNMLRHDRSSKHHQFITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVPPDQTKRPLGIDPTRGIGTAYEgyvkvpktggvkkgwvRQFVVVCDFKLFLYDISPDRNALPAVYVSLVLDMRDEDFAVSGVRESDVIHATKKDIPCIFRITTSLMDPPGTKNHTLMLADSDTEKTKWVVALSELHRILKRNNLPNHTVSTPKIARVGDTKKIYQMDYIPKEQLLVVLAGKQRYVQIARVGDTKKIYQMDYIPEEQLLVVLAGKQRYVRLVPVRALDGDEVEWVKIPETKGCLSFTTGPLTHTRTQHCLALAVKRQNSSQIILYEITRTKTRHKRLHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIPLIHQDNPLVSLLTYSPVDALLAIELPRGEFLLVFHSLAAYVDSQGHKSREKEIMYPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFSLANDIPYVVYLANIHQRELINLMTGGDMRQPRPKRRFSMREGQRAPRAVDTKKssspsssYPI
************************************************************************************************************KEICDFRL***********************************************************************************************QFITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSC**********LGIDPTRGIGTAYEGYVKVPKTGGVKKGWVRQFVVVCDFKLFLYDISPDRNALPAVYVSLVLDMRDEDFAVSGVRESDVIHATKKDIPCIFRITTSLMD******HTLMLADSDTEKTKWVVALSELHRILKRNNLPNHTVSTPKIARVGDTKKIYQMDYIPKEQLLVVLAGKQRYVQIARVGDTKKIYQMDYIPEEQLLVVLAGKQRYVRLVPVRALDGDEVEWVKIPETKGCLSFTTGPLTHTRTQHCLALAVKRQNSSQIILYEITRTKTRHKRLHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIPLIHQDNPLVSLLTYSPVDALLAIELPRGEFLLVFHSLAAYVDSQ*******EIMYPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFSLANDIPYVVYLANIHQRELINLMT***************************************
**************SDEKDARSYLQALTTK**************************************************************************************************************************************************************************************FITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVP**********************************GWVRQFVVVCDFKLFLYDISPDR******************FA**GVRESDVIHATKKDIPCIFRITTSLMDPPGTKNHTLMLADSDTEKTKWVVALSELHRILKRNNLPNHTVSTPKIARVGDTKKIYQMDYIPKEQLLVVLAGKQRYVQIARVGDTKKIYQMDYIPEEQLLVVLAGKQRYVRLVPVRA***************GCLSFTTGPLTHTRTQHCLALAVKRQNSSQIILYEITRTKTRHKRLHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIPLIHQDNPLVSLLTYSPVDALLAIELPRGEFLLVFHSLAAYVDSQGHKSREKEIMYPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFSLANDIPYVVYLANIHQR**********************************************
*******************ARSYLQALTTKTTQELEYLKHASSLGGPGVGTVPGVGGPGDKNWRDRRSQKLEKMELLNLQSSLNSEIQAKTQISEELSKTRSELIAAQKEICDFRLKMESVSMDLRRKDSQLKELQSRLESGDILERPASQISYLDHFLKES************IEDNRVPSIASSRSNLSELTIDQMNNMLRHDRSSKHHQFITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVPPDQTKRPLGIDPTRGIGTAYEGYVKVPKTGGVKKGWVRQFVVVCDFKLFLYDISPDRNALPAVYVSLVLDMRDEDFAVSGVRESDVIHATKKDIPCIFRITTSLMDPPGTKNHTLMLADSDTEKTKWVVALSELHRILKRNNLPNHTVSTPKIARVGDTKKIYQMDYIPKEQLLVVLAGKQRYVQIARVGDTKKIYQMDYIPEEQLLVVLAGKQRYVRLVPVRALDGDEVEWVKIPETKGCLSFTTGPLTHTRTQHCLALAVKRQNSSQIILYEITRTKTRHKRLHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIPLIHQDNPLVSLLTYSPVDALLAIELPRGEFLLVFHSLAAYVDSQGHKSREKEIMYPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFSLANDIPYVVYLANIHQRELINLMTGGDMRQPRPK*****************************
*S*****AGQEFRVSDEKDARSYLQALTTKTTQELEYLKH********************KNWRDRRSQKLEKMELLNLQSSLNSEIQAKTQISEELSKTRSELIAAQKEICDFRLKMESVSMDLRRKDSQLKELQSRLE********************************************************************KHHQFITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVPPDQTKRPLGIDPTRGIGTAYEGYVKVPKTGGVKKGWVRQFVVVCDFKLFLYDISPDRNALPAVYVSLVLDMRDEDFAVSGVRESDVIHATKKDIPCIFRITTSLMDPPGTKNHTLMLADSDTEKTKWVVALSELHRILKRNNLPNHTVSTPKIARVGDTKKIYQMDYIPKEQLLVVLAGKQRYVQIARVGDTKKIYQMDYIPEEQLLVVLAGKQRYVRLVPVRALDGDEVEWVKIPETKGCLSFTTGPLTHTRTQHCLALAVKRQNSSQIILYEITRTKTRHKRLHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIPLIHQDNPLVSLLTYSPVDALLAIELPRGEFLLVFHSLAAYVDSQGHKSREKEIMYPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFSLANDIPYVVYLANIHQRELINLMTGGDMRQPRPKRRFSMREGQ**********SS**S*S***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLASKAGQEFRVSDEKDARSYLQALTTKTTQELEYLKHASSLGGPGVGTVPGVGGPGDKNWRDRRSQKLEKMELLNLQSSLNSEIQAxxxxxxxxxxxxxxxxxxxxxICDFRLKxxxxxxxxxxxxxxxxxxxxxLESGDILERPASQISYLDHFLKESRHTGSVESEDGDIEDNRVPSIASSRSNLSELTIDQMNNMLRHDRSSKHHQFITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVPPDQTKRPLGIDPTRGIGTAYEGYVKVPKTGGVKKGWVRQFVVVCDFKLFLYDISPDRNALPAVYVSLVLDMRDEDFAVSGVRESDVIHATKKDIPCIFRITTSLMDPPGTKNHTLMLADSDTEKTKWVVALSELHRILKRNNLPNHTVSTPKIARVGDTKKIYQMDYIPKEQLLVVLAGKQRYVQIARVGDTKKIYQMDYIPEEQLLVVLAGKQRYVRLVPVRALDGDEVEWVKIPETKGCLSFTTGPLTHTRTQHCLALAVKRQNSSQIILYEITRTKTRHKRLHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIPLIHQDNPLVSLLTYSPVDALLAIELPRGEFLLVFHSLAAYVDSQGHKSREKEIMYPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFSLANDIPYVVYLANIHQRELINLMTGGDMRQPRPKRRFSMREGQRAPRAVDTKKSSSPSSSYPI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query760 2.2.26 [Sep-21-2011]
Q9W1B01637 Serine/threonine-protein yes N/A 0.881 0.409 0.456 0.0
Q3UU96 1719 Serine/threonine-protein yes N/A 0.867 0.383 0.388 1e-148
Q5VT25 1732 Serine/threonine-protein no N/A 0.868 0.381 0.387 1e-148
O54874 1732 Serine/threonine-protein yes N/A 0.875 0.383 0.387 1e-148
Q7TT50 1713 Serine/threonine-protein no N/A 0.925 0.410 0.389 1e-143
Q9Y5S2 1711 Serine/threonine-protein no N/A 0.909 0.403 0.385 1e-143
Q7TT49 1713 Serine/threonine-protein no N/A 0.925 0.410 0.383 1e-143
Q80UW5 1551 Serine/threonine-protein no N/A 0.886 0.434 0.326 1e-94
Q6DT37 1551 Serine/threonine-protein no N/A 0.897 0.439 0.335 6e-90
P490252055 Citron Rho-interacting ki no N/A 0.644 0.238 0.217 5e-17
>sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 Back     alignment and function desciption
 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/821 (45%), Positives = 508/821 (61%), Gaps = 151/821 (18%)

Query: 14   VSDEKDARSYLQALTTKTTQELEYLKHASSLGGPGVGTVPGVGGPGDKNWRDRRSQKLEK 73
            VSDEKDAR YLQAL TK T+ELEYLKH  +    GV          +KNWR+RRSQKL+K
Sbjct: 767  VSDEKDARGYLQALATKMTEELEYLKHVGTFNNNGVD---------NKNWRNRRSQKLDK 817

Query: 74   MELLNLQSSLNSEIQAKTQISEELSKTRSELIAAQKEICDFRLKMESVSMDLRRKDSQLK 133
            MELLNLQS+L  EIQAK  IS+ELS+TRS+LI+ QKE+ D++ + +S+  D ++K+++L+
Sbjct: 818  MELLNLQSALQREIQAKNMISDELSQTRSDLISTQKEVRDYKKRYDSILHDFQKKETELR 877

Query: 134  ELQSRLESGDILERPASQISYLDHFLKESRHTG-----------------SVESEDGDIE 176
            +LQ               + Y + FL +S H G                 S ES   +  
Sbjct: 878  DLQK------------GGLEYSESFLNKSTHHGLSSAFFRDMSKNSEIIDSAESFGNESG 925

Query: 177  DNRVPSIASS-------------------------RSNLSELTIDQMNNMLRHDR----- 206
            DN  P+   S                          +++S+L+ ++ + +++  +     
Sbjct: 926  DNFTPNFFQSGNSGMLFNYEPKYAGKNNKDHSSMKEASVSDLSREESDQLVKESQKKVPG 985

Query: 207  SSKHHQFITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVPPDQ 266
            ++  HQF+ RTF+SPTKCNHCTSLMVGLTRQGVVC+ICGFACH  CC KVP +CPVP DQ
Sbjct: 986  NTAIHQFLVRTFSSPTKCNHCTSLMVGLTRQGVVCEICGFACHTICCQKVPTTCPVPMDQ 1045

Query: 267  TKRPLGIDPTRGIGTAYEGYVKVPKTGGVKKGWVRQFVVVCDFKLFLYDISPDRNALPAV 326
            TKRPLGIDPTRGIGTAYEGYVKVPK+G +K+GW+RQFVVVCDFKLFLYDISPDR ALP+V
Sbjct: 1046 TKRPLGIDPTRGIGTAYEGYVKVPKSGVIKRGWIRQFVVVCDFKLFLYDISPDRCALPSV 1105

Query: 327  YVSLVLDMRDEDFAVSGVRESDVIHATKKDIPCIFRITTSLMDPPGTKNHTLMLADSDTE 386
             VS VLDMRD +F+V  VRESDVIHA KKD+PCIF+I T+L+D  G   +TLMLAD+++E
Sbjct: 1106 SVSQVLDMRDPEFSVGSVRESDVIHAAKKDVPCIFKIKTALID-GGLSLNTLMLADNESE 1164

Query: 387  KTKWVVALSELHRILKRNNLPNHTV----------------------------------- 411
            K+KWV+AL ELHRILKRN+LPN  +                                   
Sbjct: 1165 KSKWVIALGELHRILKRNSLPNTAIFKVNEILDNTLSLIRNALCSVIIYPNQILLGTEDG 1224

Query: 412  ------STPKIARVGDTKKIYQMDYIPKEQLLVVLAGKQRYVQIARVGDTKKIYQMDYIP 465
                     +IAR+G++KKI Q+ YI +EQ+LV+L G                       
Sbjct: 1225 LFYINLDQYEIARIGESKKILQLWYIEEEQILVILCG----------------------- 1261

Query: 466  EEQLLVVLAGKQRYVRLVPVRALDGDEVEWVKIPETKGCLSFTTGPLTHT-RTQHCLALA 524
                      KQR +RL+P+RAL+  +VEW+K+ E+K C+S  TG +       +   +A
Sbjct: 1262 ----------KQRNLRLLPIRALEASDVEWIKVVESKNCISACTGIIRRFPNIVYSFIIA 1311

Query: 525  VKR-QNSSQIILYEITRTKTRHKRLHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQ 583
            +KR  N +QI++YEI RT+TRH++  E  +  +AQ + I S+ RL V +QSGF+ Y    
Sbjct: 1312 LKRPNNHTQIVVYEINRTRTRHQKTCEFTIGYMAQHLQILSDMRLVVAHQSGFTAYFLRG 1371

Query: 584  DNRPIPLIHQDNPLVSLLTYSPVDALLAIEL------PRGEFLLVFHSLAAYVDSQGHKS 637
            +   + L+H +N L + L YS VDA+  IE+        GE+LLVF +LA YVD QG KS
Sbjct: 1372 EATAMSLVHPENQLCAFLNYSGVDAVRVIEILCPSGGNFGEYLLVFQTLAIYVDLQGRKS 1431

Query: 638  REKEIMYPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFS 697
            R++EIMYPA PT  ++ DG LL+FS+TH+D+FN ++ +W+Q++ ++++LPL+  G++  S
Sbjct: 1432 RDREIMYPAFPTYITFCDGHLLVFSDTHLDIFNTQTAEWVQSIGLKQSLPLNNLGNVVLS 1491

Query: 698  LANDIPYVVYLANIHQRELINLMTGGDMRQPRPKRRFSMRE 738
              ND P +VYL+NIH + L+    G     P  KRRFS+RE
Sbjct: 1492 SVNDTPLIVYLSNIHTKGLLQYRDGNRKGLPSIKRRFSIRE 1532
Acts as a downstream effector for the regulation of actin polymerization by Cdc42.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 Back     alignment and function description
>sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 Back     alignment and function description
>sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 Back     alignment and function description
>sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 Back     alignment and function description
>sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 Back     alignment and function description
>sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 Back     alignment and function description
>sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=2 SV=2 Back     alignment and function description
>sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 Back     alignment and function description
>sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
307208423 1790 Serine/threonine-protein kinase Genghis 0.926 0.393 0.608 0.0
242024080 1772 serine/threonine-protein kinase MRCK bet 0.921 0.395 0.603 0.0
383852179 1796 PREDICTED: serine/threonine-protein kina 0.926 0.391 0.605 0.0
328786255 1794 PREDICTED: serine/threonine-protein kina 0.923 0.391 0.608 0.0
350412784 1794 PREDICTED: serine/threonine-protein kina 0.926 0.392 0.600 0.0
340710704 1794 PREDICTED: serine/threonine-protein kina 0.926 0.392 0.600 0.0
380014819 1953 PREDICTED: serine/threonine-protein kina 0.923 0.359 0.605 0.0
345487692 1797 PREDICTED: serine/threonine-protein kina 0.925 0.391 0.591 0.0
328704663 1635 PREDICTED: serine/threonine-protein kina 0.915 0.425 0.555 0.0
328704661 1675 PREDICTED: serine/threonine-protein kina 0.915 0.415 0.555 0.0
>gi|307208423|gb|EFN85802.1| Serine/threonine-protein kinase Genghis Khan [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  976 bits (2523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/807 (60%), Positives = 600/807 (74%), Gaps = 103/807 (12%)

Query: 14   VSDEKDARSYLQALTTKTTQELEYLKHASSLGGPGVGTVPGVGGPGDKNWRDRRSQKLEK 73
            VSDEKDAR YLQAL TK T+ELE+LKH+       VG V       DKNWR+RRSQKL+K
Sbjct: 844  VSDEKDARGYLQALATKMTEELEFLKHSGG-----VGGVGSGTTMADKNWRNRRSQKLDK 898

Query: 74   MELLNLQSSLNSEIQAKTQISEELSKTRSELIAAQKEICDFRLKMESVSMDLRRKDSQLK 133
            MELLNLQSSL SEIQAK  ISEEL+KTRS+LIA+QKE+ DF+ +++++S +L+RKD Q+K
Sbjct: 899  MELLNLQSSLQSEIQAKQAISEELTKTRSDLIASQKELRDFKQRLDTMSHELKRKDMQVK 958

Query: 134  ELQSRLESGD-ILERPASQISYLDHFLKES----RHTGSVESEDGDIEDNRVPSIASSRS 188
            ELQ+RL++GD  LERP SQ+SYL+HFLKE+    RH GSV+S +GDIEDNR PSI SS+S
Sbjct: 959  ELQARLDTGDGFLERPTSQMSYLEHFLKETTSSTRH-GSVDSVEGDIEDNRAPSITSSKS 1017

Query: 189  NLSELTIDQ---MNNMLRHDRSSKH-----------HQFITRTFTSPTKCNHCTSLMVGL 234
            NLSEL+ID    +++ L +  SS H           HQF+ RTF++PTKCNHCTSLMVGL
Sbjct: 1018 NLSELSIDPTSPLSHELLNKSSSSHGQANLQPKPKSHQFLVRTFSAPTKCNHCTSLMVGL 1077

Query: 235  TRQGVVCDICGFACHLSCCDKVPPSCPVPPDQTKRPLGIDPTRGIGTAYEGYVKVPKTGG 294
            TRQGVVC++CGFACH+ CCDKVPP CPVP DQTKRPLGIDPTRGIGTAYEGYVKVPK GG
Sbjct: 1078 TRQGVVCEVCGFACHMPCCDKVPPMCPVPHDQTKRPLGIDPTRGIGTAYEGYVKVPKMGG 1137

Query: 295  VKKGWVRQFVVVCDFKLFLYDISPDRNALPAVYVSLVLDMRDEDFAVSGVRESDVIHATK 354
            VKKGWVRQFVVVCDFKLFLYDISPDRNALP+VYVS VLDMRDE+F+VS VR+SDVIHATK
Sbjct: 1138 VKKGWVRQFVVVCDFKLFLYDISPDRNALPSVYVSQVLDMRDEEFSVSSVRDSDVIHATK 1197

Query: 355  KDIPCIFRITTSLMDPPGTKNHTLMLADSDTEKTKWVVALSELHRILKRNNLPNHTVSTP 414
            KDIPCIFRITTSL++PPG +NHTLMLAD+++EKTKWVVALSELHRILKRNNLPN T+   
Sbjct: 1198 KDIPCIFRITTSLLEPPGLRNHTLMLADTESEKTKWVVALSELHRILKRNNLPNTTIFRA 1257

Query: 415  K-----------------------------------------IARVGDTKKIYQMDYIPK 433
            K                                         IARVG+ KKIY ++Y+ +
Sbjct: 1258 KELLDNTLAFIKNVMSGAIIDPDRLVIGTEEGLFCLDLDRSEIARVGEGKKIYLLEYVTE 1317

Query: 434  EQLLVVLAGKQRYVQIARVGDTKKIYQMDYIPEEQLLVVLAGKQRYVRLVPVRALDGDEV 493
            EQL+VVL+GK                                 QR+VRLVPVRALDGDEV
Sbjct: 1318 EQLIVVLSGK---------------------------------QRHVRLVPVRALDGDEV 1344

Query: 494  EWVKIPETKGCLSFTTGPLTHTRTQHCLALAVKRQNSSQIILYEITRTKTRHKRLHEVIL 553
            EW+K+ ETKGC++ TTG +      +CL +A+K+Q+ SQ+I+YEITRTKTRHKR+ E++L
Sbjct: 1345 EWIKVAETKGCITLTTGVVRRNPLTYCLCVAIKKQSVSQVIIYEITRTKTRHKRIRELML 1404

Query: 554  PTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIPLIHQDNPLVSLLTYSPVDALLAIE 613
            P LAQ + + SEGRLCVGYQSGFSIY    D+ PI L+H +N L+  LTYS VDAL  IE
Sbjct: 1405 PCLAQTLQVLSEGRLCVGYQSGFSIYSILGDHHPISLVHAENTLLGFLTYSAVDALRCIE 1464

Query: 614  LPRGEFLLVFHSLAAYVDSQGHKSREKEIMYPALPTGASYMDGQLLIFSETHVDVFNAES 673
            L RGEFLLVFH+LA YVDSQG K+R++E+MYPA+PT  SY +G LL++SETH+DVF+  S
Sbjct: 1465 LARGEFLLVFHTLAVYVDSQGRKNRDREMMYPAVPTAVSYCEGYLLVYSETHIDVFDCTS 1524

Query: 674  GDWLQTVNIRRALPLDTRGSLCFSLANDIPYVVYLANIHQRELINL--MTGGDMRQPRPK 731
            GDWLQT+N++RA PL+  GSL   + ND+P+V+YL+N+HQREL+N+  +     +  RP+
Sbjct: 1525 GDWLQTLNVKRARPLNVSGSLTSCVINDMPHVIYLSNLHQRELLNITPLDASGRQMTRPR 1584

Query: 732  RRFSMREGQRAPRAVD--TKKSSSPSS 756
            RRFS+REG RA R  D  +K  S+P++
Sbjct: 1585 RRFSLREGNRAVRPTDRRSKMISAPTN 1611

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242024080|ref|XP_002432458.1| serine/threonine-protein kinase MRCK beta, putative [Pediculus humanus corporis] gi|212517891|gb|EEB19720.1| serine/threonine-protein kinase MRCK beta, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383852179|ref|XP_003701606.1| PREDICTED: serine/threonine-protein kinase MRCK alpha-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328786255|ref|XP_395596.4| PREDICTED: serine/threonine-protein kinase Genghis Khan [Apis mellifera] Back     alignment and taxonomy information
>gi|350412784|ref|XP_003489761.1| PREDICTED: serine/threonine-protein kinase Genghis Khan-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340710704|ref|XP_003393926.1| PREDICTED: serine/threonine-protein kinase Genghis Khan-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380014819|ref|XP_003691414.1| PREDICTED: serine/threonine-protein kinase Genghis Khan-like [Apis florea] Back     alignment and taxonomy information
>gi|345487692|ref|XP_003425741.1| PREDICTED: serine/threonine-protein kinase Genghis Khan [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328704663|ref|XP_003242560.1| PREDICTED: serine/threonine-protein kinase Genghis Khan-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328704661|ref|XP_001945916.2| PREDICTED: serine/threonine-protein kinase Genghis Khan-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
FB|FBgn00230811637 gek "genghis khan" [Drosophila 0.723 0.335 0.511 6.5e-177
UNIPROTKB|E1BWT5 1732 CDC42BPA "Uncharacterized prot 0.918 0.403 0.396 2.7e-132
UNIPROTKB|H0Y6V3728 CDC42BPA "Serine/threonine-pro 0.647 0.675 0.444 2.9e-131
UNIPROTKB|F5H5N0 1699 CDC42BPA "Serine/threonine-pro 0.8 0.357 0.390 5.3e-130
RGD|621406 1732 Cdc42bpa "CDC42 binding protei 0.919 0.403 0.393 7.3e-130
UNIPROTKB|O54874 1732 Cdc42bpa "Serine/threonine-pro 0.919 0.403 0.393 7.3e-130
UNIPROTKB|Q5VT25 1732 CDC42BPA "Serine/threonine-pro 0.919 0.403 0.389 2.5e-129
UNIPROTKB|F1S8P5 1646 LOC100739027 "Uncharacterized 0.911 0.421 0.393 1.1e-128
UNIPROTKB|F1NUB2 1660 CDC42BPA "Uncharacterized prot 0.859 0.393 0.394 1.1e-124
UNIPROTKB|H0Y5V1 1048 CDC42BPA "Serine/threonine-pro 0.932 0.676 0.373 1e-123
FB|FBgn0023081 gek "genghis khan" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1440 (512.0 bits), Expect = 6.5e-177, Sum P(2) = 6.5e-177
 Identities = 294/575 (51%), Positives = 394/575 (68%)

Query:   185 SSRSNLSELTIDQM--NNMLRHDRSSKHHQFITRTFTSPTKCNHCTSLMVGLTRQGVVCD 242
             +S S+LS    DQ+   +  +   ++  HQF+ RTF+SPTKCNHCTSLMVGLTRQGVVC+
Sbjct:   962 ASVSDLSREESDQLVKESQKKVPGNTAIHQFLVRTFSSPTKCNHCTSLMVGLTRQGVVCE 1021

Query:   243 ICGFACHLSCCDKVPPSCPVPPDQTKRPLGIDPTRGIGTAYEXXXXXXXXXXXXXXXXRQ 302
             ICGFACH  CC KVP +CPVP DQTKRPLGIDPTRGIGTAYE                RQ
Sbjct:  1022 ICGFACHTICCQKVPTTCPVPMDQTKRPLGIDPTRGIGTAYEGYVKVPKSGVIKRGWIRQ 1081

Query:   303 FVVVCDFKLFLYDISPDRNALPAVYVSLVLDMRDEDFAVSGVRESDVIHATKKDIPCIFR 362
             FVVVCDFKLFLYDISPDR ALP+V VS VLDMRD +F+V  VRESDVIHA KKD+PCIF+
Sbjct:  1082 FVVVCDFKLFLYDISPDRCALPSVSVSQVLDMRDPEFSVGSVRESDVIHAAKKDVPCIFK 1141

Query:   363 ITTSLMDPPGTKNHTLMLADSDTEKTKWVVALSELHRILKRNNLPNHTVSTPKIARVGDT 422
             I T+L+D  G   +TLMLAD+++EK+KWV+AL ELHRILKRN+LPN  +   K+  + D 
Sbjct:  1142 IKTALIDG-GLSLNTLMLADNESEKSKWVIALGELHRILKRNSLPNTAIF--KVNEILDN 1198

Query:   423 ------KKIYQMDYIPKEQLLVVLAGK-----QRYVQIARVGDTKKIYQMDYIPEEQLLV 471
                     +  +   P + LL    G       +Y +IAR+G++KKI Q+ YI EEQ+LV
Sbjct:  1199 TLSLIRNALCSVIIYPNQILLGTEDGLFYINLDQY-EIARIGESKKILQLWYIEEEQILV 1257

Query:   472 VLAGKQRYVRLVPVRALDGDEVEWVKIPETKGCLSFTTGPLTH-TRTQHCLALAVKRQNS 530
             +L GKQR +RL+P+RAL+  +VEW+K+ E+K C+S  TG +       +   +A+KR N+
Sbjct:  1258 ILCGKQRNLRLLPIRALEASDVEWIKVVESKNCISACTGIIRRFPNIVYSFIIALKRPNN 1317

Query:   531 -SQIILYEITRTKTRHKRLHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIP 589
              +QI++YEI RT+TRH++  E  +  +AQ + I S+ RL V +QSGF+ Y    +   + 
Sbjct:  1318 HTQIVVYEINRTRTRHQKTCEFTIGYMAQHLQILSDMRLVVAHQSGFTAYFLRGEATAMS 1377

Query:   590 LIHQDNPLVSLLTYSPVDALLAIEL--PRG----EFLLVFHSLAAYVDSQGHKSREKEIM 643
             L+H +N L + L YS VDA+  IE+  P G    E+LLVF +LA YVD QG KSR++EIM
Sbjct:  1378 LVHPENQLCAFLNYSGVDAVRVIEILCPSGGNFGEYLLVFQTLAIYVDLQGRKSRDREIM 1437

Query:   644 YPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFSLANDIP 703
             YPA PT  ++ DG LL+FS+TH+D+FN ++ +W+Q++ ++++LPL+  G++  S  ND P
Sbjct:  1438 YPAFPTYITFCDGHLLVFSDTHLDIFNTQTAEWVQSIGLKQSLPLNNLGNVVLSSVNDTP 1497

Query:   704 YVVYLANIHQRELINLMTGGDMRQPRPKRRFSMRE 738
              +VYL+NIH + L+    G     P  KRRFS+RE
Sbjct:  1498 LIVYLSNIHTKGLLQYRDGNRKGLPSIKRRFSIRE 1532
GO:0004672 "protein kinase activity" evidence=IDA
GO:0008154 "actin polymerization or depolymerization" evidence=IMP
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS;NAS
GO:0008064 "regulation of actin polymerization or depolymerization" evidence=NAS
GO:0019992 "diacylglycerol binding" evidence=ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS;NAS
GO:0005543 "phospholipid binding" evidence=IEA
GO:0031532 "actin cytoskeleton reorganization" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0005083 "small GTPase regulator activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0030426 "growth cone" evidence=IDA
GO:0030424 "axon" evidence=IDA
GO:0008039 "synaptic target recognition" evidence=IMP
UNIPROTKB|E1BWT5 CDC42BPA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y6V3 CDC42BPA "Serine/threonine-protein kinase MRCK alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H5N0 CDC42BPA "Serine/threonine-protein kinase MRCK alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|621406 Cdc42bpa "CDC42 binding protein kinase alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O54874 Cdc42bpa "Serine/threonine-protein kinase MRCK alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VT25 CDC42BPA "Serine/threonine-protein kinase MRCK alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8P5 LOC100739027 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUB2 CDC42BPA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y5V1 CDC42BPA "Serine/threonine-protein kinase MRCK alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
cd01243136 cd01243, PH_MRCK, MRCK (myotonic dystrophy-related 7e-79
pfam00780266 pfam00780, CNH, CNH domain 6e-48
pfam0013053 pfam00130, C1_1, Phorbol esters/diacylglycerol bin 2e-16
smart00036302 smart00036, CNH, Domain found in NIK1-like kinases 2e-16
cd0002950 cd00029, C1, Protein kinase C conserved region 1 ( 4e-16
smart0010950 smart00109, C1, Protein kinase C conserved region 1e-13
cd01242126 cd01242, PH_ROCK, Rho-associated coiled-coil conta 5e-09
COG54221175 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange 6e-09
pfam00169101 pfam00169, PH, PH domain 1e-07
smart00233102 smart00233, PH, Pleckstrin homology domain 4e-07
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 2e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 0.002
pfam0882661 pfam08826, DMPK_coil, DMPK coiled coil domain like 0.003
>gnl|CDD|241276 cd01243, PH_MRCK, MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information 
 Score =  248 bits (636), Expect = 7e-79
 Identities = 100/136 (73%), Positives = 111/136 (81%), Gaps = 1/136 (0%)

Query: 270 PLGIDPTRGIGTAYEGYVKVPKTGGVKKGWVRQFVVVCDFKLFLYDISPDRNALPAVYVS 329
           PLGIDPTRGIGTAYEGYVKVPK GGVKKGW RQF VVCDFKLFLYDIS D+N  P+V  S
Sbjct: 1   PLGIDPTRGIGTAYEGYVKVPKPGGVKKGWQRQFAVVCDFKLFLYDISEDKNPQPSVVAS 60

Query: 330 LVLDMRDEDFAVSGVRESDVIHATKKDIPCIFRITTSLMDPPG-TKNHTLMLADSDTEKT 388
            VLDMRDE+F+VS V ESDVIHA KKDIPCIFR+T S +  P   K+  L+LADS+ EK 
Sbjct: 61  QVLDMRDEEFSVSSVLESDVIHANKKDIPCIFRVTASQLHAPLLLKSSQLLLADSEAEKQ 120

Query: 389 KWVVALSELHRILKRN 404
           KWV AL ELHR+LK+N
Sbjct: 121 KWVGALKELHRLLKKN 136

MRCK is thought to be coincidence detector of signaling by Cdc42 and phosphoinositides. It has been shown to promote cytoskeletal reorganization, which affects many biological processes. There are 2 members of this family: MRCKalpha and MRCKbeta. MRCK consists of a serine/threonine kinase domain, a cysteine rich (C1) region, a PH domain and a p21 binding motif. The MRCK PH domain is responsible for its targeting to cell to cell junctions. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 136
>gnl|CDD|216115 pfam00780, CNH, CNH domain Back     alignment and domain information
>gnl|CDD|215738 pfam00130, C1_1, Phorbol esters/diacylglycerol binding domain (C1 domain) Back     alignment and domain information
>gnl|CDD|214481 smart00036, CNH, Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>gnl|CDD|237996 cd00029, C1, Protein kinase C conserved region 1 (C1) Back     alignment and domain information
>gnl|CDD|197519 smart00109, C1, Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) Back     alignment and domain information
>gnl|CDD|241275 cd01242, PH_ROCK, Rho-associated coiled-coil containing protein kinase pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|227709 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|117396 pfam08826, DMPK_coil, DMPK coiled coil domain like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 760
KOG0612|consensus1317 100.0
COG54221175 ROM1 RhoGEF, Guanine nucleotide exchange factor fo 100.0
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 100.0
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 100.0
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 100.0
KOG4305|consensus1029 100.0
KOG0976|consensus1265 99.98
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 99.96
KOG0976|consensus1265 99.91
KOG2063|consensus 877 99.75
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 99.74
KOG0696|consensus683 99.6
KOG0576|consensus829 99.49
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 99.18
KOG4236|consensus888 99.14
cd0002950 C1 Protein kinase C conserved region 1 (C1) . Cyst 98.91
KOG1011|consensus 1283 98.87
smart0010949 C1 Protein kinase C conserved region 1 (C1) domain 98.76
KOG4236|consensus 888 98.72
KOG0696|consensus683 98.7
KOG0695|consensus593 98.69
KOG0587|consensus953 98.64
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 98.5
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 98.46
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 98.4
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 98.39
KOG0694|consensus694 98.39
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 98.38
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 98.33
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 98.26
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 98.26
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 98.24
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 98.2
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 98.19
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 98.18
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 98.17
KOG1090|consensus1732 98.14
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 98.11
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 98.08
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 98.05
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 97.99
KOG4239|consensus348 97.98
KOG0694|consensus694 97.84
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 97.83
KOG3564|consensus604 97.82
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 97.79
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 97.75
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 97.7
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 97.69
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 97.66
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 97.65
KOG2996|consensus865 97.44
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 97.41
KOG0193|consensus678 97.23
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 97.18
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 97.09
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 97.0
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 96.91
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 96.82
KOG0930|consensus395 96.63
KOG0612|consensus1317 96.26
KOG0291|consensus 893 96.11
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.09
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 95.94
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 95.21
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 94.99
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 94.61
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 94.55
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 94.29
PF1540989 PH_8: Pleckstrin homology domain 94.11
PF0310730 C1_2: C1 domain; InterPro: IPR004146 This short do 93.57
KOG2114|consensus 933 93.17
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 92.73
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 92.55
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 92.28
KOG4378|consensus 673 92.09
KOG1453|consensus918 91.4
KOG0294|consensus362 91.1
PRK11028330 6-phosphogluconolactonase; Provisional 90.82
KOG3640|consensus1116 90.78
KOG0291|consensus 893 90.33
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 89.93
KOG1169|consensus634 89.12
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 89.1
KOG0296|consensus399 88.93
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 88.92
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 88.72
PF15404185 PH_4: Pleckstrin homology domain 88.63
PTZ00420 568 coronin; Provisional 88.33
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 88.32
KOG1273|consensus405 87.76
KOG3751|consensus622 87.73
KOG2315|consensus 566 87.56
KOG2048|consensus 691 86.97
COG3883265 Uncharacterized protein conserved in bacteria [Fun 86.91
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 86.24
KOG0690|consensus516 86.18
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 85.65
KOG2048|consensus691 85.36
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 84.98
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 84.71
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 84.61
KOG0289|consensus506 84.44
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 83.6
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 83.4
KOG0292|consensus 1202 83.14
COG4026290 Uncharacterized protein containing TOPRIM domain, 82.7
PF14727418 PHTB1_N: PTHB1 N-terminus 82.52
KOG1274|consensus 933 82.44
KOG2445|consensus361 82.42
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 82.39
KOG0310|consensus487 82.13
KOG0266|consensus456 81.97
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 81.86
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 81.68
PF15406112 PH_6: Pleckstrin homology domain 81.44
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 80.96
KOG0279|consensus315 80.68
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 80.43
>KOG0612|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.8e-56  Score=517.89  Aligned_cols=595  Identities=23%  Similarity=0.279  Sum_probs=469.8

Q ss_pred             hhhhhhhhhccchhHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCCcCCCCCCCCCCcccchhhHHHHHHHhhhHHHHH
Q psy3725           5 ASKAGQEFRVSDEKDARSYLQALTTKTTQELEYLKHASSLGGPGVGTVPGVGGPGDKNWRDRRSQKLEKMELLNLQSSLN   84 (760)
Q Consensus         5 ~~~~~i~qwv~dek~ar~ylq~la~k~~~ele~lr~~~~~~~~~~~~~~~~~~~~~~~w~~rr~~k~~~~~~l~lqsal~   84 (760)
                      +.++||++||+|||+||+|+++|+++|++|+|+||+.           +.++  ....|+.||++++++++.++||++|+
T Consensus       700 ~~~~e~~~~lseek~ar~k~e~~~~~i~~e~e~L~~d-----------~~~~--~~~~~~l~r~~~~~~~~vl~Lq~~LE  766 (1317)
T KOG0612|consen  700 AQMKEIESKLSEEKSAREKAENLLLEIEAELEYLSND-----------YKQS--QEKLNELRRSKDQLITEVLKLQSMLE  766 (1317)
T ss_pred             HHHHHHHHHhcccccHHHHHHHHHHHHHHHHHHHhhh-----------hhhh--ccchhhhhhhHHHHHHHHHHHHHHHH
Confidence            6789999999999999999999999999999999998           2233  37889999999999999999999999


Q ss_pred             HHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHhhhHHHHHHHHhhhccCC-CC-CCCCccccccccccccc
Q psy3725          85 SEIQAKTQISEELSKTRSELIAAQKEICDFRLKMESVSMDLRRKDSQLKELQSRLESGD-IL-ERPASQISYLDHFLKES  162 (760)
Q Consensus        85 ~Ei~akq~i~eeL~k~~~~~~~~e~~l~e~e~~~~~l~~e~~~l~~e~~~l~~~~~~g~-~~-~~~~s~~~~~~~~~~~~  162 (760)
                      +||+||+.++.||+ ++++++++    +.+|+|++++..++..+|+++++ +.....|. .+ .+++.   .+.+.+...
T Consensus       767 qe~~~r~~~~~eLs-sq~~~~~t----~~~Ekq~~~~~~~l~~~K~~~e~-~~~q~~~~~~~~~~~~k---~lq~~leae  837 (1317)
T KOG0612|consen  767 QEISKRLSLQRELK-SQEQEVNT----KMLEKQLKKLLDELAELKKQLEE-ENAQLRGLNRSAWGQMK---ELQDQLEAE  837 (1317)
T ss_pred             HHHHHhhhhHHHhh-hHHHhhcc----HHHHHHHHHHHHHHHHHHHHHHH-HHHHhhcccccchhhhH---HHHHHHHHH
Confidence            99999999999999 99999988    88999999999999999888876 32334444 11 12221   222222111


Q ss_pred             ccccc---ccCCCC--CCCCC-CCCCc--ccccCCCcccccccccccccCCCCCCCceeEEeeecCCcccCCCccccccc
Q psy3725         163 RHTGS---VESEDG--DIEDN-RVPSI--ASSRSNLSELTIDQMNNMLRHDRSSKHHQFITRTFTSPTKCNHCTSLMVGL  234 (760)
Q Consensus       163 ~~~~~---~~~~~~--~~~~~-~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~H~F~~~~f~~pt~C~~C~~~i~Gl  234 (760)
                      ..++.   .+..+.  ..++. +++--  ...+.+.|.--..+....-..+.....|.|....+..|      ++.+.|.
T Consensus       838 ~~~~~~~ktq~~e~~e~~~ek~~~~~~er~~~~~Q~~~~~~~~~~~~la~~~ee~~~el~~e~~~~~------t~~~~g~  911 (1317)
T KOG0612|consen  838 QCFSSLMKTQIIEDREEIAEKNQSLQAERMLLPKQVEQAVTKADSEQLARSLEERIEELEQEKISKK------TKDVLGL  911 (1317)
T ss_pred             HHHHHHHHhhhhhhhhhhhhcccchhhhhhhcchhcchhhchhhhHHHhhhhhhHHHHHHHHHhhhh------HHHHHHH
Confidence            10000   000000  00000 00000  00000100000000000001112567899999988888      4567899


Q ss_pred             ccCeeeecCCCcccccccccccCCCCCCCccCCCCCCCCCCCCCCCcceeeeeecccccccccceEEEEEEEeCcEEEEE
Q psy3725         235 TRQGVVCDICGFACHLSCCDKVPPSCPVPPDQTKRPLGIDPTRGIGTAYEGYVKVPKTGGVKKGWVRQFVVVCDFKLFLY  314 (760)
Q Consensus       235 ~rQG~~C~~C~~~cH~kC~~~vp~~C~~p~~~~~~~~~id~~~~~Gt~~eG~vkvp~~~~~kkgw~r~~~~l~~~kL~~y  314 (760)
                      .|||+.|.+|.+.||..|...++..|++++.+..++++.            ++++++.+++++                 
T Consensus       912 hRqe~~~k~~t~ac~~e~~~~l~q~~~i~~~E~e~~~~~------------~~k~~~~~~~~~-----------------  962 (1317)
T KOG0612|consen  912 HRQELTCKDCTLACLEETNRTLTQKCKLLSEEKERLLGK------------HKKVQEEGVVLK-----------------  962 (1317)
T ss_pred             HHHHHHHHHHhHHHHHHHHHHhhhhcCCchhhhhhhhhh------------hhhccchhhhhh-----------------
Confidence            999999999999999999999999999998887777554            678888877665                 


Q ss_pred             ecCCCCCCCCccceeEEeecCCCCeEEEeeccCcccccCCCccceeeeeecccCCCCCCcceEEEeeCCHHHHHHHHHHH
Q psy3725         315 DISPDRNALPAVYVSLVLDMRDEDFAVSGVRESDVIHATKKDIPCIFRITTSLMDPPGTKNHTLMLADSDTEKTKWVVAL  394 (760)
Q Consensus       315 d~~~~~~~~p~~~~~~~ldl~d~~fsV~~V~~sdvi~a~~~dip~if~it~s~l~~~~~~~~l~LlA~S~~ek~kWv~~L  394 (760)
                           +       .+.++  ||.+|++.+|+++|||||+.+|+|+||+++.+.+..+.. .+.+.|+.++.||+| +.+|
T Consensus       963 -----~-------~~i~~--~d~efs~~~~~e~~v~~aa~~kl~eif~r~~~~i~~~~~-~~t~~l~kkE~EkrK-v~~L 1026 (1317)
T KOG0612|consen  963 -----D-------EEIVL--RDAEFSKKLVTERDVKHAAVNKLAEIFNRKTSLIPGKKS-TNTLDLRKKEKEKRK-VMEL 1026 (1317)
T ss_pred             -----h-------hhHhh--ccHHHHhhhhhHHHHHHHHHHHHHHHHHHHhhccCCccc-ccHHHHHHHHHHHHH-HHHH
Confidence                 1       12233  899999999999999999999999999999988865543 578899999999999 9999


Q ss_pred             HHHHHHHhhcCCCCCceeeeeeeecCC---CCeeEEEEecCCCeEEEEEc--CCCCCCceEEcCCCCCeeEEEEecCCCe
Q psy3725         395 SELHRILKRNNLPNHTVSTPKIARVGD---TKKIYQMDYIPKEQLLVVLA--GKQRYVQIARVGDTKKIYQMDYIPEEQL  469 (760)
Q Consensus       395 ~~~~~~l~~~~~~~~~v~~~~e~~d~~---~~~i~Caa~~~~~rllvGTe--~l~~~~~l~rv~~~k~V~QI~Vi~e~~l  469 (760)
                      +.++.++.++.+++..+|   +++|.+   +..+.|.+++|..++.||..  ++..-..+.+|++.+.      .+..++
T Consensus      1027 ~qlr~~l~k~~l~~q~~~---d~~~~t~~~i~~~~~~~~id~~~~~I~~l~~~L~~~~~~~~v~~~~~------~e~e~~ 1097 (1317)
T KOG0612|consen 1027 SQLRTKLNKLRLKNQKEL---DLQAQTEESIRKILLQMIIDSKASEIEELRSKLYEINDSSSVGSQPE------DEAEQI 1097 (1317)
T ss_pred             HHHHHHHHHHhhhhHHHH---HHHHhhhHHHHHHHHHHHHhhhHHHHHHHHhhhHHHhhhhhcccCCc------chhhcc
Confidence            999999999998888877   566654   78889999899999999988  3432226788988777      888999


Q ss_pred             EEEEEC--CCCeEEEEECCCccCCCcceeecCcccceEEEEeeeeCCCccceEEEEEEecCCceEEEEEEecCCccccee
Q psy3725         470 LVVLAG--KQRYVRLVPVRALDGDEVEWVKIPETKGCLSFTTGPLTHTRTQHCLALAVKRQNSSQIILYEITRTKTRHKR  547 (760)
Q Consensus       470 LlvLsg--k~r~L~l~~L~~L~~~~~~~~kl~etKgc~~f~~g~~~~~~~~~~LcVAvKr~~~~~Vl~ye~~~~k~~fkk  547 (760)
                      |.+++|  ++++|+++|..++++ +..+.++..+++|+.|+++..+... +-.++++++|    .+.+|+++++..++.+
T Consensus      1098 l~~l~~~~~eg~lsl~~~~~~~~-~~~~~~V~~s~~~~l~~~~~~~k~~-~~~~il~i~k----~~~v~~vt~~d~~~~~ 1171 (1317)
T KOG0612|consen 1098 LPLLQGSRLEGWLSLPPRQNLDR-DWKRIYVIVSSKKILFYVSEQDKEQ-SGPLILDIKK----LFHVRQVTQTDVRRAD 1171 (1317)
T ss_pred             hhhhhhhhhhcccccCccccccc-chheeEEeecccceEeeeccccccc-cchhhhhhhh----ceeEEeecccccccch
Confidence            999999  889999999999999 5777999999999999999887653 3248899998    8999999999988999


Q ss_pred             eeeEecCCcceEEEEecCceEEEEEcCCeEEEEecCCCCceeecCCCCCcccccccCCCCceEEE-EeC--CCeEEEEec
Q psy3725         548 LHEVILPTLAQCIHIFSEGRLCVGYQSGFSIYKFSQDNRPIPLIHQDNPLVSLLTYSPVDALLAI-ELP--RGEFLLVFH  624 (760)
Q Consensus       548 ~kE~~lP~~~~sl~~~~~~~LcVG~~~gF~ivdl~~~~~~~~Ll~~~d~sl~f~~~~~~~pl~i~-~l~--~~EfLLcy~  624 (760)
                      .+||  |..++.|..+.+ .  +|..++|..+++.    +..+++++++.++|+.+.+.+..++. .+.  -++|+|||.
T Consensus      1172 ~~ei--p~~fq~l~~~~~-~--~~~~~~f~~l~l~----~~~~v~~~~~~~~~l~~~~~~~~~~~k~l~~~~~~ye~~~~ 1242 (1317)
T KOG0612|consen 1172 AKEI--PRIFQILYANEG-E--SGHPSEFSYLSLG----PNSLVHKGHEFIPFLYHFPTNCEACIKPLWHMFKAYECRRC 1242 (1317)
T ss_pred             hhhc--chhHHHHHhhcc-c--ccCccccchhhcc----chhhcCCCCcchHHHhhcchhHHHHhhhcccchhHHHHHHh
Confidence            9999  999998888866 4  9999999999994    67889999999999988776665333 231  239999999


Q ss_pred             ceEEEEcCCCCcccccceecCCCCcEEEeeCCeEEEEeCCeeEEEECcCCcEEEEEecCCceecCCCCCEEEEecCCccE
Q psy3725         625 SLAAYVDSQGHKSREKEIMYPALPTGASYMDGQLLIFSETHVDVFNAESGDWLQTVNIRRALPLDTRGSLCFSLANDIPY  704 (760)
Q Consensus       625 ~~gvfVD~~G~rsR~~~I~W~~~P~~~ay~~PYLlvf~~~~IEVr~i~tg~lVQtI~~~~ir~L~s~G~l~l~s~~~~~~  704 (760)
                      ++++|+|..|+      ++|+..  .+++..+|++++.++..+     +.+|||+|..+..+++.+.|++.+++.++  .
T Consensus      1243 ~~~~~~d~~~k------~m~p~k--y~~~~a~~l~l~a~~~~d-----q~eWV~~l~k~~~k~~~~~~~~~~~s~~~--~ 1307 (1317)
T KOG0612|consen 1243 HIKCHKDHMDK------IMAPCK--YDTSSARHLLLLAESTED-----QAKWVQRLVKKIPKPLPAAGSFSRSSPRT--L 1307 (1317)
T ss_pred             hcccccccccc------ccCccc--ccccCCccceeccCCchH-----HHHHHHHHhcccCCCCCcccceecccccc--c
Confidence            99999999999      999988  889999999999999988     89999999999999999999999999886  6


Q ss_pred             EEEeecc
Q psy3725         705 VVYLANI  711 (760)
Q Consensus       705 ~~~~~~~  711 (760)
                      +++.++.
T Consensus      1308 ~~~~s~~ 1314 (1317)
T KOG0612|consen 1308 KISLSQS 1314 (1317)
T ss_pred             hhhhhhh
Confidence            6666654

>COG5422 ROM1 RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4305|consensus Back     alignment and domain information
>KOG0976|consensus Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0976|consensus Back     alignment and domain information
>KOG2063|consensus Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd00029 C1 Protein kinase C conserved region 1 (C1) Back     alignment and domain information
>KOG1011|consensus Back     alignment and domain information
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1090|consensus Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>KOG4239|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3564|consensus Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>KOG0930|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1453|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG3640|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1169|consensus Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 4e-09
2e73_A77 Solution Structure Of The Phorbol EstersDIACYLGLYCE 2e-08
2enz_A65 Solution Structure Of The Second C1 Domain From Hum 8e-08
4fkd_A65 Identification Of The Activator Binding Residues In 9e-08
3ugd_A65 Structural And Functional Characterization Of An An 1e-07
3uff_A65 Structural And Functional Characterization Of An An 2e-07
3uej_A65 Structural And Functional Characterization Of An An 2e-07
1ptq_A50 Protein Kinase C Delta Cys2 Domain Length = 50 2e-07
1xa6_A466 Crystal Structure Of The Human Beta2-Chimaerin Leng 2e-07
3uey_A65 Structural And Functional Characterization Of An An 3e-07
3cxl_A463 Crystal Structure Of Human Chimerin 1 (Chn1) Length 5e-07
1y8f_A66 Solution Structure Of The Munc13-1 C1-domain Length 3e-06
2eli_A85 Solution Structure Of The Second Phorbol EstersDIAC 3e-06
1tbn_A82 Nmr Structure Of A Protein Kinase C-G Phorbol-Bindi 7e-06
2yuu_A83 Solution Structure Of The First Phorbol EstersDIACY 9e-06
2enn_A77 Solution Structure Of The First C1 Domain From Huma 4e-05
2rov_A117 The Split Ph Domain Of Rock Ii Length = 117 2e-04
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure 
Iteration: 1

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 34/67 (50%), Gaps = 3/67 (4%)
Query: 209 KHHQFITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVPPDQTK 268
           K+H+F  R F  PT C+HCT  + G  +QG  C +C F  H  C + V  SC   P   K
Sbjct: 36  KNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCSFVVHKRCHEFVTFSC---PGADK 92
Query: 269 RPLGIDP 275
            P   DP
Sbjct: 93  GPASDDP 99
>pdb|2E73|A Chain A, Solution Structure Of The Phorbol EstersDIACYLGLYCEROL Binding Domain Of Protein Kinase C Gamma Length = 77 Back     alignment and structure
>pdb|2ENZ|A Chain A, Solution Structure Of The Second C1 Domain From Human Protein Kinase C Theta Length = 65 Back     alignment and structure
>pdb|4FKD|A Chain A, Identification Of The Activator Binding Residues In The Second Cysteine-rich Regulatory Domain Of Protein Kinase C Theta Length = 65 Back     alignment and structure
>pdb|3UGD|A Chain A, Structural And Functional Characterization Of An Anesthetic Binding Site In The Second Cysteine-Rich Domain Of Protein Kinase C Delta Length = 65 Back     alignment and structure
>pdb|3UFF|A Chain A, Structural And Functional Characterization Of An Anesthetic Binding Site In The Second Cysteine-Rich Domain Of Protein Kinase Cdelta Length = 65 Back     alignment and structure
>pdb|3UEJ|A Chain A, Structural And Functional Characterization Of An Anesthetic Binding Site In The Second Cysteine-Rich Domain Of Protein Kinase Cdelta Length = 65 Back     alignment and structure
>pdb|1PTQ|A Chain A, Protein Kinase C Delta Cys2 Domain Length = 50 Back     alignment and structure
>pdb|1XA6|A Chain A, Crystal Structure Of The Human Beta2-Chimaerin Length = 466 Back     alignment and structure
>pdb|3UEY|A Chain A, Structural And Functional Characterization Of An Anesthetic Binding Site In The Second Cysteine-Rich Domain Of Protein Kinase Cdelta Length = 65 Back     alignment and structure
>pdb|3CXL|A Chain A, Crystal Structure Of Human Chimerin 1 (Chn1) Length = 463 Back     alignment and structure
>pdb|1Y8F|A Chain A, Solution Structure Of The Munc13-1 C1-domain Length = 66 Back     alignment and structure
>pdb|2ELI|A Chain A, Solution Structure Of The Second Phorbol EstersDIACYLGLYCEROL BINDING DOMAIN OF HUMAN PROTEIN Kinase C Alpha Type Length = 85 Back     alignment and structure
>pdb|1TBN|A Chain A, Nmr Structure Of A Protein Kinase C-G Phorbol-Binding Domain, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|2YUU|A Chain A, Solution Structure Of The First Phorbol EstersDIACYLGLYCEROL BINDING DOMAIN OF HUMAN PROTEIN Kinase C, Delta Length = 83 Back     alignment and structure
>pdb|2ENN|A Chain A, Solution Structure Of The First C1 Domain From Human Protein Kinase C Theta Length = 77 Back     alignment and structure
>pdb|2ROV|A Chain A, The Split Ph Domain Of Rock Ii Length = 117 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 3e-38
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 5e-25
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 4e-24
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 1e-23
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 4e-23
1ptq_A50 Protein kinase C delta type; phosphotransferase; 1 4e-22
2db6_A74 SH3 and cysteine rich domain 3; STAC3, C1 domain, 9e-22
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 4e-21
1faq_A52 RAF-1; transferase, serine/threonine-protein kinas 1e-18
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 1e-14
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 2e-14
2fnf_X72 Putative RAS effector NORE1; zinc, signal transduc 1e-13
1rfh_A59 RAS association (ralgds/AF-6) domain family 5; zin 1e-13
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-11
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-11
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 4e-08
1kbe_A49 Kinase suppressor of RAS; KSR, cysteine-rich domai 3e-07
1r79_A84 Diacylglycerol kinase, delta; C1 domain, cystein-r 2e-06
2yry_A122 Pleckstrin homology domain-containing family A mem 3e-06
3aj4_A112 Pleckstrin homology domain-containing family B ME; 5e-06
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 1e-05
2d9y_A117 Pleckstrin homology domain-containing protein fami 1e-05
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 2e-05
2d9v_A130 Pleckstrin homology domain-containing protein fami 2e-05
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 2e-05
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 5e-05
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 7e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 8e-05
3rcp_A103 Pleckstrin homology domain-containing family A ME; 1e-04
2dkp_A128 Pleckstrin homology domain-containing family A mem 1e-04
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 2e-04
3cxb_B112 Pleckstrin homology domain-containing family M mem 2e-04
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 2e-04
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 2e-04
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 3e-04
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 3e-04
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 5e-04
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 7e-04
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 8e-04
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 117 Back     alignment and structure
 Score =  137 bits (345), Expect = 3e-38
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 8/122 (6%)

Query: 283 YEGYVKVPKTGGVKK-GWVRQFVVVCDFKLFLYDISPDRNALPAVYVSLVLDMRDEDFAV 341
            EG++ +P     KK GWV+++V+V   K+  YD   D+         +VLD+ D+ F V
Sbjct: 3   LEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSN---PYMVLDI-DKLFHV 58

Query: 342 SGVRESDVIHATKKDIPCIFRITTSLMDPPGTKNHTLMLADSDTEKTKWVVALSELHRIL 401
             V ++DV  A  K+IP IF+I  +       KN  L+LA+S  E+ KWV  L    +I 
Sbjct: 59  RPVTQTDVYRADAKEIPRIFQILYANEGISSAKN-LLLLANSTEEQQKWVSRLV--KKIP 115

Query: 402 KR 403
           K+
Sbjct: 116 KK 117
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Length = 66 Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Length = 50 Back     alignment and structure
>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Length = 52 Back     alignment and structure
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 84 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 Back     alignment and structure
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Length = 72 Back     alignment and structure
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Length = 59 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A Length = 49 Back     alignment and structure
>1r79_A Diacylglycerol kinase, delta; C1 domain, cystein-rich zinc binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: g.49.1.1 Length = 84 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.86
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 99.78
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 99.53
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 99.49
2db6_A74 SH3 and cysteine rich domain 3; STAC3, C1 domain, 99.47
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 99.47
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 99.47
3uej_A65 NPKC-delta, protein kinase C delta type; proteine 99.46
1ptq_A50 Protein kinase C delta type; phosphotransferase; 1 99.45
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 99.44
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 99.4
1rfh_A59 RAS association (ralgds/AF-6) domain family 5; zin 99.28
2fnf_X72 Putative RAS effector NORE1; zinc, signal transduc 99.27
1faq_A52 RAF-1; transferase, serine/threonine-protein kinas 99.26
4b6d_A61 RAC GTPase-activating protein 1; signaling protein 99.2
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.11
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 99.07
1kbe_A49 Kinase suppressor of RAS; KSR, cysteine-rich domai 99.0
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 98.88
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 98.72
3aj4_A112 Pleckstrin homology domain-containing family B ME; 98.57
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 98.53
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 98.5
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 98.48
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 98.48
3rcp_A103 Pleckstrin homology domain-containing family A ME; 98.47
2yry_A122 Pleckstrin homology domain-containing family A mem 98.43
2dkp_A128 Pleckstrin homology domain-containing family A mem 98.43
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 98.43
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 98.42
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 98.4
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 98.4
2d9v_A130 Pleckstrin homology domain-containing protein fami 98.4
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 98.39
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 98.39
2d9y_A117 Pleckstrin homology domain-containing protein fami 98.38
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 98.37
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 98.37
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.37
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 98.35
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 98.34
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 98.34
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.33
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 98.32
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 98.31
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 98.3
1v88_A130 Oxysterol binding protein-related protein 8; vesic 98.29
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 98.28
3cxb_B112 Pleckstrin homology domain-containing family M mem 98.26
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 98.26
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 98.25
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 98.25
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 98.23
1wi1_A126 Calcium-dependent activator protein for secretion, 98.22
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 98.22
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 98.21
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 98.19
1v5p_A126 Pleckstrin homology domain-containing, family A; T 98.18
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 98.08
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 98.07
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 98.07
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 98.04
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 98.02
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 97.96
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 97.9
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 97.86
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 97.86
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 97.85
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 97.83
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 97.83
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 97.81
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 97.75
1u5e_A211 SRC-associated adaptor protein; novel dimerization 97.74
2d9w_A127 Docking protein 2; PH domain, structural genomics, 97.72
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 97.69
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.69
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.63
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 97.57
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 97.44
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 97.42
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 97.38
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 97.31
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 97.17
1r79_A84 Diacylglycerol kinase, delta; C1 domain, cystein-r 97.14
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 97.08
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 96.82
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 96.67
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.48
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.39
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.28
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.21
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 96.2
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.17
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.7
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.64
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.38
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.34
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.23
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.23
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.12
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.04
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 94.93
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.91
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.89
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.75
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.74
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.64
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 94.58
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 94.47
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 94.45
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.42
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.41
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.28
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.24
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 94.18
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.15
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.98
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 93.95
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.72
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 93.66
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 93.36
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 93.14
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 92.89
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 92.84
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 92.84
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.79
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 92.79
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 92.62
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 92.54
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 91.93
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 91.91
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 91.81
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 91.7
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 91.61
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 91.54
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 91.5
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 91.41
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 90.97
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 90.83
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 90.75
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 90.68
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 90.44
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 90.43
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 90.4
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 90.24
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 89.58
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 88.8
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 88.74
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 88.71
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 88.42
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 88.33
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 88.28
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 87.74
3ow8_A321 WD repeat-containing protein 61; structural genomi 87.57
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 87.3
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 87.06
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 87.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 86.84
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 86.77
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 86.72
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 86.66
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 86.5
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 86.37
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 86.14
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 85.99
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 85.72
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 85.62
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 85.41
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 85.26
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 85.04
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 84.93
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 84.68
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 84.62
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 84.48
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 84.39
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 84.37
2xyi_A430 Probable histone-binding protein CAF1; transcripti 84.12
1d7m_A101 Cortexillin I; coiled-coil, coiled-coil trigger si 84.02
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 83.77
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 83.6
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 83.41
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 83.05
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 82.47
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 82.41
1g6u_A48 Domain swapped dimer; designed three helix bundle, 82.35
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 82.24
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 82.11
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 82.03
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 81.85
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 81.68
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 81.19
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 80.94
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 80.83
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 80.69
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 80.63
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 80.54
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 80.22
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
Probab=99.86  E-value=5.4e-22  Score=184.00  Aligned_cols=111  Identities=35%  Similarity=0.620  Sum_probs=98.0

Q ss_pred             cceeeeeeccccccccc-ceEEEEEEEeCcEEEEEecCCCC-CCCCccceeEEeecCCCCeEEEeeccCcccccCCCccc
Q psy3725         281 TAYEGYVKVPKTGGVKK-GWVRQFVVVCDFKLFLYDISPDR-NALPAVYVSLVLDMRDEDFAVSGVRESDVIHATKKDIP  358 (760)
Q Consensus       281 t~~eG~vkvp~~~~~kk-gw~r~~~~l~~~kL~~yd~~~~~-~~~p~~~~~~~ldl~d~~fsV~~V~~sdvi~a~~~dip  358 (760)
                      +.+|||+++|+++|.++ ||+++|++|++++|++||.++++ ...    +..+||| +..|+|++|+++||||++++|+|
T Consensus         1 ~~~eGwl~~pk~~~~~k~~Wkkr~~vL~~~kL~~y~~~~~~~~~~----p~~~Idl-~~~~~V~~V~~~d~i~~~~~~~p   75 (117)
T 2rov_A            1 SRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSN----PYMVLDI-DKLFHVRPVTQTDVYRADAKEIP   75 (117)
T ss_dssp             CCSEEEEECCCCSSSSCCCCCEEEEEEETTEEEEESCHHHHHTTC----CSEEECG-GGEEEEEECCTTTCSSSCTTTGG
T ss_pred             CceEEEEEeecCCCccCCCcEEEEEEEECCEEEEEECCCCcccCC----ceEEEEC-cccEEEEEcccccccccccccCC
Confidence            46899999999999998 99999999999999999987655 223    4568999 89999999999999999999999


Q ss_pred             eeeeeecccCCCCCCcceEEEeeCCHHHHHHHHHHHHHH
Q psy3725         359 CIFRITTSLMDPPGTKNHTLMLADSDTEKTKWVVALSEL  397 (760)
Q Consensus       359 ~if~it~s~l~~~~~~~~l~LlA~S~~ek~kWv~~L~~~  397 (760)
                      +||+|+.+..+.++ ..+++|+|+|+.+|++|+.+|..+
T Consensus        76 ~iF~I~~~~~~~~~-~~~l~l~A~s~~e~~~WV~aL~~~  113 (117)
T 2rov_A           76 RIFQILYANEGISS-AKNLLLLANSTEEQQKWVSRLVKK  113 (117)
T ss_dssp             GEEEEEECSSSSTT-CEEEEEECSSHHHHHHHHHHHHHH
T ss_pred             cEEEEEeCCCCCCC-CcEEEEEeCCHHHHHHHHHHHHHH
Confidence            99999887776444 368999999999999999999865
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* Back     alignment and structure
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Back     alignment and structure
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Back     alignment and structure
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Back     alignment and structure
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Back     alignment and structure
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>1r79_A Diacylglycerol kinase, delta; C1 domain, cystein-rich zinc binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: g.49.1.1 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1g6u_A Domain swapped dimer; designed three helix bundle, de novo protein; 1.48A {Synthetic} SCOP: k.9.1.1 Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 760
d1xa6a362 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain 5e-21
d1tbna_66 g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus 2e-19
d1ptqa_50 g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {M 6e-19
d1r79a_84 g.49.1.1 (A:) Diacylglycerol kinase delta {Human ( 3e-18
d1faqa_52 g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 1e-14
d1kbea_49 g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse 2e-13
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 3e-06
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 3e-06
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 1e-05
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 1e-04
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 1e-04
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 2e-04
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 2e-04
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 3e-04
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 3e-04
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 4e-04
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 4e-04
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 0.002
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain)
domain: Beta-chimaerin, middle domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 85.1 bits (210), Expect = 5e-21
 Identities = 23/61 (37%), Positives = 26/61 (42%)

Query: 208 SKHHQFITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVPPDQT 267
            K H F   TF  P  C +C + M GL  QGV C  CG   H  C   VP  C     + 
Sbjct: 2   EKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRI 61

Query: 268 K 268
           K
Sbjct: 62  K 62
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Length = 66 Back     information, alignment and structure
>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Length = 49 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
d1xa6a362 Beta-chimaerin, middle domain {Human (Homo sapiens 99.45
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 99.41
d1ptqa_50 Protein kinase C-delta (PKCdelta) {Mouse (Mus musc 99.36
d1faqa_52 RAF-1 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1kbea_49 Kinase suppressor of Ras, Ksr {Mouse (Mus musculus 99.09
d1r79a_84 Diacylglycerol kinase delta {Human (Homo sapiens) 99.05
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 98.66
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 98.5
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 98.46
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 98.45
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 98.45
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 98.39
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 98.38
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 98.3
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 98.28
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 98.28
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 98.28
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.26
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 98.25
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 98.25
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 98.22
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 98.21
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 98.21
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 98.16
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 98.15
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 98.07
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 98.03
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 98.03
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 98.03
d1wi1a_126 Calcium-dependent activator protein for secretion, 98.01
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 98.01
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 97.98
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 97.97
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 97.95
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 97.89
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 97.82
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 97.79
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 97.59
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 96.84
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 96.73
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 96.57
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 96.42
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.77
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 95.19
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.13
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 94.92
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.77
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.49
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 94.42
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 94.1
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 93.33
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 92.06
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 91.69
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 91.61
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 91.11
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 90.83
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 90.12
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 89.06
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 87.54
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 86.27
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 84.94
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 84.57
d1v5na_89 Pdi-like hypothetical protein At1g60420 {Thale cre 82.95
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 82.09
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 81.55
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain)
domain: Beta-chimaerin, middle domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.45  E-value=3e-14  Score=115.19  Aligned_cols=59  Identities=37%  Similarity=0.789  Sum_probs=55.5

Q ss_pred             CCCceeEEeeecCCcccCCCcccccccccCeeeecCCCcccccccccccCCCCCCCccC
Q psy3725         208 SKHHQFITRTFTSPTKCNHCTSLMVGLTRQGVVCDICGFACHLSCCDKVPPSCPVPPDQ  266 (760)
Q Consensus       208 ~~~H~F~~~~f~~pt~C~~C~~~i~Gl~rQG~~C~~C~~~cH~kC~~~vp~~C~~p~~~  266 (760)
                      .++|+|...+|..|++|++|.++|||+.+||++|.+|++.||++|...|+..|+.+...
T Consensus         2 ~k~H~F~~~~~~~pt~C~~C~~~i~g~~~~g~~C~~C~~~~H~~C~~~v~~~C~~~~~~   60 (62)
T d1xa6a3           2 EKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKR   60 (62)
T ss_dssp             CCCCCCCEECCSSCCBCTTTCCBCCTTTTCEECCSSSCCCBCTGGGTTSCSCCCTTTTS
T ss_pred             CCCCEEEEeeCCCCCCCcccCccccccccCeEEcCCCCchhhHHHHhhCCCcCCCChhh
Confidence            47899999999999999999999999999999999999999999999999999876543
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure