Psyllid ID: psy3726

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGHHTVFGK
cEEEEEEccEEEEEEEEEEccccccccHHHHHHHHcccccccccccccccEEEcccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEcccccccccccEEEcc
EEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHccccccccccEEEEEEcccEEEEccccccccccccccccccEcccccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEE
myfdlnyngfheGRIIVGlfgkdvpktVENFKTLATVGvenktyigtKFHRIVKNFVLQggdvvyndgrgsisiygdkfddenfkikhtgagfvsmansgpnsngcqffitmsatpwldghhtvfgk
MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGHHTVFGK
MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGHHTVFGK
*YFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGHHTV***
MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGHHTVFGK
MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGHHTVFGK
MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGHHTVFGK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGHHTVFGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query127 2.2.26 [Sep-21-2011]
Q27774213 Peptidyl-prolyl cis-trans N/A N/A 0.992 0.591 0.575 2e-38
Q26551213 Peptidyl-prolyl cis-trans N/A N/A 0.992 0.591 0.568 6e-38
Q9SP02204 Peptidyl-prolyl cis-trans no N/A 1.0 0.622 0.578 1e-37
P45877212 Peptidyl-prolyl cis-trans yes N/A 0.992 0.594 0.582 1e-37
Q41651248 Peptidyl-prolyl cis-trans N/A N/A 0.984 0.504 0.571 2e-37
Q08E11212 Peptidyl-prolyl cis-trans yes N/A 0.992 0.594 0.590 3e-37
Q2UGK2192 Peptidyl-prolyl cis-trans yes N/A 0.992 0.656 0.566 3e-37
P34791260 Peptidyl-prolyl cis-trans no N/A 0.992 0.484 0.574 3e-37
Q8LDP4201 Peptidyl-prolyl cis-trans no N/A 1.0 0.631 0.571 4e-37
O94273201 Peptidyl-prolyl cis-trans yes N/A 0.992 0.626 0.574 4e-37
>sp|Q27774|PPIB_SCHJA Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma japonicum PE=2 SV=1 Back     alignment and function desciption
 Score =  157 bits (397), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 76/132 (57%), Positives = 98/132 (74%), Gaps = 6/132 (4%)

Query: 1   MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENK-----TYIGTKFHRIVKN 55
           ++FD+  +    GRII+GLFGK VPKTVENFK L+ +G   K      Y G+ FHR++K+
Sbjct: 34  VFFDIEVDEQPLGRIIIGLFGKTVPKTVENFKQLS-IGTTLKDGRTAAYKGSTFHRVIKS 92

Query: 56  FVLQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSAT 115
           F++QGGD   +DG G  SIYG++F DENFK+KH GAG++SMAN+GPN+NG QFFIT +  
Sbjct: 93  FMIQGGDFTNHDGTGGFSIYGERFPDENFKLKHVGAGWLSMANAGPNTNGAQFFITTTQN 152

Query: 116 PWLDGHHTVFGK 127
           PWLDG H VFGK
Sbjct: 153 PWLDGKHVVFGK 164
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Schistosoma japonicum (taxid: 6182)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q26551|PPIB_SCHMA Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma mansoni GN=CYP PE=2 SV=1 Back     alignment and function description
>sp|Q9SP02|CP20A_ARATH Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Arabidopsis thaliana GN=CYP20-1 PE=1 SV=1 Back     alignment and function description
>sp|P45877|PPIC_HUMAN Peptidyl-prolyl cis-trans isomerase C OS=Homo sapiens GN=PPIC PE=1 SV=1 Back     alignment and function description
>sp|Q41651|CYPB_VICFA Peptidyl-prolyl cis-trans isomerase, chloroplastic OS=Vicia faba PE=1 SV=1 Back     alignment and function description
>sp|Q08E11|PPIC_BOVIN Peptidyl-prolyl cis-trans isomerase C OS=Bos taurus GN=PPIC PE=2 SV=1 Back     alignment and function description
>sp|Q2UGK2|PPIB_ASPOR Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpr2 PE=3 SV=1 Back     alignment and function description
>sp|P34791|CP20C_ARATH Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic OS=Arabidopsis thaliana GN=CYP20-3 PE=1 SV=1 Back     alignment and function description
>sp|Q8LDP4|CP19D_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Arabidopsis thaliana GN=CYP19-4 PE=1 SV=2 Back     alignment and function description
>sp|O94273|PPIB_SCHPO Peptidyl-prolyl cis-trans isomerase B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query127
345483318 234 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.542 0.645 2e-42
321457457202 hypothetical protein DAPPUDRAFT_301417 [ 1.0 0.628 0.629 2e-41
307191840 235 Peptidyl-prolyl cis-trans isomerase, rho 1.0 0.540 0.637 3e-41
359843256205 peptidyl-prolyl cis-trans isomerase, par 1.0 0.619 0.606 2e-40
307168672201 Peptidyl-prolyl cis-trans isomerase, rho 1.0 0.631 0.637 4e-40
289064185206 peptidyl prolyl cis-trans isomerase B [C 1.0 0.616 0.622 2e-39
383855424 233 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.545 0.606 3e-39
297820336 228 hypothetical protein ARALYDRAFT_486034 [ 1.0 0.557 0.624 6e-39
157123185 233 cyclophilin-r [Aedes aegypti] gi|1088744 1.0 0.545 0.535 2e-38
158299012 253 AGAP009991-PA [Anopheles gambiae str. PE 1.0 0.501 0.559 2e-38
>gi|345483318|ref|XP_001602615.2| PREDICTED: peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/127 (64%), Positives = 101/127 (79%)

Query: 1   MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQG 60
           +YFD+       GRI++GLFG+D PKTVENF  LAT G++ +TY G+KFHR++K F++QG
Sbjct: 29  VYFDIMIGDNPAGRIVLGLFGEDAPKTVENFLKLATEGIKGRTYAGSKFHRVIKKFMIQG 88

Query: 61  GDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDG 120
           GD+   DG GSISI+G  FDDENFKI H+G GF+SMAN+G N+NGCQFFIT  ATPWLDG
Sbjct: 89  GDIEKGDGTGSISIWGKYFDDENFKINHSGPGFLSMANAGKNTNGCQFFITTIATPWLDG 148

Query: 121 HHTVFGK 127
            HTVFGK
Sbjct: 149 AHTVFGK 155

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|321457457|gb|EFX68543.1| hypothetical protein DAPPUDRAFT_301417 [Daphnia pulex] Back     alignment and taxonomy information
>gi|307191840|gb|EFN75266.1| Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|359843256|gb|AEV89763.1| peptidyl-prolyl cis-trans isomerase, partial [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|307168672|gb|EFN61708.1| Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme [Camponotus floridanus] Back     alignment and taxonomy information
>gi|289064185|gb|ADC80506.1| peptidyl prolyl cis-trans isomerase B [Conus novaehollandiae] Back     alignment and taxonomy information
>gi|383855424|ref|XP_003703212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|297820336|ref|XP_002878051.1| hypothetical protein ARALYDRAFT_486034 [Arabidopsis lyrata subsp. lyrata] gi|297323889|gb|EFH54310.1| hypothetical protein ARALYDRAFT_486034 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|157123185|ref|XP_001660049.1| cyclophilin-r [Aedes aegypti] gi|108874488|gb|EAT38713.1| AAEL009421-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158299012|ref|XP_319131.4| AGAP009991-PA [Anopheles gambiae str. PEST] gi|157014164|gb|EAA13914.4| AGAP009991-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query127
TAIR|locus:2081993228 AT3G55920 [Arabidopsis thalian 1.0 0.557 0.624 4.2e-40
UNIPROTKB|J9NUZ6199 PPIC "Peptidyl-prolyl cis-tran 0.992 0.633 0.582 2.1e-38
UNIPROTKB|P45877212 PPIC "Peptidyl-prolyl cis-tran 0.992 0.594 0.582 2.6e-38
UNIPROTKB|F1RVH5211 LOC100524880 "Peptidyl-prolyl 0.992 0.597 0.590 3.4e-38
UNIPROTKB|Q08E11212 PPIC "Peptidyl-prolyl cis-tran 0.992 0.594 0.590 5.5e-38
FB|FBgn0034753205 CG2852 [Drosophila melanogaste 0.992 0.614 0.590 7e-38
UNIPROTKB|F1NV93207 PPIB "Peptidyl-prolyl cis-tran 0.992 0.608 0.590 7e-38
UNIPROTKB|F1P4M4223 PPIB "Peptidyl-prolyl cis-tran 0.992 0.565 0.590 7e-38
ZFIN|ZDB-GENE-040426-1955216 ppib "peptidylprolyl isomerase 0.992 0.583 0.590 7e-38
TAIR|locus:2178863204 ROC7 "rotamase CYP 7" [Arabido 1.0 0.622 0.578 8.9e-38
TAIR|locus:2081993 AT3G55920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 427 (155.4 bits), Expect = 4.2e-40, P = 4.2e-40
 Identities = 83/133 (62%), Positives = 96/133 (72%)

Query:     1 MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLAT--VGVENK---TYI-GTKFHRIVK 54
             +YFD+  NG   GRI++GLFG  VPKT ENF++L T   GV N     Y  G+ FHRI+ 
Sbjct:    61 VYFDIQINGSPAGRILIGLFGNIVPKTAENFRSLCTGEKGVGNMGKPLYFKGSSFHRIIP 120

Query:    55 NFVLQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSA 114
              F++QGGD    DGRG  SIYGDKF DENFK+KHTG GF+SMANSGP+SNG QFFIT   
Sbjct:   121 GFMIQGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGFLSMANSGPDSNGSQFFITTVT 180

Query:   115 TPWLDGHHTVFGK 127
             T WLDGHH VFGK
Sbjct:   181 TSWLDGHHVVFGK 193
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0005886 "plasma membrane" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
UNIPROTKB|J9NUZ6 PPIC "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P45877 PPIC "Peptidyl-prolyl cis-trans isomerase C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RVH5 LOC100524880 "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E11 PPIC "Peptidyl-prolyl cis-trans isomerase C" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0034753 CG2852 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV93 PPIB "Peptidyl-prolyl cis-trans isomerase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4M4 PPIB "Peptidyl-prolyl cis-trans isomerase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1955 ppib "peptidylprolyl isomerase B (cyclophilin B)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2178863 ROC7 "rotamase CYP 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0CP78PPIB_CRYNJ5, ., 2, ., 1, ., 80.54960.99210.5454yesN/A
Q9TW32PPIB_DICDI5, ., 2, ., 1, ., 80.56391.00.6446yesN/A
Q8X166PPIB_ASPNG5, ., 2, ., 1, ., 80.54330.99210.5943yesN/A
O94273PPIB_SCHPO5, ., 2, ., 1, ., 80.57480.99210.6268yesN/A
Q2UGK2PPIB_ASPOR5, ., 2, ., 1, ., 80.56690.99210.6562yesN/A
Q6C4W6PPIB_YARLI5, ., 2, ., 1, ., 80.55110.99210.5526yesN/A
P52013CYP5_CAEEL5, ., 2, ., 1, ., 80.57480.99210.6176yesN/A
P45877PPIC_HUMAN5, ., 2, ., 1, ., 80.58260.99210.5943yesN/A
Q4I5R9PPIB_GIBZE5, ., 2, ., 1, ., 80.55110.99210.5080yesN/A
Q4WP12PPIB_ASPFU5, ., 2, ., 1, ., 80.55110.99210.6028yesN/A
Q08E11PPIC_BOVIN5, ., 2, ., 1, ., 80.59050.99210.5943yesN/A
Q5B4R3PPIB_EMENI5, ., 2, ., 1, ., 80.55110.99210.5887yesN/A
P30412PPIC_MOUSE5, ., 2, ., 1, ., 80.56690.99210.5943yesN/A
P24367PPIB_CHICK5, ., 2, ., 1, ., 80.58260.99210.6086yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.921
4th Layer5.2.1.80.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 6e-58
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 2e-48
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 9e-48
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 3e-44
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 1e-42
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 2e-42
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 6e-41
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 2e-36
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 5e-35
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 6e-34
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 7e-32
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 4e-21
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 7e-20
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 5e-10
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 7e-08
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 2e-04
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 0.003
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information 
 Score =  176 bits (448), Expect = 6e-58
 Identities = 71/130 (54%), Positives = 89/130 (68%), Gaps = 4/130 (3%)

Query: 2   YFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLAT----VGVENKTYIGTKFHRIVKNFV 57
           +FD+   G   GRI++ LF   VPKT ENF+ L T     G +   Y G+ FHR++ +F+
Sbjct: 4   FFDITIGGEPAGRIVMELFADVVPKTAENFRALCTGEKGKGGKPFGYKGSTFHRVIPDFM 63

Query: 58  LQGGDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPW 117
           +QGGD    +G G  SIYG+KF DENFK+KHTG G +SMAN+GPN+NG QFFIT   TPW
Sbjct: 64  IQGGDFTRGNGTGGKSIYGEKFPDENFKLKHTGPGLLSMANAGPNTNGSQFFITTVKTPW 123

Query: 118 LDGHHTVFGK 127
           LDG H VFGK
Sbjct: 124 LDGKHVVFGK 133

This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. These enzymes have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. As cyclophilins, Human hCyP-A, human cyclophilin-B (hCyP-19), S. cerevisiae Cpr1 and C. elegans Cyp-3, are inhibited by the immunosuppressive drug cyclopsporin A (CsA). CsA binds to the PPIase active site. Cyp-3. S. cerevisiae Cpr1 interacts with the Rpd3 - Sin3 complex and in addition is a component of the Set3 complex. S. cerevisiae Cpr1 has also been shown to have a role in Zpr1p nuclear transport. Human cyclophilin H associates with the [U4/U6.U5] tri-snRNP particles of the splicesome. Length = 164
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 127
KOG0546|consensus 372 100.0
KOG0880|consensus217 100.0
KOG0879|consensus177 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
KOG0881|consensus164 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
KOG0111|consensus298 100.0
PTZ00060183 cyclophilin; Provisional 100.0
PTZ00221249 cyclophilin; Provisional 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
KOG0882|consensus558 100.0
KOG0883|consensus 518 100.0
KOG0884|consensus161 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
KOG0885|consensus 439 100.0
KOG0865|consensus167 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
KOG0415|consensus 479 99.97
KOG0882|consensus 558 96.13
PRK00969508 hypothetical protein; Provisional 94.94
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 94.51
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 91.15
PRK00969 508 hypothetical protein; Provisional 89.64
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 88.97
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 80.83
>KOG0546|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.1e-55  Score=324.86  Aligned_cols=126  Identities=53%  Similarity=0.947  Sum_probs=122.6

Q ss_pred             CeEEeEECCeeeEEEEEEEcCCCCcchHHhHHhhhccCCcc--------ccccccEEEEEecCeEEeeCcccccCCCCcc
Q psy3726           1 MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVEN--------KTYIGTKFHRIVKNFVLQGGDVVYNDGRGSI   72 (127)
Q Consensus         1 v~~di~i~~t~~G~i~ieL~~~~~P~t~~nF~~L~~~~~~~--------~~Y~g~~f~rv~~~~~iq~Gd~~~~~~~~~~   72 (127)
                      |||||+|++.++|||+||||.|.||+||+||+.||+|. +|        .+|+|+.||||+++|||||||++.++|+|+.
T Consensus        11 ~ffDISI~ge~~GRIvfeLf~dv~PKTaENFraLCtGE-~G~~~~~gk~L~YKG~~FHRViK~FMiQgGDfs~gnGtGGe   89 (372)
T KOG0546|consen   11 VFFDISIGGEPAGRIVFELFNDVVPKTAENFRALCTGE-KGGGLTTGKPLHYKGSRFHRVIKNFMIQGGDFSEGNGTGGE   89 (372)
T ss_pred             EEEEEEeCCcccceEEEEeecccCchhHHHHHHHhccc-cCCCCCCCCeeeecCchhheeeecceeeccccccCCCCCcc
Confidence            79999999999999999999999999999999999987 43        3799999999999999999999999999999


Q ss_pred             cccCCCCCCCccccCcccceEEEeecCCCCCCcceEEEEcCCCCCCCCCCeEecC
Q psy3726          73 SIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGHHTVFGK  127 (127)
Q Consensus        73 ~~~~~~~~~e~~~~~~~~~G~l~~~~~~~~~~~sqFfItl~~~~~ld~~~~vFG~  127 (127)
                      ||||..|+||++.++|+++++|||||.|||+||||||||+.++|||||+|+||||
T Consensus        90 SIYG~~FdDEnF~lKHdrpflLSMAN~GpNTNgSQFFITT~p~PHLdGkHVVFGq  144 (372)
T KOG0546|consen   90 SIYGEKFDDENFELKHDRPFLLSMANRGPNTNGSQFFITTVPTPHLDGKHVVFGQ  144 (372)
T ss_pred             cccccccccccceeccCcchhhhhhcCCCCCCCcceEEeCCCCCCcCCceeEEee
Confidence            9999999999999999999999999999999999999999999999999999996

>KOG0880|consensus Back     alignment and domain information
>KOG0879|consensus Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0881|consensus Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG0883|consensus Back     alignment and domain information
>KOG0884|consensus Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>KOG0885|consensus Back     alignment and domain information
>KOG0865|consensus Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 2e-38
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 1e-37
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 2e-37
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 1e-36
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 1e-36
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 2e-36
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 3e-36
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 3e-36
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 5e-34
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 7e-34
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 8e-34
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 8e-34
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 8e-34
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 9e-34
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 9e-34
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 1e-33
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 1e-33
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 1e-33
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 1e-33
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 2e-33
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 2e-33
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 2e-33
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 2e-33
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 2e-33
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 3e-33
1dyw_A173 Biochemical And Structural Characterization Of A Di 6e-33
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 7e-33
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 9e-33
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 1e-32
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 5e-32
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 6e-32
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 7e-32
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 2e-31
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 2e-31
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 2e-31
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 3e-31
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 5e-31
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 5e-31
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 5e-31
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 5e-31
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 6e-31
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 8e-31
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 1e-30
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 1e-30
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 3e-30
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 3e-30
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 8e-30
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 5e-29
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 8e-29
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 1e-28
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 2e-28
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 2e-28
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 2e-28
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 7e-28
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 1e-27
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 2e-26
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 1e-25
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 9e-25
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 1e-21
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 6e-21
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 3e-20
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 4e-20
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 6e-18
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 1e-16
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 6e-16
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 1e-15
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 2e-11
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 3e-10
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 2e-05
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 2e-04
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 2e-04
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 8e-04
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure 
Iteration: 1

 Score =  154 bits (388), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 96/127 (75%), Gaps = 1/127 (0%)
Query: 1   MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQG 60
           ++FD+       GRI++GLFGK VPKTVENF  LAT G +   Y G+KFHR++K+F++QG
Sbjct: 18  VFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALAT-GEKGYGYKGSKFHRVIKDFMIQG 76
Query: 61  GDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDG 120
           GD+   DG G +SIYG+ F DENFK+KH G G+VSMAN+GP++NG QFFIT++   WLDG
Sbjct: 77  GDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDG 136
Query: 121 HHTVFGK 127
            H VFGK
Sbjct: 137 KHVVFGK 143
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 4e-66
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 6e-66
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-65
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 2e-65
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 2e-65
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 3e-65
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 5e-65
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 6e-65
1z81_A229 Cyclophilin; structural genomics, structural genom 1e-64
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 2e-64
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-64
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 4e-64
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 8e-64
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 9e-64
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 1e-63
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 1e-63
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 2e-62
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 1e-61
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 2e-56
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 1e-53
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-53
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 5e-53
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 1e-52
2b71_A196 Cyclophilin-like protein; structural genomics, str 2e-51
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 4e-50
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 4e-49
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 5e-49
2hq6_A185 Serologically defined colon cancer antigen 10; pro 8e-49
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 3e-47
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 2e-44
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 7e-44
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 9e-30
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 6e-26
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 2e-25
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 6e-25
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
 Score =  197 bits (502), Expect = 4e-66
 Identities = 74/127 (58%), Positives = 91/127 (71%), Gaps = 1/127 (0%)

Query: 1   MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQG 60
           +YFDL       GR+I GLFGK VPKTV+NF  LAT G +   Y  +KFHR++K+F++QG
Sbjct: 18  VYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALAT-GEKGFGYKNSKFHRVIKDFMIQG 76

Query: 61  GDVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDG 120
           GD    DG G  SIYG++F DENFK+KH G G+VSMAN+G ++NG QFFIT   T WLDG
Sbjct: 77  GDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDG 136

Query: 121 HHTVFGK 127
            H VFGK
Sbjct: 137 KHVVFGK 143
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 127
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 1e-34
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 3e-31
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 8e-31
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 2e-30
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 4e-30
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 2e-29
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 3e-29
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 1e-28
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 3e-28
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 3e-27
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 3e-27
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 2e-26
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 4e-26
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 5e-26
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 6e-26
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 6e-26
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 9e-23
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 8e-20
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 4e-19
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 1e-17
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-15
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-12
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin-like allergen Mal s 6
species: Malassezia sympodialis [TaxId: 76777]

 Score =  115 bits (289), Expect = 1e-34
 Identities = 65/126 (51%), Positives = 81/126 (64%), Gaps = 1/126 (0%)

Query: 2   YFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQGG 61
           +FD+  NG   G I   LF   VPKT  NF+ L T   +   Y G+ FHR++ +F+LQGG
Sbjct: 5   FFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTG-EKGFGYAGSHFHRVIPDFMLQGG 63

Query: 62  DVVYNDGRGSISIYGDKFDDENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGH 121
           D    +G G  SIYG KF DENF++KH   G +SMAN+GPN+NG QFFIT   T WLDG 
Sbjct: 64  DFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGK 123

Query: 122 HTVFGK 127
           H VFG+
Sbjct: 124 HVVFGE 129
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query127
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.6e-43  Score=240.26  Aligned_cols=126  Identities=52%  Similarity=0.896  Sum_probs=117.6

Q ss_pred             CeEEeEECCeeeEEEEEEEcCCCCcchHHhHHhhhccCCccccccccEEEEEecCeEEeeCcccccCCCCcccccCCCCC
Q psy3726           1 MYFDLNYNGFHEGRIIVGLFGKDVPKTVENFKTLATVGVENKTYIGTKFHRIVKNFVLQGGDVVYNDGRGSISIYGDKFD   80 (127)
Q Consensus         1 v~~di~i~~t~~G~i~ieL~~~~~P~t~~nF~~L~~~~~~~~~Y~g~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~~   80 (127)
                      |||||+|+++++|+|+||||.+.||+||+||++||+.. ++..|+++.||||+|++++|+|++....+.+..+.++...+
T Consensus         4 vy~di~i~~~~~G~i~ieL~~~~aP~tv~nF~~L~~~~-~~~~Y~g~~f~Rv~~~~~iq~G~~~~~~~~~~~~~~~~~~~   82 (161)
T d2r99a1           4 VYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHE-KGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFD   82 (161)
T ss_dssp             EEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHTT-TSCCSTTCBEEEEETTTEEEECCTTTSSSSCCCBTTBSCBC
T ss_pred             EEEEEEECCEeceEEEEEEcCCCCcHHHHHHHHhhhhc-cccccCCcEEEEEEEeeeEEeeeccCCCCCCCccccCcccc
Confidence            79999999999999999999999999999999999765 33449999999999999999999998777777888888888


Q ss_pred             CCccccCcccceEEEeecCCCCCCcceEEEEcCCCCCCCCCCeEecC
Q psy3726          81 DENFKIKHTGAGFVSMANSGPNSNGCQFFITMSATPWLDGHHTVFGK  127 (127)
Q Consensus        81 ~e~~~~~~~~~G~l~~~~~~~~~~~sqFfItl~~~~~ld~~~~vFG~  127 (127)
                      ++....+|.++|+|+|++.++++++|||||+++++|+||++|+||||
T Consensus        83 ~~~~~~~~~~~G~ls~~~~~~~s~~sqFfI~~~~~~~Ldg~~tvFG~  129 (161)
T d2r99a1          83 DENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGE  129 (161)
T ss_dssp             CCCCCSCCCSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEE
T ss_pred             ccccccccccceeeeecccCCCCcCcceEeccCCccccCCcceEEEE
Confidence            88899999999999999999999999999999999999999999996
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure