Psyllid ID: psy3760


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLTKPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGIGIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFINKILNN
ccccHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHcHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEcccccccccEEEEEEEEEEEEEEEcccccccccccccHHHHccccEEEEcccccHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHcccHHHHHHHHHcccccccEEEEEccccccccEEEEEEEccccccHHHHHHHHHHHHHHcHHHHHHHHcc
ccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHccEEEEEcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcHHHHHHccHHHHHHHHHHccEEEEEEEEccHHHHHHHHHcccccEEEEcccccccccEEEEEEEEEcEEEEEcccccccccccccHHHHHccEEEEEccccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccEEEEEHHHcccccccccEEEEcEccEccEEEEEEEEccccccHHHHHHHHHHcccccHHHHHHHHcc
MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRhgkrirgltkpgqAILRSIEIIMQEIEGLKKIGkefsaydtgnltiaTTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEilspsdklisipcyqweyviivpldhpllllnsislkeisnyplitydlsfsgrikldrefslqkltpyiVLETINSDIIKTYVELRMGIGIIAsiafdsnrdkNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFINKILNN
MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFirhgkrirgltkpgqaiLRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDRefslqkltpyiVLETINSDIIKTYVELRMGIGIIASIAFDSNRDKNLRSIsashlfgttisrviiKQGTYLRSYVYSFIkllspklnrkfinkilnn
MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAiieleeelsidifiRHGKRIRGLTKPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGIGIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFINKILNN
*****FRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLTKPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGIGIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFINKI***
MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLTKPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGIGIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKF*NKI***
MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLTKPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGIGIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFINKILNN
*NLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLTKPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGIGIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFINKILNN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLTKPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGIGIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFINKILNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
P06614324 HTH-type transcriptional yes N/A 0.983 0.929 0.428 3e-74
P45600324 HTH-type transcriptional yes N/A 0.983 0.929 0.425 3e-74
P0A9F3324 HTH-type transcriptional N/A N/A 0.983 0.929 0.421 3e-73
P0A9F4324 HTH-type transcriptional yes N/A 0.983 0.929 0.421 3e-73
P0A9F5324 HTH-type transcriptional N/A N/A 0.983 0.929 0.421 3e-73
Q47083316 HTH-type transcriptional N/A N/A 0.986 0.955 0.423 2e-70
P45105323 HTH-type transcriptional yes N/A 0.983 0.931 0.417 6e-70
Q08598316 HTH-type transcriptional no N/A 0.967 0.936 0.435 4e-65
Q55459304 HTH-type transcriptional N/A N/A 0.774 0.779 0.300 2e-21
P37499292 Uncharacterized HTH-type yes N/A 0.826 0.866 0.262 3e-20
>sp|P06614|CYSB_SALTY HTH-type transcriptional regulator CysB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysB PE=1 SV=1 Back     alignment and function desciption
 Score =  278 bits (712), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 129/301 (42%), Positives = 191/301 (63%)

Query: 1   MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLT 60
           M L Q R++ E V  N N++  A+ LYTSQPG+SK +  LE+EL I IF R GK +  +T
Sbjct: 1   MKLQQLRYIVEVVNHNLNVSSTAEGLYTSQPGISKQVRMLEDELGIQIFARSGKHLTQVT 60

Query: 61  KPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFP 120
             GQ I+R    ++ +++ +K +  E +  D G+L IATTHTQARYALP +IK F  ++P
Sbjct: 61  PAGQEIIRIAREVLSKVDAIKSVAGEHTWPDKGSLYIATTHTQARYALPGVIKGFIERYP 120

Query: 121 KVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLL 180
           +V L + QG+P QI E +    AD AI TE L   D L+ +PCY W   I+V  DHPL  
Sbjct: 121 RVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAA 180

Query: 181 LNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGI 240
            +S++++ ++ YPL+TY   F+GR +LD  F+   LTP IV    ++D+IKTYV L +G+
Sbjct: 181 TSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGV 240

Query: 241 GIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFI 300
           G+IAS+A D   D +L  I A  +F  + +++  ++ T+LRSY+Y FI+  +P L R  +
Sbjct: 241 GVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVV 300

Query: 301 N 301
           +
Sbjct: 301 D 301




This protein is a positive regulator of gene expression for the cysteine regulon, a system of 10 or more loci involved in the biosynthesis of L-cysteine from inorganic sulfate. The inducer for cysB is N-acetylserine. CysB inhibits its own transcription.
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (taxid: 99287)
>sp|P45600|CYSB_KLEPN HTH-type transcriptional regulator CysB OS=Klebsiella pneumoniae GN=cysB PE=1 SV=2 Back     alignment and function description
>sp|P0A9F3|CYSB_ECOLI HTH-type transcriptional regulator CysB OS=Escherichia coli (strain K12) GN=cysB PE=3 SV=1 Back     alignment and function description
>sp|P0A9F4|CYSB_ECOL6 HTH-type transcriptional regulator CysB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysB PE=3 SV=1 Back     alignment and function description
>sp|P0A9F5|CYSB_ECO57 HTH-type transcriptional regulator CysB OS=Escherichia coli O157:H7 GN=cysB PE=3 SV=1 Back     alignment and function description
>sp|Q47083|CBL_ECOLI HTH-type transcriptional regulator cbl OS=Escherichia coli (strain K12) GN=cbl PE=1 SV=2 Back     alignment and function description
>sp|P45105|CYSB_HAEIN HTH-type transcriptional regulator CysB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cysB PE=3 SV=1 Back     alignment and function description
>sp|Q08598|CBL_ENTAE HTH-type transcriptional regulator cbl OS=Enterobacter aerogenes GN=cbl PE=4 SV=1 Back     alignment and function description
>sp|Q55459|CMPR_SYNY3 HTH-type transcriptional activator CmpR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpR PE=1 SV=1 Back     alignment and function description
>sp|P37499|YYBE_BACSU Uncharacterized HTH-type transcriptional regulator YybE OS=Bacillus subtilis (strain 168) GN=yybE PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
399017224313 transcriptional regulator [Herbaspirillu 1.0 0.977 0.709 1e-134
300312397313 cys regulon transcription regulator prot 1.0 0.977 0.709 1e-134
415948476313 HTH-type transcriptional regulator [Herb 1.0 0.977 0.705 1e-133
398832713313 transcriptional regulator [Herbaspirillu 1.0 0.977 0.699 1e-132
340788687313 regulatory protein CysB [Collimonas fung 1.0 0.977 0.679 1e-131
152980807313 transcriptional regulator CysB-like prot 1.0 0.977 0.683 1e-129
134095567313 transcriptional regulator CysB-like prot 1.0 0.977 0.689 1e-128
329903700313 Regulatory protein CysB [Oxalobacteracea 1.0 0.977 0.663 1e-126
395761411313 transcriptional regulator CysB-like prot 1.0 0.977 0.656 1e-125
427403367312 hypothetical protein HMPREF9710_03960 [M 1.0 0.980 0.637 1e-121
>gi|399017224|ref|ZP_10719422.1| transcriptional regulator [Herbaspirillum sp. CF444] gi|398104128|gb|EJL94282.1| transcriptional regulator [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/306 (70%), Positives = 269/306 (87%)

Query: 1   MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLT 60
           MNLHQFRFVREAVRQN+NLTEAAKALYTSQPGVSKAIIELEEEL +DIF RHGKRIRGLT
Sbjct: 1   MNLHQFRFVREAVRQNYNLTEAAKALYTSQPGVSKAIIELEEELGVDIFTRHGKRIRGLT 60

Query: 61  KPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFP 120
           +PG+A+LRS+E+IMQE++GLK+IGKEF+A+D+G+ TIATTHTQARY+LPK+++ FT ++P
Sbjct: 61  EPGRAVLRSVELIMQEVDGLKRIGKEFAAHDSGSFTIATTHTQARYSLPKVVQAFTQKYP 120

Query: 121 KVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLL 180
           KV+LSLLQGNPKQITEM+RNDQADIAI TE L+  + L+S+PCYQWE+V++VP +HPLL 
Sbjct: 121 KVRLSLLQGNPKQITEMVRNDQADIAIATEALASGEGLVSLPCYQWEHVVVVPPEHPLLK 180

Query: 181 LNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGI 240
             ++SL+EI+ YPLITYD +FSGR K+D  FSL+ L P IVLE I++D+IKTYVEL MG+
Sbjct: 181 SKNLSLEEIAGYPLITYDAAFSGRSKIDHAFSLRDLKPDIVLEAIDADVIKTYVELGMGV 240

Query: 241 GIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFI 300
           GIIA +AFD +RD+ LRSI A HLFGT +SRV +KQG YLRSYVY+FI+LL+P LNRK I
Sbjct: 241 GIIAGMAFDGDRDRGLRSIPAGHLFGTNVSRVALKQGAYLRSYVYTFIELLAPTLNRKLI 300

Query: 301 NKILNN 306
            +++  
Sbjct: 301 AQVMEG 306




Source: Herbaspirillum sp. CF444

Species: Herbaspirillum sp. CF444

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi|300312397|ref|YP_003776489.1| cys regulon transcription regulator protein [Herbaspirillum seropedicae SmR1] gi|409406827|ref|ZP_11255289.1| cys regulon transcription regulator protein [Herbaspirillum sp. GW103] gi|300075182|gb|ADJ64581.1| cys regulon transcription regulator protein [Herbaspirillum seropedicae SmR1] gi|386435376|gb|EIJ48201.1| cys regulon transcription regulator protein [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|415948476|ref|ZP_11556747.1| HTH-type transcriptional regulator [Herbaspirillum frisingense GSF30] gi|407757891|gb|EKF67797.1| HTH-type transcriptional regulator [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|398832713|ref|ZP_10590869.1| transcriptional regulator [Herbaspirillum sp. YR522] gi|398222870|gb|EJN09229.1| transcriptional regulator [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|340788687|ref|YP_004754152.1| regulatory protein CysB [Collimonas fungivorans Ter331] gi|340553954|gb|AEK63329.1| Regulatory protein CysB [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|152980807|ref|YP_001354140.1| transcriptional regulator CysB-like protein [Janthinobacterium sp. Marseille] gi|151280884|gb|ABR89294.1| cys regulon transcriptionnal regulator protein [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|134095567|ref|YP_001100642.1| transcriptional regulator CysB-like protein [Herminiimonas arsenicoxydans] gi|133739470|emb|CAL62521.1| HTH-type transcriptional regulator cysB (Cys regulon transcriptional activator) [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|329903700|ref|ZP_08273585.1| Regulatory protein CysB [Oxalobacteraceae bacterium IMCC9480] gi|327548248|gb|EGF32946.1| Regulatory protein CysB [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
>gi|395761411|ref|ZP_10442080.1| transcriptional regulator CysB-like protein [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
>gi|427403367|ref|ZP_18894364.1| hypothetical protein HMPREF9710_03960 [Massilia timonae CCUG 45783] gi|425717838|gb|EKU80793.1| hypothetical protein HMPREF9710_03960 [Massilia timonae CCUG 45783] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
TIGR_CMR|SO_2649324 SO_2649 "cys regulon transcrip 0.986 0.932 0.397 6.9e-63
UNIPROTKB|P0A9F3324 cysB "CysB" [Escherichia coli 0.983 0.929 0.398 4.3e-61
UNIPROTKB|Q9KQU1324 VC_1907 "Cys regulon transcrip 0.996 0.941 0.383 9e-61
TIGR_CMR|VC_1907324 VC_1907 "cys regulon transcrip 0.996 0.941 0.383 9e-61
TIGR_CMR|CPS_1200324 CPS_1200 "cys regulon transcri 0.993 0.938 0.384 1.9e-58
UNIPROTKB|Q47083316 cbl [Escherichia coli K-12 (ta 0.986 0.955 0.394 3.2e-58
TIGR_CMR|BA_2439300 BA_2439 "transcriptional regul 0.937 0.956 0.284 2.6e-24
TIGR_CMR|GSU_2817296 GSU_2817 "transcriptional regu 0.941 0.972 0.245 1.6e-17
TIGR_CMR|GSU_0266307 GSU_0266 "transcriptional regu 0.816 0.814 0.245 9.7e-17
UNIPROTKB|P27111299 cynR "CynR DNA-binding transcr 0.790 0.809 0.261 1.2e-16
TIGR_CMR|SO_2649 SO_2649 "cys regulon transcriptional activator" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
 Score = 642 (231.1 bits), Expect = 6.9e-63, P = 6.9e-63
 Identities = 120/302 (39%), Positives = 184/302 (60%)

Query:     1 MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAXXXXXXXXXXXXXXRHGKRIRGLT 60
             M L Q R++ E V+ N N++  A+ LYTSQPG+SK               R GK +  +T
Sbjct:     1 MKLQQLRYIAEVVKHNLNVSATAENLYTSQPGISKQVRMLEDELGIQIFGRSGKHLTHVT 60

Query:    61 KPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFP 120
               GQ ++     I+ ++E +KK+ +E++  D G L IATT TQARYALP II++F  ++P
Sbjct:    61 PAGQQVINIANDILGKVESIKKVSEEYTKPDQGELNIATTDTQARYALPNIIRQFIDRYP 120

Query:   121 KVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLL 180
             KV L + QG P QI+E      AD AI TE +     LI +PCY W   ++VP DHPL  
Sbjct:   121 KVNLHMHQGTPSQISEQAARGDADFAIATEAMHLYSDLIMLPCYHWNRSVVVPKDHPLAT 180

Query:   181 LNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGI 240
                IS+++++ +PL+TY   F    ++++ F+   L P +V    ++D++KTYV L +G+
Sbjct:   181 RTQISIEDLARFPLVTYVFGFDRASEIEKAFNRANLEPRVVFSATSADVLKTYVRLGLGV 240

Query:   241 GIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFI 300
             G+IAS+A D N DK+L +I A HLF  + +++  ++G++LRSY+Y FI+  +P L R  +
Sbjct:   241 GVIASMAIDPNIDKDLVAIDAGHLFAHSTTKIGFRKGSFLRSYMYDFIQHFAPHLTRDVV 300

Query:   301 NK 302
              K
Sbjct:   301 EK 302




GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0019344 "cysteine biosynthetic process" evidence=ISS
UNIPROTKB|P0A9F3 cysB "CysB" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KQU1 VC_1907 "Cys regulon transcriptional activator" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1907 VC_1907 "cys regulon transcriptional activator" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1200 CPS_1200 "cys regulon transcription activator" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q47083 cbl [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2439 BA_2439 "transcriptional regulator, LysR family" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2817 GSU_2817 "transcriptional regulator, LysR family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0266 GSU_0266 "transcriptional regulator, LysR family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P27111 cynR "CynR DNA-binding transcriptional repressor" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P45600CYSB_KLEPNNo assigned EC number0.42520.98360.9290yesN/A
P52595CBBR_RHORUNo assigned EC number0.23180.87580.8993yesN/A
P06614CYSB_SALTYNo assigned EC number0.42850.98360.9290yesN/A
A0T0G2RBCR_PHATCNo assigned EC number0.26140.87250.8697yesN/A
P37499YYBE_BACSUNo assigned EC number0.26250.82670.8664yesN/A
P45105CYSB_HAEINNo assigned EC number0.41720.98360.9318yesN/A
P0A9F4CYSB_ECOL6No assigned EC number0.42190.98360.9290yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
PRK12684313 PRK12684, PRK12684, transcriptional regulator CysB 0.0
PRK12682309 PRK12682, PRK12682, transcriptional regulator CysB 1e-155
PRK12683309 PRK12683, PRK12683, transcriptional regulator CysB 1e-148
PRK12681324 PRK12681, cysB, transcriptional regulator CysB; Re 1e-116
cd08413198 cd08413, PBP2_CysB_like, The C-terminal substrate 1e-103
PRK12679316 PRK12679, cbl, transcriptional regulator Cbl; Revi 1e-102
cd08444198 cd08444, PBP2_Cbl, The C-terminal substrate bindin 8e-75
cd08443198 cd08443, PBP2_CysB, The C-terminal substrate domai 6e-71
PRK12680327 PRK12680, PRK12680, transcriptional regulator CysB 7e-54
COG0583297 COG0583, LysR, Transcriptional regulator [Transcri 8e-44
cd05466197 cd05466, PBP2_LTTR_substrate, The substrate bindin 2e-40
pfam03466207 pfam03466, LysR_substrate, LysR substrate binding 1e-34
cd08420201 cd08420, PBP2_CysL_like, C-terminal substrate bind 3e-24
cd08434195 cd08434, PBP2_GltC_like, The substrate binding dom 2e-23
TIGR03339279 TIGR03339, phn_lysR, aminoethylphosphonate catabol 1e-22
cd08415196 cd08415, PBP2_LysR_opines_like, The C-terminal sub 6e-21
PRK11242296 PRK11242, PRK11242, DNA-binding transcriptional re 1e-19
cd08440197 cd08440, PBP2_LTTR_like_4, TThe C-terminal substra 4e-19
cd08419197 cd08419, PBP2_CbbR_RubisCO_like, The C-terminal su 5e-18
CHL00180305 CHL00180, rbcR, LysR transcriptional regulator; Pr 8e-18
PRK09791302 PRK09791, PRK09791, putative DNA-binding transcrip 1e-17
TIGR02424300 TIGR02424, TF_pcaQ, pca operon transcription facto 1e-16
cd08414197 cd08414, PBP2_LTTR_aromatics_like, The C-terminal 9e-16
PRK11013309 PRK11013, PRK11013, DNA-binding transcriptional re 5e-15
PRK09906296 PRK09906, PRK09906, DNA-binding transcriptional re 5e-15
cd08412198 cd08412, PBP2_PAO1_like, The C-terminal substrate- 1e-13
PRK09986294 PRK09986, PRK09986, DNA-binding transcriptional ac 2e-13
PRK10837290 PRK10837, PRK10837, putative DNA-binding transcrip 9e-13
cd08438197 cd08438, PBP2_CidR, The C-terminal substrate bindi 3e-12
cd08426199 cd08426, PBP2_LTTR_like_5, The C-terminal substrat 4e-12
pfam0012660 pfam00126, HTH_1, Bacterial regulatory helix-turn- 9e-12
cd08456196 cd08456, PBP2_LysR, The C-terminal substrate bindi 6e-11
PRK11151305 PRK11151, PRK11151, DNA-binding transcriptional re 6e-11
cd08433198 cd08433, PBP2_Nac, The C-teminal substrate binding 4e-10
cd08457196 cd08457, PBP2_OccR, The C-terminal substrate-domai 7e-10
cd08435201 cd08435, PBP2_GbpR, The C-terminal substrate bindi 1e-09
cd08411200 cd08411, PBP2_OxyR, The C-terminal substrate-bindi 2e-09
PRK10086311 PRK10086, PRK10086, DNA-binding transcriptional re 4e-09
cd08436194 cd08436, PBP2_LTTR_like_3, The C-terminal substrat 4e-09
PRK11716269 PRK11716, PRK11716, DNA-binding transcriptional re 5e-09
cd08451199 cd08451, PBP2_BudR, The C-terminal substrate bindi 5e-09
PRK15421317 PRK15421, PRK15421, DNA-binding transcriptional re 9e-09
TIGR03418291 TIGR03418, chol_sulf_TF, putative choline sulfate- 2e-08
cd08421198 cd08421, PBP2_LTTR_like_1, The C-terminal substrat 4e-08
cd08427195 cd08427, PBP2_LTTR_like_2, The C-terminal substrat 1e-07
TIGR02036302 TIGR02036, dsdC, D-serine deaminase transcriptiona 2e-07
cd08417200 cd08417, PBP2_Nitroaromatics_like, The C-terminal 3e-07
PRK10341312 PRK10341, PRK10341, DNA-binding transcriptional ac 3e-07
PRK11233305 PRK11233, PRK11233, nitrogen assimilation transcri 8e-07
PRK11139297 PRK11139, PRK11139, DNA-binding transcriptional ac 9e-07
cd08418201 cd08418, PBP2_TdcA, The C-terminal substrate bindi 1e-06
cd08437198 cd08437, PBP2_MleR, The substrate binding domain o 1e-06
cd08442193 cd08442, PBP2_YofA_SoxR_like, The C-terminal subst 2e-06
cd08425197 cd08425, PBP2_CynR, The C-terminal substrate-bindi 1e-05
cd08423200 cd08423, PBP2_LTTR_like_6, The C-terminal substrat 1e-05
cd08448197 cd08448, PBP2_LTTR_aromatics_like_2, The C-termina 1e-05
cd08449197 cd08449, PBP2_XapR, The C-terminal substrate bindi 1e-05
cd08441198 cd08441, PBP2_MetR, The C-terminal substrate bindi 4e-05
PRK10632309 PRK10632, PRK10632, transcriptional regulator; Pro 4e-05
cd08452197 cd08452, PBP2_AlsR, The C-terminal substrate bindi 5e-05
cd08416199 cd08416, PBP2_MdcR, The C-terminal substrate-bindi 9e-05
cd08461198 cd08461, PBP2_DntR_like_3, The C-terminal substrat 1e-04
PRK09508314 PRK09508, leuO, leucine transcriptional activator; 2e-04
cd08430199 cd08430, PBP2_IlvY, The C-terminal substrate bindi 3e-04
PRK03601275 PRK03601, PRK03601, transcriptional regulator HdfR 5e-04
PRK15092310 PRK15092, PRK15092, DNA-binding transcriptional re 6e-04
PRK10082303 PRK10082, PRK10082, cell density-dependent motilit 7e-04
cd08447198 cd08447, PBP2_LTTR_aromatics_like_1, The C-termina 0.002
cd08459201 cd08459, PBP2_DntR_NahR_LinR_like, The C-terminal 0.003
>gnl|CDD|237173 PRK12684, PRK12684, transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
 Score =  504 bits (1301), Expect = 0.0
 Identities = 190/306 (62%), Positives = 252/306 (82%)

Query: 1   MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLT 60
           MNLHQ RFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELE+EL ++IF RHGKR+RGLT
Sbjct: 1   MNLHQLRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEDELGVEIFTRHGKRLRGLT 60

Query: 61  KPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFP 120
           +PG+ IL S+E I+QE+E LK++GKEF+A D GNLTIATTHTQARYALP  IKEF  ++P
Sbjct: 61  EPGRIILASVERILQEVENLKRVGKEFAAQDQGNLTIATTHTQARYALPAAIKEFKKRYP 120

Query: 121 KVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLL 180
           KV+LS+LQG+P QI EM+ + QAD+AI TE ++   +L+S+PCYQW + ++VP DHPLL 
Sbjct: 121 KVRLSILQGSPTQIAEMVLHGQADLAIATEAIADYKELVSLPCYQWNHCVVVPPDHPLLE 180

Query: 181 LNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGI 240
              ++L++++ YPLITYD +F+GR K+++ F+L+ L P IVLE I++D+IKTYVEL +G+
Sbjct: 181 RKPLTLEDLAQYPLITYDFAFAGRSKINKAFALRGLKPDIVLEAIDADVIKTYVELGLGV 240

Query: 241 GIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFI 300
           GI+A +AFD  RD+NLR+I A HLFG++ +R+ +++G YLR YVY+FI+L +P LNRK +
Sbjct: 241 GIVADMAFDPERDRNLRAIDAGHLFGSSTTRLGLRRGAYLRGYVYTFIELFAPTLNRKLV 300

Query: 301 NKILNN 306
            + L  
Sbjct: 301 EQALKG 306


Length = 313

>gnl|CDD|183679 PRK12682, PRK12682, transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|237172 PRK12683, PRK12683, transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|183678 PRK12681, cysB, transcriptional regulator CysB; Reviewed Back     alignment and domain information
>gnl|CDD|176105 cd08413, PBP2_CysB_like, The C-terminal substrate domain of LysR-type transcriptional regulators CysB-like contains type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|183676 PRK12679, cbl, transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>gnl|CDD|176135 cd08444, PBP2_Cbl, The C-terminal substrate binding domain of LysR-type transcriptional regulator Cbl, which is required for expression of sulfate starvation-inducible (ssi) genes, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176134 cd08443, PBP2_CysB, The C-terminal substrate domain of LysR-type transcriptional regulator CysB contains type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|183677 PRK12680, PRK12680, transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|223656 COG0583, LysR, Transcriptional regulator [Transcription] Back     alignment and domain information
>gnl|CDD|176102 cd05466, PBP2_LTTR_substrate, The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>gnl|CDD|217576 pfam03466, LysR_substrate, LysR substrate binding domain Back     alignment and domain information
>gnl|CDD|176112 cd08420, PBP2_CysL_like, C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176125 cd08434, PBP2_GltC_like, The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|132382 TIGR03339, phn_lysR, aminoethylphosphonate catabolism associated LysR family transcriptional regulator Back     alignment and domain information
>gnl|CDD|176107 cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|183051 PRK11242, PRK11242, DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>gnl|CDD|176131 cd08440, PBP2_LTTR_like_4, TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176111 cd08419, PBP2_CbbR_RubisCO_like, The C-terminal substrate binding of LysR-type transcriptional regulator (CbbR) of RubisCO operon, which is involved in the carbon dioxide fixation, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|177082 CHL00180, rbcR, LysR transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|182077 PRK09791, PRK09791, putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|233862 TIGR02424, TF_pcaQ, pca operon transcription factor PcaQ Back     alignment and domain information
>gnl|CDD|176106 cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|236819 PRK11013, PRK11013, DNA-binding transcriptional regulator LysR; Provisional Back     alignment and domain information
>gnl|CDD|182137 PRK09906, PRK09906, DNA-binding transcriptional regulator HcaR; Provisional Back     alignment and domain information
>gnl|CDD|176104 cd08412, PBP2_PAO1_like, The C-terminal substrate-binding domain of putative LysR-type transcriptional regulator PAO1-like, a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>gnl|CDD|182183 PRK09986, PRK09986, DNA-binding transcriptional activator XapR; Provisional Back     alignment and domain information
>gnl|CDD|182768 PRK10837, PRK10837, putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|176129 cd08438, PBP2_CidR, The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176117 cd08426, PBP2_LTTR_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|215735 pfam00126, HTH_1, Bacterial regulatory helix-turn-helix protein, lysR family Back     alignment and domain information
>gnl|CDD|176145 cd08456, PBP2_LysR, The C-terminal substrate binding domain of LysR, transcriptional regulator for lysine biosynthesis, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|182999 PRK11151, PRK11151, DNA-binding transcriptional regulator OxyR; Provisional Back     alignment and domain information
>gnl|CDD|176124 cd08433, PBP2_Nac, The C-teminal substrate binding domain of LysR-like nitrogen assimilation control (NAC) protein, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176146 cd08457, PBP2_OccR, The C-terminal substrate-domain of LysR-type transcriptional regulator, OccR, involved in the catabolism of octopine, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176126 cd08435, PBP2_GbpR, The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176103 cd08411, PBP2_OxyR, The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>gnl|CDD|182231 PRK10086, PRK10086, DNA-binding transcriptional regulator DsdC; Provisional Back     alignment and domain information
>gnl|CDD|176127 cd08436, PBP2_LTTR_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|236961 PRK11716, PRK11716, DNA-binding transcriptional regulator IlvY; Provisional Back     alignment and domain information
>gnl|CDD|176142 cd08451, PBP2_BudR, The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|185319 PRK15421, PRK15421, DNA-binding transcriptional regulator MetR; Provisional Back     alignment and domain information
>gnl|CDD|188320 TIGR03418, chol_sulf_TF, putative choline sulfate-utilization transcription factor Back     alignment and domain information
>gnl|CDD|176113 cd08421, PBP2_LTTR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176118 cd08427, PBP2_LTTR_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|131091 TIGR02036, dsdC, D-serine deaminase transcriptional activator Back     alignment and domain information
>gnl|CDD|176109 cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|182391 PRK10341, PRK10341, DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>gnl|CDD|183045 PRK11233, PRK11233, nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|182990 PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional Back     alignment and domain information
>gnl|CDD|176110 cd08418, PBP2_TdcA, The C-terminal substrate binding domain of LysR-type transcriptional regulator TdcA, which is involved in the degradation of L-serine and L-threonine, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176128 cd08437, PBP2_MleR, The substrate binding domain of LysR-type transcriptional regulator MleR which required for malolactic fermentation, contains type 2 periplasmic binidning fold Back     alignment and domain information
>gnl|CDD|176133 cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176116 cd08425, PBP2_CynR, The C-terminal substrate-binding domain of the LysR-type transcriptional regulator CynR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176115 cd08423, PBP2_LTTR_like_6, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176139 cd08448, PBP2_LTTR_aromatics_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176140 cd08449, PBP2_XapR, The C-terminal substrate binding domain of LysR-type transcriptional regulator XapR involved in xanthosine catabolism, contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176132 cd08441, PBP2_MetR, The C-terminal substrate binding domain of LysR-type transcriptional regulator metR, which regulates the expression of methionine biosynthetic genes, contains type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|182601 PRK10632, PRK10632, transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|176143 cd08452, PBP2_AlsR, The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176108 cd08416, PBP2_MdcR, The C-terminal substrate-binding domian of LysR-type transcriptional regulator MdcR, which involved in the malonate catabolism contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176150 cd08461, PBP2_DntR_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|181918 PRK09508, leuO, leucine transcriptional activator; Reviewed Back     alignment and domain information
>gnl|CDD|176121 cd08430, PBP2_IlvY, The C-terminal substrate binding of LysR-type transcriptional regulator IlvY, which activates the expression of ilvC gene that encoding acetohydroxy acid isomeroreductase for the biosynthesis of branched amino acids; contains the type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|235137 PRK03601, PRK03601, transcriptional regulator HdfR; Provisional Back     alignment and domain information
>gnl|CDD|237907 PRK15092, PRK15092, DNA-binding transcriptional repressor LrhA; Provisional Back     alignment and domain information
>gnl|CDD|182228 PRK10082, PRK10082, cell density-dependent motility repressor; Provisional Back     alignment and domain information
>gnl|CDD|176138 cd08447, PBP2_LTTR_aromatics_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold Back     alignment and domain information
>gnl|CDD|176148 cd08459, PBP2_DntR_NahR_LinR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 306
PRK12681324 cysB transcriptional regulator CysB; Reviewed 100.0
PRK12682309 transcriptional regulator CysB-like protein; Revie 100.0
PRK12683309 transcriptional regulator CysB-like protein; Revie 100.0
PRK12684313 transcriptional regulator CysB-like protein; Revie 100.0
PRK11151305 DNA-binding transcriptional regulator OxyR; Provis 100.0
PRK12679316 cbl transcriptional regulator Cbl; Reviewed 100.0
PRK11242296 DNA-binding transcriptional regulator CynR; Provis 100.0
PRK12680327 transcriptional regulator CysB-like protein; Revie 100.0
PRK10341312 DNA-binding transcriptional activator TdcA; Provis 100.0
CHL00180305 rbcR LysR transcriptional regulator; Provisional 100.0
TIGR02424300 TF_pcaQ pca operon transcription factor PcaQ. Memb 100.0
PRK11013309 DNA-binding transcriptional regulator LysR; Provis 100.0
PRK09791302 putative DNA-binding transcriptional regulator; Pr 100.0
PRK11233305 nitrogen assimilation transcriptional regulator; P 100.0
PRK09906296 DNA-binding transcriptional regulator HcaR; Provis 100.0
PRK10837290 putative DNA-binding transcriptional regulator; Pr 100.0
PRK15421317 DNA-binding transcriptional regulator MetR; Provis 100.0
PRK09986294 DNA-binding transcriptional activator XapR; Provis 100.0
TIGR03339279 phn_lysR aminoethylphosphonate catabolism associat 100.0
PRK09508314 leuO leucine transcriptional activator; Reviewed 100.0
PRK11074300 putative DNA-binding transcriptional regulator; Pr 100.0
PRK15243297 transcriptional regulator SpvR; Provisional 100.0
PRK10094308 DNA-binding transcriptional activator AllS; Provis 100.0
PRK11062296 nhaR transcriptional activator NhaR; Provisional 100.0
PRK09801310 transcriptional activator TtdR; Provisional 100.0
PRK11139297 DNA-binding transcriptional activator GcvA; Provis 100.0
PRK11482317 putative DNA-binding transcriptional regulator; Pr 100.0
PRK10632309 transcriptional regulator; Provisional 100.0
PRK13348294 chromosome replication initiation inhibitor protei 100.0
TIGR03298292 argP transcriptional regulator, ArgP family. ArgP 100.0
PRK03601275 transcriptional regulator HdfR; Provisional 100.0
PRK03635294 chromosome replication initiation inhibitor protei 100.0
PRK10216319 DNA-binding transcriptional regulator YidZ; Provis 100.0
PRK14997301 LysR family transcriptional regulator; Provisional 100.0
TIGR03418291 chol_sulf_TF putative choline sulfate-utilization 100.0
PRK10086311 DNA-binding transcriptional regulator DsdC; Provis 100.0
PRK10082303 cell density-dependent motility repressor; Provisi 100.0
PRK15092310 DNA-binding transcriptional repressor LrhA; Provis 100.0
TIGR02036302 dsdC D-serine deaminase transcriptional activator. 100.0
COG0583297 LysR Transcriptional regulator [Transcription] 100.0
PRK11716269 DNA-binding transcriptional regulator IlvY; Provis 100.0
PF03466209 LysR_substrate: LysR substrate binding domain; Int 100.0
cd08444198 PBP2_Cbl The C-terminal substrate binding domain o 99.97
cd08413198 PBP2_CysB_like The C-terminal substrate domain of 99.97
cd08421198 PBP2_LTTR_like_1 The C-terminal substrate binding 99.97
cd08411200 PBP2_OxyR The C-terminal substrate-binding domain 99.97
cd08459201 PBP2_DntR_NahR_LinR_like The C-terminal substrate 99.97
cd08433198 PBP2_Nac The C-teminal substrate binding domain of 99.97
cd08437198 PBP2_MleR The substrate binding domain of LysR-typ 99.97
cd08435201 PBP2_GbpR The C-terminal substrate binding domain 99.97
cd08438197 PBP2_CidR The C-terminal substrate binding domain 99.97
cd08443198 PBP2_CysB The C-terminal substrate domain of LysR- 99.97
cd08417200 PBP2_Nitroaromatics_like The C-terminal substrate 99.97
cd08440197 PBP2_LTTR_like_4 TThe C-terminal substrate binding 99.97
cd08426199 PBP2_LTTR_like_5 The C-terminal substrate binding 99.97
cd08412198 PBP2_PAO1_like The C-terminal substrate-binding do 99.97
cd08425197 PBP2_CynR The C-terminal substrate-binding domain 99.97
cd08434195 PBP2_GltC_like The substrate binding domain of Lys 99.97
cd08436194 PBP2_LTTR_like_3 The C-terminal substrate binding 99.97
cd08415196 PBP2_LysR_opines_like The C-terminal substrate-dom 99.97
cd08464200 PBP2_DntR_like_2 The C-terminal substrate binding 99.97
cd08463203 PBP2_DntR_like_4 The C-terminal substrate binding 99.97
cd08420201 PBP2_CysL_like C-terminal substrate binding domain 99.96
cd08418201 PBP2_TdcA The C-terminal substrate binding domain 99.96
cd08458196 PBP2_NocR The C-terminal substrate-domain of LysR- 99.96
cd08456196 PBP2_LysR The C-terminal substrate binding domain 99.96
cd08423200 PBP2_LTTR_like_6 The C-terminal substrate binding 99.96
cd08460200 PBP2_DntR_like_1 The C-terminal substrate binding 99.96
cd08419197 PBP2_CbbR_RubisCO_like The C-terminal substrate bi 99.96
cd08462200 PBP2_NodD The C-terminal substsrate binding domain 99.96
cd08466200 PBP2_LeuO The C-terminal substrate binding domain 99.96
cd08467200 PBP2_SyrM The C-terminal substrate binding of LysR 99.96
cd08414197 PBP2_LTTR_aromatics_like The C-terminal substrate 99.96
cd08441198 PBP2_MetR The C-terminal substrate binding domain 99.96
cd08453200 PBP2_IlvR The C-terminal substrate binding domain 99.96
cd08442193 PBP2_YofA_SoxR_like The C-terminal substrate bindi 99.96
cd08449197 PBP2_XapR The C-terminal substrate binding domain 99.96
cd08486198 PBP2_CbnR The C-terminal substrate binding domain 99.96
cd08461198 PBP2_DntR_like_3 The C-terminal substrate binding 99.96
cd08468202 PBP2_Pa0477 The C-terminal substrate biniding doma 99.96
cd08446198 PBP2_Chlorocatechol The C-terminal substrate bindi 99.96
cd08450196 PBP2_HcaR The C-terminal substrate binding domain 99.96
cd08457196 PBP2_OccR The C-terminal substrate-domain of LysR- 99.96
cd08427195 PBP2_LTTR_like_2 The C-terminal substrate binding 99.96
cd08445203 PBP2_BenM_CatM_CatR The C-terminal substrate bindi 99.96
cd08430199 PBP2_IlvY The C-terminal substrate binding of LysR 99.96
cd08485198 PBP2_ClcR The C-terminal substrate binding domain 99.96
cd08416199 PBP2_MdcR The C-terminal substrate-binding domian 99.96
cd08448197 PBP2_LTTR_aromatics_like_2 The C-terminal substrat 99.96
cd08469221 PBP2_PnbR The C-terminal substrate binding domain 99.96
cd08429204 PBP2_NhaR The C-terminal substrate binding domain 99.96
cd08451199 PBP2_BudR The C-terminal substrate binding domain 99.95
cd05466197 PBP2_LTTR_substrate The substrate binding domain o 99.95
cd08465200 PBP2_ToxR The C-terminal substrate binding domain 99.95
cd08452197 PBP2_AlsR The C-terminal substrate binding domain 99.95
cd08447198 PBP2_LTTR_aromatics_like_1 The C-terminal substrat 99.95
cd08431195 PBP2_HupR The C-terminal substrate binding domain 99.94
cd08432194 PBP2_GcdR_TrpI_HvrB_AmpR_like The C-terminal subst 99.93
cd08475199 PBP2_CrgA_like_6 The C-terminal substrate binding 99.93
cd08471201 PBP2_CrgA_like_2 The C-terminal substrate binding 99.93
cd08478199 PBP2_CrgA The C-terminal substrate binding domain 99.93
cd08422197 PBP2_CrgA_like The C-terminal substrate binding do 99.93
cd08481194 PBP2_GcdR_like The C-terminal substrate binding do 99.92
cd08474202 PBP2_CrgA_like_5 The C-terminal substrate binding 99.92
cd08472202 PBP2_CrgA_like_3 The C-terminal substrate binding 99.92
cd08477197 PBP2_CrgA_like_8 The C-terminal substrate binding 99.92
cd08479198 PBP2_CrgA_like_9 The C-terminal substrate binding 99.91
cd08439185 PBP2_LrhA_like The C-terminal substrate domain of 99.91
cd08428195 PBP2_IciA_ArgP The C-terminal substrate binding do 99.91
cd08470197 PBP2_CrgA_like_1 The C-terminal substrate binding 99.91
cd08473202 PBP2_CrgA_like_4 The C-terminal substrate binding 99.91
cd08476197 PBP2_CrgA_like_7 The C-terminal substrate binding 99.91
TIGR0063799 ModE_repress ModE molybdate transport repressor do 99.9
cd08483190 PBP2_HvrB The C-terminal substrate-binding domain 99.9
PF0012660 HTH_1: Bacterial regulatory helix-turn-helix prote 99.9
TIGR02136287 ptsS_2 phosphate binding protein. Members of this 99.9
cd08480198 PBP2_CrgA_like_10 The C-terminal substrate binding 99.89
cd08482195 PBP2_TrpI The C-terminal substrate binding domain 99.89
cd08488191 PBP2_AmpR The C-terminal substrate domain of LysR- 99.89
cd08487189 PBP2_BlaA The C-terminal substrate-binding domain 99.89
cd08484189 PBP2_LTTR_beta_lactamase The C-terminal substrate- 99.88
PRK14498633 putative molybdopterin biosynthesis protein MoeA/L 99.83
PRK10676263 DNA-binding transcriptional regulator ModE; Provis 99.81
PF12727193 PBP_like: PBP superfamily domain; InterPro: IPR024 99.44
PRK11553314 alkanesulfonate transporter substrate-binding subu 99.33
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 99.2
COG2005130 ModE N-terminal domain of molybdenum-binding prote 99.19
cd00134218 PBPb Bacterial periplasmic transport systems use m 99.02
TIGR02122320 TRAP_TAXI TRAP transporter solute receptor, TAXI f 99.01
TIGR01728288 SsuA_fam ABC transporter, substrate-binding protei 98.9
PRK0972968 hypothetical protein; Provisional 98.87
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 98.82
PF13531230 SBP_bac_11: Bacterial extracellular solute-binding 98.79
PF12849281 PBP_like_2: PBP superfamily domain; InterPro: IPR0 98.61
COG2998280 TupB ABC-type tungstate transport system, permease 98.61
COG0725258 ModA ABC-type molybdate transport system, periplas 98.49
PRK11050152 manganese transport regulator MntR; Provisional 98.48
TIGR01256216 modA molybdenum ABC transporter, periplasmic molyb 98.48
COG1910223 Periplasmic molybdate-binding protein/domain [Inor 98.47
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 98.42
PRK10677257 modA molybdate transporter periplasmic protein; Pr 98.41
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 98.4
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory 98.39
TIGR00975314 3a0107s03 phosphate ABC transporter, phosphate-bin 98.37
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 98.29
PRK03902142 manganese transport transcriptional regulator; Pro 98.26
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 98.22
TIGR03730273 tungstate_WtpA tungstate ABC transporter binding p 98.2
PRK04168334 molybdate ABC transporter periplasmic substrate-bi 98.03
PRK11260266 cystine transporter subunit; Provisional 97.92
PF1355659 HTH_30: PucR C-terminal helix-turn-helix domain; P 97.85
PRK09495247 glnH glutamine ABC transporter periplasmic protein 97.82
TIGR00363258 lipoprotein, YaeC family. This family of putative 97.8
PRK13777185 transcriptional regulator Hpr; Provisional 97.8
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 97.78
COG0226318 PstS ABC-type phosphate transport system, periplas 97.77
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 97.76
PRK14165217 winged helix-turn-helix domain-containing protein/ 97.76
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 97.74
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 97.72
PRK10797302 glutamate and aspartate transporter subunit; Provi 97.7
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 97.7
PRK03573144 transcriptional regulator SlyA; Provisional 97.68
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 97.65
PF13379252 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_ 97.6
PRK10918346 phosphate ABC transporter periplasmic substrate-bi 97.58
PRK11063271 metQ DL-methionine transporter substrate-binding s 97.58
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 97.57
COG1321154 TroR Mn-dependent transcriptional regulator [Trans 97.55
COG1846126 MarR Transcriptional regulators [Transcription] 97.54
PRK09861272 cytoplasmic membrane lipoprotein-28; Provisional 97.53
PRK10870176 transcriptional repressor MprA; Provisional 97.48
PF0295442 HTH_8: Bacterial regulatory protein, Fis family; I 97.47
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 97.4
TIGR02285268 conserved hypothetical protein. Members of this fa 97.37
PRK15010260 ABC transporter lysine/arginine/ornithine binding 97.36
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 97.33
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 97.32
TIGR01729300 taurine_ABC_bnd taurine ABC transporter, periplasm 97.3
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 97.3
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 97.3
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 97.29
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 97.28
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 97.27
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 97.24
TIGR03414290 ABC_choline_bnd choline ABC transporter, periplasm 97.22
COG165479 BirA Biotin operon repressor [Transcription] 97.17
TIGR01276309 thiB thiamine ABC transporter, periplasmic binding 97.08
PRK15437259 histidine ABC transporter substrate-binding protei 97.07
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 97.05
PRK15007243 putative ABC transporter arginine-biding protein; 97.04
PF0904859 Cro: Cro; InterPro: IPR000655 Bacteriophage lambda 97.03
COG4742260 Predicted transcriptional regulator [Transcription 97.03
TIGR03261334 phnS2 putative 2-aminoethylphosphonate ABC transpo 97.01
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 96.98
PF03180237 Lipoprotein_9: NLPA lipoprotein; InterPro: IPR0048 96.97
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 96.92
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 96.91
PF09084216 NMT1: NMT1/THI5 like; InterPro: IPR015168 This ent 96.89
PHA00738108 putative HTH transcription regulator 96.88
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 96.85
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 96.85
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 96.8
PF04069257 OpuAC: Substrate binding domain of ABC-type glycin 96.79
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 96.74
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 96.71
PRK11480320 tauA taurine transporter substrate binding subunit 96.71
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 96.69
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 96.64
TIGR00971315 3a0106s03 sulfate/thiosulfate-binding protein. Thi 96.63
COG2358321 Imp TRAP-type uncharacterized transport system, pe 96.55
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 96.54
PRK11119331 proX glycine betaine transporter periplasmic subun 96.54
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 96.54
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 96.47
PRK10852338 thiosulfate transporter subunit; Provisional 96.46
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 96.39
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 96.38
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 96.36
PF1301185 LZ_Tnp_IS481: leucine-zipper of insertion element 96.32
COG4623 473 Predicted soluble lytic transglycosylase fused to 96.25
COG1339214 Transcriptional regulator of a riboflavin/FAD bios 96.25
PF1351852 HTH_28: Helix-turn-helix domain 96.24
PRK10434256 srlR DNA-bindng transcriptional repressor SrlR; Pr 96.24
PRK11205330 tbpA thiamine transporter substrate binding subuni 96.22
PF0163890 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002 96.21
PF0522545 HTH_psq: helix-turn-helix, Psq domain; InterPro: I 96.18
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phos 96.18
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 96.18
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 96.12
TIGR02702203 SufR_cyano iron-sulfur cluster biosynthesis transc 96.09
PRK09959 1197 hybrid sensory histidine kinase in two-component r 96.07
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 95.97
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 95.93
PRK0190577 DNA-binding protein Fis; Provisional 95.9
COG0715335 TauA ABC-type nitrate/sulfonate/bicarbonate transp 95.87
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 95.83
PRK09959 1197 hybrid sensory histidine kinase in two-component r 95.79
PF0745337 NUMOD1: NUMOD1 domain; InterPro: IPR010896 This he 95.79
COG134299 Predicted DNA-binding proteins [General function p 95.77
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 95.68
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 95.66
PRK04217110 hypothetical protein; Provisional 95.64
PF0911496 MotA_activ: Transcription factor MotA, activation 95.5
PF1454960 P22_Cro: DNA-binding transcriptional regulator Cro 95.48
PRK09834263 DNA-binding transcriptional activator MhpR; Provis 95.44
PRK13509251 transcriptional repressor UlaR; Provisional 95.37
PRK11886319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 95.35
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 95.35
COG1733120 Predicted transcriptional regulators [Transcriptio 95.34
COG1609333 PurR Transcriptional regulators [Transcription] 95.33
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 95.31
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 95.26
COG3888321 Predicted transcriptional regulator [Transcription 95.26
PF02001106 DUF134: Protein of unknown function DUF134; InterP 95.24
PHA0259183 hypothetical protein; Provisional 95.2
PRK0043095 fis global DNA-binding transcriptional dual regula 95.15
cd0657190 Bac_DnaA_C C-terminal domain of bacterial DnaA pro 95.12
COG1522154 Lrp Transcriptional regulators [Transcription] 95.1
COG2522119 Predicted transcriptional regulator [General funct 95.07
PRK11169164 leucine-responsive transcriptional regulator; Prov 94.97
PF02621251 VitK2_biosynth: Menaquinone biosynthesis; InterPro 94.96
TIGR03427 328 ABC_peri_uca ABC transporter periplasmic binding p 94.96
smart0049753 IENR1 Intron encoded nuclease repeat motif. Repeat 94.91
COG2508421 Regulator of polyketide synthase expression [Signa 94.86
COG0834275 HisJ ABC-type amino acid transport/signal transduc 94.86
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 94.84
PRK09413121 IS2 repressor TnpA; Reviewed 94.81
PRK10906252 DNA-binding transcriptional repressor GlpR; Provis 94.79
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 94.79
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 94.71
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 94.62
TIGR01254304 sfuA ABC transporter periplasmic binding protein, 94.49
PRK00118104 putative DNA-binding protein; Validated 94.38
COG1732300 OpuBC Periplasmic glycine betaine/choline-binding 94.25
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 94.23
PRK01686215 hisG ATP phosphoribosyltransferase catalytic subun 94.17
PRK15201198 fimbriae regulatory protein FimW; Provisional 94.16
TIGR00721137 tfx DNA-binding protein, Tfx family. Tfx from Meth 94.13
PF1373055 HTH_36: Helix-turn-helix domain 94.09
COG4190144 Predicted transcriptional regulator [Transcription 94.08
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 94.07
smart00351125 PAX Paired Box domain. 94.06
PRK05638442 threonine synthase; Validated 94.05
TIGR03227367 PhnS 2-aminoethylphosphonate ABC transporter, peri 94.03
PF01379215 Porphobil_deam: Porphobilinogen deaminase, dipyrom 94.01
PRK0974475 DNA-binding transcriptional regulator DicC; Provis 93.96
PF0828059 HTH_Mga: M protein trans-acting positive regulator 93.96
PF01634163 HisG: ATP phosphoribosyltransferase; InterPro: IPR 93.8
PRK10411240 DNA-binding transcriptional activator FucR; Provis 93.78
COG0040290 HisG ATP phosphoribosyltransferase [Amino acid tra 93.77
PRK11477385 carbohydrate diacid transcriptional activator CdaR 93.6
PF1361353 HTH_Tnp_4: Helix-turn-helix of DDE superfamily end 93.58
cd00131128 PAX Paired Box domain 93.52
PRK14987331 gluconate operon transcriptional regulator; Provis 93.5
COG1349253 GlpR Transcriptional regulators of sugar metabolis 93.48
PF13551112 HTH_29: Winged helix-turn helix 93.44
TIGR02719138 repress_PhaQ poly-beta-hydroxybutyrate-responsive 93.41
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 93.26
PRK03975141 tfx putative transcriptional regulator; Provisiona 93.23
PF04297101 UPF0122: Putative helix-turn-helix protein, YlxM / 93.23
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 93.22
PRK10423327 transcriptional repressor RbsR; Provisional 93.19
COG3221299 PhnD ABC-type phosphate/phosphonate transport syst 93.17
TIGR03433100 padR_acidobact transcriptional regulator, Acidobac 93.06
PF0534465 DUF746: Domain of Unknown Function (DUF746); Inter 93.05
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 92.97
COG4189308 Predicted transcriptional regulator [Transcription 92.91
COG277165 CsgD DNA-binding HTH domain-containing proteins [T 92.88
PRK10163271 DNA-binding transcriptional repressor AllR; Provis 92.83
PHA0054282 putative Cro-like protein 92.78
COG0181307 HemC Porphobilinogen deaminase [Coenzyme metabolis 92.62
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 92.61
PRK10752329 sulfate transporter subunit; Provisional 92.6
PF0504387 Mga: Mga helix-turn-helix domain; InterPro: IPR007 92.57
PRK09802269 DNA-binding transcriptional regulator AgaR; Provis 92.57
PRK15320251 transcriptional activator SprB; Provisional 92.34
PF0822261 HTH_CodY: CodY helix-turn-helix domain; InterPro: 92.26
TIGR00498199 lexA SOS regulatory protein LexA. LexA acts as a h 92.25
COG1497260 Predicted transcriptional regulator [Transcription 92.16
TIGR02431248 pcaR_pcaU beta-ketoadipate pathway transcriptional 92.14
PRK10727343 DNA-binding transcriptional regulator GalR; Provis 92.05
PRK00082339 hrcA heat-inducible transcription repressor; Provi 91.92
PF14424133 Toxin-deaminase: The BURPS668_1122 family of deami 91.82
PRK10840216 transcriptional regulator RcsB; Provisional 91.63
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 91.57
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 91.55
COG419796 Uncharacterized protein conserved in bacteria, pro 91.5
TIGR0253188 yecD_yerC TrpR-related protein YerC/YecD. This mod 91.37
PRK10703341 DNA-binding transcriptional repressor PurR; Provis 91.33
PRK10401346 DNA-binding transcriptional regulator GalS; Provis 91.3
TIGR03541232 reg_near_HchA LuxR family transcriptional regulato 91.19
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 91.19
PF0344478 HrcA_DNA-bdg: Winged helix-turn-helix transcriptio 91.15
PRK10188240 DNA-binding transcriptional activator SdiA; Provis 91.11
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 91.1
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 91.07
TIGR00070182 hisG ATP phosphoribosyltransferase. Members of thi 91.02
cd0476368 HTH_MlrA-like Helix-Turn-Helix DNA binding domain 90.98
PRK11569274 transcriptional repressor IclR; Provisional 90.76
PLN02245403 ATP phosphoribosyl transferase 90.71
COG1464268 NlpA ABC-type metal ion transport system, periplas 90.67
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 90.64
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 90.59
PRK15411207 rcsA colanic acid capsular biosynthesis activation 90.57
PRK13719217 conjugal transfer transcriptional regulator TraJ; 90.49
COG3355126 Predicted transcriptional regulator [Transcription 90.48
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 90.09
COG1414246 IclR Transcriptional regulator [Transcription] 90.08
COG2739105 Uncharacterized protein conserved in bacteria [Fun 89.97
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 89.92
PRK06474178 hypothetical protein; Provisional 89.87
cd0476249 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain 89.85
PRK09483217 response regulator; Provisional 89.7
PRK01066231 porphobilinogen deaminase; Provisional 89.66
PRK09775 442 putative DNA-binding transcriptional regulator; Pr 89.59
PRK13870234 transcriptional regulator TraR; Provisional 89.53
cd0476467 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom 89.49
PRK10014342 DNA-binding transcriptional repressor MalI; Provis 89.45
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 89.42
PRK00072295 hemC porphobilinogen deaminase; Reviewed 89.35
TIGR0176449 excise DNA binding domain, excisionase family. An 89.29
COG2512258 Predicted membrane-associated trancriptional regul 89.26
PRK09954362 putative kinase; Provisional 89.2
PF1272851 HTH_17: Helix-turn-helix domain 89.18
cd00494292 HMBS Hydroxymethylbilane synthase (HMBS), also kno 89.12
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 89.01
PF0846166 HTH_12: Ribonuclease R winged-helix domain; InterP 88.92
PRK15046349 2-aminoethylphosphonate ABC transporter substrate- 88.88
PF1374480 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_ 88.61
COG1568354 Predicted methyltransferases [General function pre 88.44
TIGR02405311 trehalos_R_Ecol trehalose operon repressor, proteo 88.41
PRK00215205 LexA repressor; Validated 88.37
COG1910223 Periplasmic molybdate-binding protein/domain [Inor 88.14
PF03401274 TctC: Tripartite tricarboxylate transporter family 88.05
PRK09526342 lacI lac repressor; Reviewed 88.01
PRK15090257 DNA-binding transcriptional regulator KdgR; Provis 87.96
PF0702266 Phage_CI_repr: Bacteriophage CI repressor helix-tu 87.55
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 87.39
PF05732165 RepL: Firmicute plasmid replication protein (RepL) 87.36
PF12727193 PBP_like: PBP superfamily domain; InterPro: IPR024 87.1
TIGR0268489 dnstrm_HI1420 probable addiction module antidote p 87.09
PRK10651216 transcriptional regulator NarL; Provisional 87.01
PF1330964 HTH_22: HTH domain 86.93
cd0110468 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain 86.88
COG1458221 Predicted DNA-binding protein containing PIN domai 86.82
PF0141877 HTH_6: Helix-turn-helix domain, rpiR family; Inter 86.53
PRK13325 592 bifunctional biotin--[acetyl-CoA-carboxylase] liga 86.45
COG1725125 Predicted transcriptional regulators [Transcriptio 86.35
PHA02943165 hypothetical protein; Provisional 86.33
PRK13583228 hisG ATP phosphoribosyltransferase catalytic subun 86.29
PF0204252 RWP-RK: RWP-RK domain; InterPro: IPR003035 This do 86.21
PF0237687 CUT: CUT domain; InterPro: IPR003350 A class, also 86.16
TIGR02277280 PaaX_trns_reg phenylacetic acid degradation operon 85.96
cd0476149 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of 85.81
PRK09492315 treR trehalose repressor; Provisional 85.66
PRK12423202 LexA repressor; Provisional 85.51
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator, 85.1
COG3877122 Uncharacterized protein conserved in bacteria [Fun 85.05
PRK15369211 two component system sensor kinase SsrB; Provision 84.98
PRK10681252 DNA-binding transcriptional repressor DeoR; Provis 84.75
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 84.74
PF0131670 Arg_repressor: Arginine repressor, DNA binding dom 84.68
PRK09333150 30S ribosomal protein S19e; Provisional 84.65
COG3388101 Predicted transcriptional regulator [Transcription 84.53
PRK10403215 transcriptional regulator NarP; Provisional 84.47
smart00094 332 TR_FER Transferrin. 84.44
PF1450248 HTH_41: Helix-turn-helix domain 84.35
COG2197211 CitB Response regulator containing a CheY-like rec 84.19
COG1510177 Predicted transcriptional regulators [Transcriptio 84.14
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 83.8
PRK13182175 racA polar chromosome segregation protein; Reviewe 83.65
COG4588252 AcfC Accessory colonization factor AcfC, contains 83.57
COG3415138 Transposase and inactivated derivatives [DNA repli 83.51
COG2345218 Predicted transcriptional regulator [Transcription 83.51
PF13343242 SBP_bac_6: Bacterial extracellular solute-binding 83.43
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 83.21
PF1197254 HTH_13: HTH DNA binding domain; InterPro: IPR02106 83.1
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 83.08
PRK09416135 lstR lineage-specific thermal regulator protein; P 82.34
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 82.15
cd0139252 HTH_LacI Helix-turn-helix (HTH) DNA binding domain 82.09
PF1211682 SpoIIID: Stage III sporulation protein D; InterPro 81.68
TIGR00331337 hrcA heat shock gene repressor HrcA. In Bacillus s 81.46
cd0476599 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding dom 81.28
PF0138155 HTH_3: Helix-turn-helix; InterPro: IPR001387 This 81.26
COG343295 Predicted transcriptional regulator [Transcription 81.22
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 81.18
PRK09863 584 putative frv operon regulatory protein; Provisiona 81.15
PF0137187 Trp_repressor: Trp repressor protein; InterPro: IP 80.97
PF01090139 Ribosomal_S19e: Ribosomal protein S19e; InterPro: 80.62
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 80.61
>PRK12681 cysB transcriptional regulator CysB; Reviewed Back     alignment and domain information
Probab=100.00  E-value=1.7e-58  Score=381.34  Aligned_cols=302  Identities=45%  Similarity=0.789  Sum_probs=277.9

Q ss_pred             CchhhHHHHHHHHHh-cCCHHHHHHHhCCCchHHHHHHHHHHHHcCceeEEecCCCccccCHhHHHHHHHHHHHHHHHHH
Q psy3760           1 MNLHQFRFVREAVRQ-NFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLTKPGQAILRSIEIIMQEIEG   79 (306)
Q Consensus         1 m~~~~l~~f~~v~~~-~~s~~~aA~~l~isq~~~s~~i~~LE~~lg~~Lf~R~~~~~~~lT~~G~~l~~~a~~il~~~~~   79 (306)
                      |++++|+||++|+++ | ||++||++||+||||||++|++||++||++||+|+++++.+||++|+.|+++++++++.+++
T Consensus         1 M~~~~L~~f~avae~g~-S~s~AA~~L~iSQpavS~~I~~LE~~lG~~LF~R~~r~~~~LT~~G~~l~~~a~~il~~~~~   79 (324)
T PRK12681          1 MKLQQLRYIVEVVNHNL-NVSATAEGLYTSQPGISKQVRMLEDELGIQIFARSGKHLTQVTPAGEEIIRIAREILSKVES   79 (324)
T ss_pred             CCHHHHHHHHHHHHccC-CHHHHHHHhcCCcHHHHHHHHHHHHHhCCEeEEECCCCCCccCHHHHHHHHHHHHHHHHHHH
Confidence            899999999999999 7 99999999999999999999999999999999999999723999999999999999999999


Q ss_pred             HHHHHHhhccCCCCcEEEEecccchhhhhHHHHHHHHHhCCCcEEEEEeCChhHHHHHHHcCCeeEEEEccccCCCCCce
Q psy3760          80 LKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLI  159 (306)
Q Consensus        80 ~~~~~~~~~~~~~~~l~I~~~~~~~~~~l~~~l~~~~~~~p~~~i~~~~~~~~~~~~~l~~~~~Di~i~~~~~~~~~~~~  159 (306)
                      +...+.+......|+|+||++++++..++++++..|.+.||++++++....++++.+.|.+|++|++|+..+....+++.
T Consensus        80 ~~~~~~~~~~~~~g~l~Ig~~~~~~~~~l~~~l~~f~~~~P~i~i~i~~~~~~~~~~~L~~g~iDl~i~~~~~~~~~~l~  159 (324)
T PRK12681         80 IKSVAGEHTWPDKGSLYIATTHTQARYALPPVIKGFIERYPRVSLHMHQGSPTQIAEAAAKGNADFAIATEALHLYDDLI  159 (324)
T ss_pred             HHHHHHHhhCCCCCeEEEEechhHHHHhhHHHHHHHHHHCCCcEEEEEeCCHHHHHHHHHcCCCCEEEecCcccCCCCeE
Confidence            99999888777889999999999999999999999999999999999999999999999999999999865423356789


Q ss_pred             eeccccceEEEEecCCCCCCCCCCcChhhhcCCCeEeecCCCCcHHHHHHHHHhCCCceeEEEEecCHHHHHHHHHhccc
Q psy3760         160 SIPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMG  239 (306)
Q Consensus       160 ~~~l~~~~~~~v~~~~~~l~~~~~i~~~dl~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~g~g  239 (306)
                      +.+++.++++++++++||++....++++||.++||+.+..+...+..++.++...|+.|++.+++++..++..++.+|.|
T Consensus       160 ~~~l~~~~~~~v~~~~hpl~~~~~~~~~~L~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~v~~g~G  239 (324)
T PRK12681        160 MLPCYHWNRSVVVPPDHPLAKKKKLTIEELAQYPLVTYVFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLG  239 (324)
T ss_pred             EEEeccceeEEEeCCCChhhcCCCcCHHHHhCCCeEeccCCCchHHHHHHHHHHcCCCCceEEEeCCHHHHHHHHHhCCC
Confidence            99999999999999999999888899999999999999887777778888898899999999999999999999999999


Q ss_pred             eeeeecceecccccCCceeeecCCCCccceEEEEEeCCccccHHHHHHHHHHhHHhhHHHHHhh
Q psy3760         240 IGIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFINKI  303 (306)
Q Consensus       240 i~~~p~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  303 (306)
                      ++++|.+.......++++.+++++......++++|+++...++.++.|++++++.+.+..++.+
T Consensus       240 i~~lp~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~fi~~~~~~~~~~~~~~~  303 (324)
T PRK12681        240 VGVIASMAVDPVADPDLVAIDASHLFSHSTTKIGFRRGTFLRSYMYDFIERFAPHLTRDVVEKA  303 (324)
T ss_pred             EEEeehhhcccccCCceEEeecCCCCCceEEEEEEECCchhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999998776554578999998775667799999999999999999999999999888877653



>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12683 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12684 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional Back     alignment and domain information
>PRK12679 cbl transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>PRK12680 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>CHL00180 rbcR LysR transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02424 TF_pcaQ pca operon transcription factor PcaQ Back     alignment and domain information
>PRK11013 DNA-binding transcriptional regulator LysR; Provisional Back     alignment and domain information
>PRK09791 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>PRK09906 DNA-binding transcriptional regulator HcaR; Provisional Back     alignment and domain information
>PRK10837 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK15421 DNA-binding transcriptional regulator MetR; Provisional Back     alignment and domain information
>PRK09986 DNA-binding transcriptional activator XapR; Provisional Back     alignment and domain information
>TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator Back     alignment and domain information
>PRK09508 leuO leucine transcriptional activator; Reviewed Back     alignment and domain information
>PRK11074 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK15243 transcriptional regulator SpvR; Provisional Back     alignment and domain information
>PRK10094 DNA-binding transcriptional activator AllS; Provisional Back     alignment and domain information
>PRK11062 nhaR transcriptional activator NhaR; Provisional Back     alignment and domain information
>PRK09801 transcriptional activator TtdR; Provisional Back     alignment and domain information
>PRK11139 DNA-binding transcriptional activator GcvA; Provisional Back     alignment and domain information
>PRK11482 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK10632 transcriptional regulator; Provisional Back     alignment and domain information
>PRK13348 chromosome replication initiation inhibitor protein; Provisional Back     alignment and domain information
>TIGR03298 argP transcriptional regulator, ArgP family Back     alignment and domain information
>PRK03601 transcriptional regulator HdfR; Provisional Back     alignment and domain information
>PRK03635 chromosome replication initiation inhibitor protein; Validated Back     alignment and domain information
>PRK10216 DNA-binding transcriptional regulator YidZ; Provisional Back     alignment and domain information
>PRK14997 LysR family transcriptional regulator; Provisional Back     alignment and domain information
>TIGR03418 chol_sulf_TF putative choline sulfate-utilization transcription factor Back     alignment and domain information
>PRK10086 DNA-binding transcriptional regulator DsdC; Provisional Back     alignment and domain information
>PRK10082 cell density-dependent motility repressor; Provisional Back     alignment and domain information
>PRK15092 DNA-binding transcriptional repressor LrhA; Provisional Back     alignment and domain information
>TIGR02036 dsdC D-serine deaminase transcriptional activator Back     alignment and domain information
>COG0583 LysR Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11716 DNA-binding transcriptional regulator IlvY; Provisional Back     alignment and domain information
>PF03466 LysR_substrate: LysR substrate binding domain; InterPro: IPR005119 The structure of this domain is known and is similar to the periplasmic binding proteins [] Back     alignment and domain information
>cd08444 PBP2_Cbl The C-terminal substrate binding domain of LysR-type transcriptional regulator Cbl, which is required for expression of sulfate starvation-inducible (ssi) genes, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08413 PBP2_CysB_like The C-terminal substrate domain of LysR-type transcriptional regulators CysB-like contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08421 PBP2_LTTR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08411 PBP2_OxyR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>cd08459 PBP2_DntR_NahR_LinR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08433 PBP2_Nac The C-teminal substrate binding domain of LysR-like nitrogen assimilation control (NAC) protein, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08437 PBP2_MleR The substrate binding domain of LysR-type transcriptional regulator MleR which required for malolactic fermentation, contains type 2 periplasmic binidning fold Back     alignment and domain information
>cd08435 PBP2_GbpR The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08438 PBP2_CidR The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08443 PBP2_CysB The C-terminal substrate domain of LysR-type transcriptional regulator CysB contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08417 PBP2_Nitroaromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08440 PBP2_LTTR_like_4 TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08426 PBP2_LTTR_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08412 PBP2_PAO1_like The C-terminal substrate-binding domain of putative LysR-type transcriptional regulator PAO1-like, a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>cd08425 PBP2_CynR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator CynR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08434 PBP2_GltC_like The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08436 PBP2_LTTR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08415 PBP2_LysR_opines_like The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08464 PBP2_DntR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08463 PBP2_DntR_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08420 PBP2_CysL_like C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08418 PBP2_TdcA The C-terminal substrate binding domain of LysR-type transcriptional regulator TdcA, which is involved in the degradation of L-serine and L-threonine, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08458 PBP2_NocR The C-terminal substrate-domain of LysR-type transcriptional regulator, NocR, involved in the catabolism of nopaline, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08456 PBP2_LysR The C-terminal substrate binding domain of LysR, transcriptional regulator for lysine biosynthesis, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08423 PBP2_LTTR_like_6 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08460 PBP2_DntR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08419 PBP2_CbbR_RubisCO_like The C-terminal substrate binding of LysR-type transcriptional regulator (CbbR) of RubisCO operon, which is involved in the carbon dioxide fixation, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08462 PBP2_NodD The C-terminal substsrate binding domain of NodD family of LysR-type transcriptional regulators that regulates the expression of nodulation (nod) genes; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08466 PBP2_LeuO The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of leucine synthesis operon, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08467 PBP2_SyrM The C-terminal substrate binding of LysR-type symbiotic regulator SyrM, which activates expression of nodulation gene NodD3, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08414 PBP2_LTTR_aromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08441 PBP2_MetR The C-terminal substrate binding domain of LysR-type transcriptional regulator metR, which regulates the expression of methionine biosynthetic genes, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08453 PBP2_IlvR The C-terminal substrate binding domain of LysR-type transcriptional regulator, IlvR, involved in the biosynthesis of isoleucine, leucine and valine; contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08442 PBP2_YofA_SoxR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08449 PBP2_XapR The C-terminal substrate binding domain of LysR-type transcriptional regulator XapR involved in xanthosine catabolism, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08486 PBP2_CbnR The C-terminal substrate binding domain of LysR-type transcriptional regulator, CbnR, involved in the chlorocatechol catabolism, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08461 PBP2_DntR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08468 PBP2_Pa0477 The C-terminal substrate biniding domain of an uncharacterized LysR-like transcriptional regulator Pa0477 related to DntR, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08446 PBP2_Chlorocatechol The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the chlorocatechol catabolism, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08450 PBP2_HcaR The C-terminal substrate binding domain of LysR-type transcriptional regulator HcaR in involved in 3-phenylpropionic acid catabolism, contains the type2 periplasmic binding fold Back     alignment and domain information
>cd08457 PBP2_OccR The C-terminal substrate-domain of LysR-type transcriptional regulator, OccR, involved in the catabolism of octopine, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08427 PBP2_LTTR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08445 PBP2_BenM_CatM_CatR The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in benzoate catabolism; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08430 PBP2_IlvY The C-terminal substrate binding of LysR-type transcriptional regulator IlvY, which activates the expression of ilvC gene that encoding acetohydroxy acid isomeroreductase for the biosynthesis of branched amino acids; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08485 PBP2_ClcR The C-terminal substrate binding domain of LysR-type transcriptional regulator ClcR involved in the chlorocatechol catabolism, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08416 PBP2_MdcR The C-terminal substrate-binding domian of LysR-type transcriptional regulator MdcR, which involved in the malonate catabolism contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08448 PBP2_LTTR_aromatics_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08469 PBP2_PnbR The C-terminal substrate binding domain of LysR-type transcriptional regulator PnbR, which is involved in regulating the pnb genes encoding enzymes for 4-nitrobenzoate catabolism, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08429 PBP2_NhaR The C-terminal substrate binding domain of LysR-type transcriptional activator of the nhaA gene, encoding Na+/H+ antiporter, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08451 PBP2_BudR The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd05466 PBP2_LTTR_substrate The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily Back     alignment and domain information
>cd08465 PBP2_ToxR The C-terminal substrate binding domain of LysR-type transcriptional regulator ToxR regulates the expression of the toxoflavin biosynthesis genes; contains the type 2 periplasmic bindinig fold Back     alignment and domain information
>cd08452 PBP2_AlsR The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08447 PBP2_LTTR_aromatics_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08431 PBP2_HupR The C-terminal substrate binding domain of LysR-type transcriptional regulator, HupR, which regulates expression of the heme uptake receptor HupA; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08432 PBP2_GcdR_TrpI_HvrB_AmpR_like The C-terminal substrate domain of LysR-type GcdR, TrPI, HvR and beta-lactamase regulators, and that of other closely related homologs; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08475 PBP2_CrgA_like_6 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08471 PBP2_CrgA_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08478 PBP2_CrgA The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA, contains the type 2 periplasmic binding domain Back     alignment and domain information
>cd08422 PBP2_CrgA_like The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain Back     alignment and domain information
>cd08481 PBP2_GcdR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators GcdR-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08474 PBP2_CrgA_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08472 PBP2_CrgA_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08477 PBP2_CrgA_like_8 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08479 PBP2_CrgA_like_9 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08439 PBP2_LrhA_like The C-terminal substrate domain of LysR-like regulator LrhA (LysR homologue A) and that of closely related homologs, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08428 PBP2_IciA_ArgP The C-terminal substrate binding domain of LysR-type transcriptional regulator, ArgP (IciA), for arginine exporter (ArgO); contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08470 PBP2_CrgA_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain Back     alignment and domain information
>cd08473 PBP2_CrgA_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08476 PBP2_CrgA_like_7 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>TIGR00637 ModE_repress ModE molybdate transport repressor domain Back     alignment and domain information
>cd08483 PBP2_HvrB The C-terminal substrate-binding domain of LysR-type transcriptional regulator HvrB, an activator of S-adenosyl-L-homocysteine hydrolase expression, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR02136 ptsS_2 phosphate binding protein Back     alignment and domain information
>cd08480 PBP2_CrgA_like_10 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08482 PBP2_TrpI The C-terminal substrate binding domain of LysR-type transcriptional regulator TrpI, which is involved in control of tryptophan synthesis, contains type 2 periplasmic binding fold Back     alignment and domain information
>cd08488 PBP2_AmpR The C-terminal substrate domain of LysR-type transcriptional regulator AmpR that involved in control of the expression of beta-lactamase gene ampC, contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08487 PBP2_BlaA The C-terminal substrate-binding domain of LysR-type trnascriptional regulator BlaA which involved in control of the beta-lactamase gene expression; contains the type 2 periplasmic binding fold Back     alignment and domain information
>cd08484 PBP2_LTTR_beta_lactamase The C-terminal substrate-domain of LysR-type transcriptional regulators for beta-lactamase genes, contains the type 2 periplasmic binding fold Back     alignment and domain information
>PRK14498 putative molybdopterin biosynthesis protein MoeA/LysR substrate binding-domain-containing protein; Provisional Back     alignment and domain information
>PRK10676 DNA-binding transcriptional regulator ModE; Provisional Back     alignment and domain information
>PF12727 PBP_like: PBP superfamily domain; InterPro: IPR024370 This entry represents members of the periplasmic binding domain superfamily [] Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>COG2005 ModE N-terminal domain of molybdenum-binding protein [General function prediction only] Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family Back     alignment and domain information
>PRK09729 hypothetical protein; Provisional Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>PF13531 SBP_bac_11: Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A Back     alignment and domain information
>PF12849 PBP_like_2: PBP superfamily domain; InterPro: IPR024370 This entry represents members of the periplasmic binding domain superfamily [] Back     alignment and domain information
>COG2998 TupB ABC-type tungstate transport system, permease component [Coenzyme metabolism] Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>TIGR01256 modA molybdenum ABC transporter, periplasmic molybdate-binding protein Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>TIGR00975 3a0107s03 phosphate ABC transporter, phosphate-binding protein Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>TIGR03730 tungstate_WtpA tungstate ABC transporter binding protein WtpA Back     alignment and domain information
>PRK04168 molybdate ABC transporter periplasmic substrate-binding protein; Provisional Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PF13556 HTH_30: PucR C-terminal helix-turn-helix domain; PDB: 3ONQ_B Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>TIGR00363 lipoprotein, YaeC family Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>COG0226 PstS ABC-type phosphate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>PF13379 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_A 2I49_A 2I4B_A 2I48_A 3QSL_A Back     alignment and domain information
>PRK10918 phosphate ABC transporter periplasmic substrate-binding protein PstS; Provisional Back     alignment and domain information
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>COG1321 TroR Mn-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK09861 cytoplasmic membrane lipoprotein-28; Provisional Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>TIGR03414 ABC_choline_bnd choline ABC transporter, periplasmic binding protein Back     alignment and domain information
>COG1654 BirA Biotin operon repressor [Transcription] Back     alignment and domain information
>TIGR01276 thiB thiamine ABC transporter, periplasmic binding protein Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>PF09048 Cro: Cro; InterPro: IPR000655 Bacteriophage lambda encodes two repressors: the Cro repressor that acts to turn off early gene transcription during the lytic cycle, and the lambda or cI repressor that is required to maintain lysogenic growth Back     alignment and domain information
>COG4742 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PF03180 Lipoprotein_9: NLPA lipoprotein; InterPro: IPR004872 This family of bacterial lipoproteins contains several antigenic members, that may be involved in bacterial virulence Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PF09084 NMT1: NMT1/THI5 like; InterPro: IPR015168 This entry is found in the NMT1 and THI5 proteins Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>PF04069 OpuAC: Substrate binding domain of ABC-type glycine betaine transport system; InterPro: IPR007210 This domain is a part of a high affinity multicomponent binding-protein-dependent transport system involved in bacterial osmoregulation Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>PRK11480 tauA taurine transporter substrate binding subunit; Provisional Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>TIGR00971 3a0106s03 sulfate/thiosulfate-binding protein Back     alignment and domain information
>COG2358 Imp TRAP-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>PRK11119 proX glycine betaine transporter periplasmic subunit; Provisional Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PRK10852 thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon [Transcription / Coenzyme metabolism] Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>PF01638 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002577 The hxlR-type HTH domain is a domain of ~90-100 amino acids present in putative transcription regulators with a winged helix-turn-helix (wHTH) structure Back     alignment and domain information
>PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>PRK01905 DNA-binding protein Fis; Provisional Back     alignment and domain information
>COG0715 TauA ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PF07453 NUMOD1: NUMOD1 domain; InterPro: IPR010896 This helix-turn-helix-containing DNA-binding domain is found associated in homing nucleases [] Back     alignment and domain information
>COG1342 Predicted DNA-binding proteins [General function prediction only] Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PF09114 MotA_activ: Transcription factor MotA, activation domain; InterPro: IPR015198 Transcription factor MotA is required for the activation of middle promoters in Bacteriophage T4, in addition to phage T4 co-activator AsiA, and sigma-70-containing Escherichia coli RNA polymerase Back     alignment and domain information
>PF14549 P22_Cro: DNA-binding transcriptional regulator Cro; PDB: 1RZS_A 3BD1_A 3QWS_A 2HIN_B Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>COG1733 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>COG3888 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function Back     alignment and domain information
>PHA02591 hypothetical protein; Provisional Back     alignment and domain information
>PRK00430 fis global DNA-binding transcriptional dual regulator Fis; Provisional Back     alignment and domain information
>cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>COG2522 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PF02621 VitK2_biosynth: Menaquinone biosynthesis; InterPro: IPR003773 This entry describes proteins of unknown function, which appear to be putative periplasmic binding proteins Back     alignment and domain information
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region Back     alignment and domain information
>smart00497 IENR1 Intron encoded nuclease repeat motif Back     alignment and domain information
>COG2508 Regulator of polyketide synthase expression [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>COG1732 OpuBC Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK01686 hisG ATP phosphoribosyltransferase catalytic subunit; Reviewed Back     alignment and domain information
>PRK15201 fimbriae regulatory protein FimW; Provisional Back     alignment and domain information
>TIGR00721 tfx DNA-binding protein, Tfx family Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>COG4190 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>PF01379 Porphobil_deam: Porphobilinogen deaminase, dipyromethane cofactor binding domain; InterPro: IPR022417 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>PRK09744 DNA-binding transcriptional regulator DicC; Provisional Back     alignment and domain information
>PF08280 HTH_Mga: M protein trans-acting positive regulator (MGA) HTH domain; InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] Back     alignment and domain information
>PF01634 HisG: ATP phosphoribosyltransferase; InterPro: IPR013820 ATP phosphoribosyltransferase (2 Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>COG0040 HisG ATP phosphoribosyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11477 carbohydrate diacid transcriptional activator CdaR; Provisional Back     alignment and domain information
>PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>TIGR02719 repress_PhaQ poly-beta-hydroxybutyrate-responsive repressor Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03433 padR_acidobact transcriptional regulator, Acidobacterial, PadR-family Back     alignment and domain information
>PF05344 DUF746: Domain of Unknown Function (DUF746); InterPro: IPR008008 This is a short conserved region found in some transposons Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>COG4189 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG2771 CsgD DNA-binding HTH domain-containing proteins [Transcription] Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>COG0181 HemC Porphobilinogen deaminase [Coenzyme metabolism] Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK10752 sulfate transporter subunit; Provisional Back     alignment and domain information
>PF05043 Mga: Mga helix-turn-helix domain; InterPro: IPR007737 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>PRK15320 transcriptional activator SprB; Provisional Back     alignment and domain information
>PF08222 HTH_CodY: CodY helix-turn-helix domain; InterPro: IPR013198 This family consists of the C-terminal helix-turn-helix domain found in several bacterial GTP-sensing transcriptional pleiotropic repressor CodY proteins Back     alignment and domain information
>TIGR00498 lexA SOS regulatory protein LexA Back     alignment and domain information
>COG1497 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>PRK00082 hrcA heat-inducible transcription repressor; Provisional Back     alignment and domain information
>PF14424 Toxin-deaminase: The BURPS668_1122 family of deaminases Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>COG4197 Uncharacterized protein conserved in bacteria, prophage-related [Function unknown] Back     alignment and domain information
>TIGR02531 yecD_yerC TrpR-related protein YerC/YecD Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>TIGR03541 reg_near_HchA LuxR family transcriptional regulatory, chaperone HchA-associated Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress Back     alignment and domain information
>PRK10188 DNA-binding transcriptional activator SdiA; Provisional Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>TIGR00070 hisG ATP phosphoribosyltransferase Back     alignment and domain information
>cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>PLN02245 ATP phosphoribosyl transferase Back     alignment and domain information
>COG1464 NlpA ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>COG2739 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PRK06474 hypothetical protein; Provisional Back     alignment and domain information
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK01066 porphobilinogen deaminase; Provisional Back     alignment and domain information
>PRK09775 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK13870 transcriptional regulator TraR; Provisional Back     alignment and domain information
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PRK00072 hemC porphobilinogen deaminase; Reviewed Back     alignment and domain information
>TIGR01764 excise DNA binding domain, excisionase family Back     alignment and domain information
>COG2512 Predicted membrane-associated trancriptional regulator [Transcription] Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PF12728 HTH_17: Helix-turn-helix domain Back     alignment and domain information
>cd00494 HMBS Hydroxymethylbilane synthase (HMBS), also known as porphobilinogen deaminase (PBGD), is an intermediate enzyme in the biosynthetic pathway of tetrapyrrolic ring systems, such as heme, chlorophylls, and vitamin B12 Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PF08461 HTH_12: Ribonuclease R winged-helix domain; InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea Back     alignment and domain information
>PRK15046 2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional Back     alignment and domain information
>PF13744 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_A Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03401 TctC: Tripartite tricarboxylate transporter family receptor; InterPro: IPR005064 Bordetella pertussis, the causative agent of human whooping cough (pertussis), is an obligate human pathogen with diverse high-affinity transport systems for the assimilation of iron, a biometal that is essential for growth [] Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>PRK15090 DNA-binding transcriptional regulator KdgR; Provisional Back     alignment and domain information
>PF07022 Phage_CI_repr: Bacteriophage CI repressor helix-turn-helix domain; InterPro: IPR010744 This family consists of several phage CI repressor proteins and related bacterial sequences Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PF05732 RepL: Firmicute plasmid replication protein (RepL); InterPro: IPR008813 This entry consists of proteins thought to be involved in plasmid replication Back     alignment and domain information
>PF12727 PBP_like: PBP superfamily domain; InterPro: IPR024370 This entry represents members of the periplasmic binding domain superfamily [] Back     alignment and domain information
>TIGR02684 dnstrm_HI1420 probable addiction module antidote protein Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PF13309 HTH_22: HTH domain Back     alignment and domain information
>cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA Back     alignment and domain information
>COG1458 Predicted DNA-binding protein containing PIN domain [General function prediction only] Back     alignment and domain information
>PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] Back     alignment and domain information
>PRK13325 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed Back     alignment and domain information
>COG1725 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PHA02943 hypothetical protein; Provisional Back     alignment and domain information
>PRK13583 hisG ATP phosphoribosyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PF02042 RWP-RK: RWP-RK domain; InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain Back     alignment and domain information
>PF02376 CUT: CUT domain; InterPro: IPR003350 A class, also called ONECUT, of homeodomain proteins Back     alignment and domain information
>TIGR02277 PaaX_trns_reg phenylacetic acid degradation operon negative regulatory protein PaaX Back     alignment and domain information
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK10681 DNA-binding transcriptional repressor DeoR; Provisional Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PF01316 Arg_repressor: Arginine repressor, DNA binding domain; InterPro: IPR020900 The arginine dihydrolase (AD) pathway is found in many prokaryotes and some primitive eukaryotes, an example of the latter being Giardia lamblia (Giardia intestinalis) [] Back     alignment and domain information
>PRK09333 30S ribosomal protein S19e; Provisional Back     alignment and domain information
>COG3388 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>smart00094 TR_FER Transferrin Back     alignment and domain information
>PF14502 HTH_41: Helix-turn-helix domain Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG1510 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PRK13182 racA polar chromosome segregation protein; Reviewed Back     alignment and domain information
>COG4588 AcfC Accessory colonization factor AcfC, contains ABC-type periplasmic domain [General function prediction only] Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2345 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF13343 SBP_bac_6: Bacterial extracellular solute-binding protein; PDB: 2QRY_D 1XVX_A 1SI1_A 1SI0_A 1Q35_A 1Y9U_A 2OWS_A 2OWT_A 2VP1_A 2VOZ_A Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PF11972 HTH_13: HTH DNA binding domain; InterPro: IPR021068 The proteins in this entry have not been characterised Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PRK09416 lstR lineage-specific thermal regulator protein; Provisional Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>cd01392 HTH_LacI Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators Back     alignment and domain information
>PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D Back     alignment and domain information
>TIGR00331 hrcA heat shock gene repressor HrcA Back     alignment and domain information
>cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) Back     alignment and domain information
>COG3432 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PRK09863 putative frv operon regulatory protein; Provisional Back     alignment and domain information
>PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>PF01090 Ribosomal_S19e: Ribosomal protein S19e; InterPro: IPR001266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
1al3_A324 Cofactor Binding Fragment Of Cysb From Klebsiella A 9e-70
2fyi_A228 Crystal Structure Of The Cofactor-binding Domain Of 4e-45
2hxr_A238 Structure Of The Ligand Binding Domain Of E. Coli C 3e-08
3fzv_A306 Crystal Structure Of Pa01 Protein, Putative Lysr Fa 3e-05
4ab6_A222 Regulatory Domain Structure Of Nmb2055 (Metr), C103 5e-05
3jv9_A219 The Structure Of A Reduced Form Of Oxyr From N. Men 4e-04
4ab5_A222 Regulatory Domain Structure Of Nmb2055 (Metr) A Lys 6e-04
>pdb|1AL3|A Chain A, Cofactor Binding Fragment Of Cysb From Klebsiella Aerogenes Length = 324 Back     alignment and structure

Iteration: 1

Score = 259 bits (663), Expect = 9e-70, Method: Compositional matrix adjust. Identities = 121/301 (40%), Positives = 183/301 (60%) Query: 1 MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAXXXXXXXXXXXXXXRHGKRIRGLT 60 M L Q R++ E V N N++ A+ LYTSQPG+SK R GK + +T Sbjct: 1 MKLQQLRYIVEVVNHNLNVSSTAEGLYTSQPGISKQVRMLEDELGIQIFARSGKHLTQVT 60 Query: 61 KPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFP 120 GQ I+R ++ +++ +K + E + D G+L +ATTHTQARYALP +IK F ++P Sbjct: 61 PAGQEIIRIAREVLSKVDAIKSVAGEHTWPDKGSLYVATTHTQARYALPGVIKGFIERYP 120 Query: 121 KVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLL 180 +V L + QG+P QI E + AD AI TE L D L+ +PCY W I+V +HPL Sbjct: 121 RVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPEHPLAT 180 Query: 181 LNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGI 240 S+S++E++ YPL+TY F+GR +LD F+ LTP IV ++D+IKTYV L +G+ Sbjct: 181 KGSVSIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGV 240 Query: 241 GIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFI 300 G+IAS+A D D +L + A+ +F + +++ ++ T+LRSY+Y FI+ +P L R + Sbjct: 241 GVIASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVV 300 Query: 301 N 301 + Sbjct: 301 D 301
>pdb|2FYI|A Chain A, Crystal Structure Of The Cofactor-binding Domain Of The Cbl Transcriptional Regulator Length = 228 Back     alignment and structure
>pdb|2HXR|A Chain A, Structure Of The Ligand Binding Domain Of E. Coli Cynr, A Transcriptional Regulator Controlling Cyanate Metabolism Length = 238 Back     alignment and structure
>pdb|3FZV|A Chain A, Crystal Structure Of Pa01 Protein, Putative Lysr Family Transcriptional Regulator From Pseudomonas Aeruginosa Length = 306 Back     alignment and structure
>pdb|4AB6|A Chain A, Regulatory Domain Structure Of Nmb2055 (Metr), C103s C106s Mutant, A Lysr Family Regulator From N. Meningitidis Length = 222 Back     alignment and structure
>pdb|3JV9|A Chain A, The Structure Of A Reduced Form Of Oxyr From N. Meningitidis Length = 219 Back     alignment and structure
>pdb|4AB5|A Chain A, Regulatory Domain Structure Of Nmb2055 (Metr) A Lysr Family Regulator From N. Meningitidis Length = 222 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
1al3_A324 Cys regulon transcriptional activator CYSB; LYSR f 1e-126
2fyi_A228 HTH-type transcriptional regulator CBL; Lys-R fami 1e-85
3fzv_A306 Probable transcriptional regulator; LYSR, structur 1e-48
3fxq_A305 LYSR type regulator of TSAMBCD; transcriptional re 3e-46
2hxr_A238 HTH-type transcriptional regulator CYNR; CYNR tran 8e-34
1ixc_A294 CBNR, LYSR-type regulatory protein; long alpha hel 2e-33
4ab5_A222 Transcriptional regulator, LYSR family; transcript 2e-32
2h98_A313 HTH-type transcriptional regulator CATM; BENM, LTT 3e-30
2h9b_A312 HTH-type transcriptional regulator BENM; LTTR, tra 4e-30
2ql3_A209 Probable transcriptional regulator, LYSR family P; 6e-23
3isp_A303 HTH-type transcriptional regulator RV1985C/MT2039; 4e-18
1i6a_A219 OXYR, hydrogen peroxide-inducible genes activator; 3e-15
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR 9e-15
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcripti 3e-14
2esn_A310 Probable transcriptional regulator; PA0477, APC582 2e-13
1uth_A315 LYSR-type regulatory protein; transcription regula 1e-12
3szp_A291 Transcriptional regulator, LYSR family; winged hel 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3onm_A238 Transcriptional regulator LRHA; LYSR, ROVM, transc 6e-07
3hhg_A306 Transcriptional regulator, LYSR family; transcript 2e-06
3mz1_A300 Putative transcriptional regulator; structural gen 8e-06
3oxn_A241 Putative transcriptional regulator, LYSR family; s 3e-05
2ijl_A135 AGR_C_4647P, molybdenum-binding transcriptional re 4e-05
2y7p_A218 LYSR-type regulatory protein; transcription regula 6e-05
>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1 Length = 324 Back     alignment and structure
 Score =  362 bits (931), Expect = e-126
 Identities = 128/304 (42%), Positives = 193/304 (63%)

Query: 1   MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLT 60
           M L Q R++ E V  N N++  A+ LYTSQPG+SK +  LE+EL I IF R GK +  +T
Sbjct: 1   MKLQQLRYIVEVVNHNLNVSSTAEGLYTSQPGISKQVRMLEDELGIQIFARSGKHLTQVT 60

Query: 61  KPGQAILRSIEIIMQEIEGLKKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFP 120
             GQ I+R    ++ +++ +K +  E +  D G+L +ATTHTQARYALP +IK F  ++P
Sbjct: 61  PAGQEIIRIAREVLSKVDAIKSVAGEHTWPDKGSLYVATTHTQARYALPGVIKGFIERYP 120

Query: 121 KVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYVIIVPLDHPLLL 180
           +V L + QG+P QI E +    AD AI TE L   D L+ +PCY W   I+V  +HPL  
Sbjct: 121 RVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPEHPLAT 180

Query: 181 LNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGI 240
             S+S++E++ YPL+TY   F+GR +LD  F+   LTP IV    ++D+IKTYV L +G+
Sbjct: 181 KGSVSIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGV 240

Query: 241 GIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFI 300
           G+IAS+A D   D +L  + A+ +F  + +++  ++ T+LRSY+Y FI+  +P L R  +
Sbjct: 241 GVIASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVV 300

Query: 301 NKIL 304
           +  +
Sbjct: 301 DTAV 304


>2fyi_A HTH-type transcriptional regulator CBL; Lys-R family, cofactor-binding DO cysteine biosynthesis; 2.80A {Escherichia coli K12} SCOP: c.94.1.1 Length = 228 Back     alignment and structure
>3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, structure initiative; 2.71A {Pseudomonas aeruginosa PA01} Length = 306 Back     alignment and structure
>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A 3n6t_A 3n6u_A* Length = 305 Back     alignment and structure
>2hxr_A HTH-type transcriptional regulator CYNR; CYNR transcriptional regulator LYSR struc genomics, PSI-2, protein structure initiative; 2.05A {Escherichia coli} PDB: 3hfu_A Length = 238 Back     alignment and structure
>1ixc_A CBNR, LYSR-type regulatory protein; long alpha helix connecting DNA binding and regulatory domai binding protein; 2.20A {Cupriavidus necator} SCOP: a.4.5.37 c.94.1.1 PDB: 1iz1_A Length = 294 Back     alignment and structure
>4ab5_A Transcriptional regulator, LYSR family; transcription factors; 2.51A {Neisseria meningitidis serogroup B} PDB: 4ab6_A Length = 222 Back     alignment and structure
>2h98_A HTH-type transcriptional regulator CATM; BENM, LTTR; 1.80A {Acinetobacter SP} PDB: 2h9q_A* 2f7b_A 2f7c_A* 3glb_A* 3m1e_A Length = 313 Back     alignment and structure
>2h9b_A HTH-type transcriptional regulator BENM; LTTR, transcriptional activator, LYSR-type transcripti regulator; 1.80A {Acinetobacter SP} PDB: 2h99_A 3k1m_A 3k1n_A 3k1p_A 2f7a_A* 2f6p_A 2f78_A 2f6g_A* 2f8d_A 2f97_A* Length = 312 Back     alignment and structure
>2ql3_A Probable transcriptional regulator, LYSR family P; APC7314, rhodococcus RHA1, structural genomics, PSI-2; HET: MSE; 2.05A {Rhodococcus SP} Length = 209 Back     alignment and structure
>3isp_A HTH-type transcriptional regulator RV1985C/MT2039; ROD shaped structure, DNA binding domain, regulatory domain, DNA-binding; 2.70A {Mycobacterium tuberculosis} Length = 303 Back     alignment and structure
>1i6a_A OXYR, hydrogen peroxide-inducible genes activator; OXYR regulatory domain, oxidized form, transcription; 2.30A {Escherichia coli} SCOP: c.94.1.1 PDB: 1i69_A Length = 219 Back     alignment and structure
>3jv9_A OXYR, transcriptional regulator, LYSR family; LYSR-type transcriptional regulator, LTTR, redox, structural genomics, OPPF; 2.39A {Neisseria meningitidis} Length = 219 Back     alignment and structure
>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis} Length = 232 Back     alignment and structure
>2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein struc initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1 Length = 310 Back     alignment and structure
>1uth_A LYSR-type regulatory protein; transcription regulation, transcriptional regulator; 2.2A {Burkholderia SP} SCOP: c.94.1.1 PDB: 1utb_A 1utb_B 1uth_B 2uyf_A 2uye_A Length = 315 Back     alignment and structure
>3szp_A Transcriptional regulator, LYSR family; winged helix-turn helix, DNA-binding, transcription factor; 2.20A {Vibrio cholerae} PDB: 3t1b_B Length = 291 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3onm_A Transcriptional regulator LRHA; LYSR, ROVM, transcription factor, virulence factor; 2.40A {Yersinia pseudotuberculosis} Length = 238 Back     alignment and structure
>3hhg_A Transcriptional regulator, LYSR family; transcription factor, structur genomics, oxford protein production facility, OPPF; 3.20A {Neisseria meningitidis serogroup B} Length = 306 Back     alignment and structure
>3mz1_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative, MI center for STR uctural genomics, MCSG; 1.88A {Sinorhizobium meliloti} Length = 300 Back     alignment and structure
>3oxn_A Putative transcriptional regulator, LYSR family; structural genomics, PSI-2, protein structure initiative; 2.70A {Vibrio parahaemolyticus} Length = 241 Back     alignment and structure
>2ijl_A AGR_C_4647P, molybdenum-binding transcriptional repressor; structural GE DNA-binding protein, PSI-2, PROT structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 135 Back     alignment and structure
>2y7p_A LYSR-type regulatory protein; transcription regulator, DNA-binding, transcription, transcr factor, transcription regulation; HET: SAL PEU; 1.85A {Burkholderia SP} PDB: 2y7k_A* 2y84_A 2y7w_A 2y7r_A Length = 218 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
1ixc_A294 CBNR, LYSR-type regulatory protein; long alpha hel 100.0
3fxq_A305 LYSR type regulator of TSAMBCD; transcriptional re 100.0
3fzv_A306 Probable transcriptional regulator; LYSR, structur 100.0
2esn_A310 Probable transcriptional regulator; PA0477, APC582 100.0
1al3_A324 Cys regulon transcriptional activator CYSB; LYSR f 100.0
2h9b_A312 HTH-type transcriptional regulator BENM; LTTR, tra 100.0
2h98_A313 HTH-type transcriptional regulator CATM; BENM, LTT 100.0
1uth_A315 LYSR-type regulatory protein; transcription regula 100.0
3szp_A291 Transcriptional regulator, LYSR family; winged hel 100.0
3hhg_A306 Transcriptional regulator, LYSR family; transcript 100.0
3isp_A303 HTH-type transcriptional regulator RV1985C/MT2039; 100.0
3mz1_A300 Putative transcriptional regulator; structural gen 100.0
2hxr_A238 HTH-type transcriptional regulator CYNR; CYNR tran 100.0
2fyi_A228 HTH-type transcriptional regulator CBL; Lys-R fami 100.0
3oxn_A241 Putative transcriptional regulator, LYSR family; s 100.0
4ab5_A222 Transcriptional regulator, LYSR family; transcript 100.0
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcripti 100.0
2y7p_A218 LYSR-type regulatory protein; transcription regula 100.0
2ql3_A209 Probable transcriptional regulator, LYSR family P; 100.0
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR 100.0
1i6a_A219 OXYR, hydrogen peroxide-inducible genes activator; 99.98
3hhf_B213 Transcriptional regulator, LYSR family; transcript 99.96
3onm_A238 Transcriptional regulator LRHA; LYSR, ROVM, transc 99.96
2qsx_A218 Putative transcriptional regulator, LYSR family; t 99.95
3kos_A219 HTH-type transcriptional activator AMPR; alpha-bet 99.95
3fd3_A208 Chromosome replication initiation inhibitor prote; 99.95
2ijl_A135 AGR_C_4647P, molybdenum-binding transcriptional re 99.94
1twy_A290 ABC transporter, periplasmic substrate-binding PR; 99.92
3cta_A230 Riboflavin kinase; structural genomics, transferas 99.91
3cvg_A294 Putative metal binding protein; PSI-II, NYSGXRC, p 99.89
1b9m_A265 Protein (mode); DNA-binding, gene regulation, wing 99.86
4ecf_A264 ABC-type phosphate transport system, periplasmic; 99.85
4exl_A265 PBP 1, phosphate-binding protein PSTS 1; center fo 99.77
1ixh_A321 Phosphate-binding protein; phosphate transport, ul 99.73
1atg_A231 MODA, periplasmic molybdate-binding protein; tungs 99.73
1pc3_A350 Phosphate-binding protein 1; phosphate transport r 99.69
3muq_A237 Uncharacterized conserved protein; structural geno 99.64
3lr1_A236 Tungstate ABC transporter, periplasmic tungstate- 99.61
3kn3_A242 Putative periplasmic protein; alpha-beta structure 99.44
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 99.23
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; 99.2
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 99.18
4gd5_A279 Phosphate ABC transporter, phosphate-binding PROT; 99.17
1us5_A314 Putative GLUR0 ligand binding core; receptor, memb 99.05
3r26_A237 Molybdate-binding periplasmic protein; protein bin 99.02
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 98.95
3gzg_A253 Molybdate-binding periplasmic protein; permease; m 98.92
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 98.83
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 98.82
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 98.81
3cij_A295 UPF0100 protein AF_0094; archaeal periplasmic bind 98.8
3cfx_A296 UPF0100 protein MA_0280; ABC transporter, binding 98.8
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 98.79
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 98.78
2ovg_A66 Phage lambda CRO; transcription factor, helix-turn 98.78
3cfz_A292 UPF0100 protein MJ1186; ABC transporter, binding p 98.77
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 98.68
2hxw_A237 Major antigenic peptide PEB3; periplasmic binding 98.64
2h09_A155 Transcriptional regulator MNTR; transcription regu 98.61
3k6v_A354 Solute-binding protein MA_0280; MODA, molybdate, p 98.57
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-b 98.56
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 98.51
3kzg_A237 Arginine 3RD transport system periplasmic binding 98.51
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 98.51
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 98.51
3f3x_A144 Transcriptional regulator, MARR family, putative; 98.49
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 98.49
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 98.47
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 98.47
3cg1_A296 UPF0100 protein PF0080; ABC transporter, binding p 98.46
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 98.45
2vha_A287 Periplasmic binding transport protein; periplasmic 98.44
3del_B242 Arginine binding protein; alpha and beta protein ( 98.42
2pg4_A95 Uncharacterized protein; structural genomics, join 98.39
3tql_A227 Arginine-binding protein; transport and binding pr 98.39
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 98.39
2yln_A283 Putative ABC transporter, periplasmic binding Pro 98.39
4eq9_A246 ABC transporter substrate-binding protein-amino A 98.38
4ddd_A327 Immunogenic protein; ssgcid, structural genomics, 98.31
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 98.31
3hv1_A268 Polar amino acid ABC uptake transporter substrate 98.31
2pij_A67 Prophage PFL 6 CRO; transcription factor, helix-tu 98.29
2cw1_A65 SN4M; lambda CRO fold, de novo protein; NMR {Synth 98.29
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 98.28
2nnn_A140 Probable transcriptional regulator; structural gen 98.26
3k4u_A245 Binding component of ABC transporter; structural g 98.26
2q88_A257 EHUB, putative ABC transporter amino acid-binding 98.26
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 98.25
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 98.24
3qax_A268 Probable ABC transporter arginine-binding protein; 98.24
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 98.24
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 98.22
1xt8_A292 Putative amino-acid transporter periplasmic solut 98.2
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 98.18
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 98.15
4fx0_A148 Probable transcriptional repressor protein; helix- 98.15
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 98.15
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 98.15
3bja_A139 Transcriptional regulator, MARR family, putative; 98.15
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 98.14
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 98.14
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 98.14
2hr3_A147 Probable transcriptional regulator; MCSG, structur 98.13
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 98.13
1s3j_A155 YUSO protein; structural genomics, MARR transcript 98.12
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 98.12
3ech_A142 MEXR, multidrug resistance operon repressor; winge 98.12
2gxg_A146 146AA long hypothetical transcriptional regulator; 98.12
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 98.11
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 98.1
3tmg_A280 Glycine betaine, L-proline ABC transporter, glycin 98.09
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 98.09
3df8_A111 Possible HXLR family transcriptional factor; APC89 98.08
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 98.08
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 98.07
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 98.07
2eth_A154 Transcriptional regulator, putative, MAR family; M 98.07
1z91_A147 Organic hydroperoxide resistance transcriptional; 98.06
2qq9_A226 Diphtheria toxin repressor; regulator, DTXR, helix 98.05
3bdd_A142 Regulatory protein MARR; putative multiple antibio 98.05
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 98.05
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 98.03
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 98.03
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 98.03
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 98.02
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 98.02
3l6g_A256 Betaine ABC transporter permease and substrate BI 98.01
2obp_A96 Putative DNA-binding protein; structural genomics, 98.0
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 98.0
3cjn_A162 Transcriptional regulator, MARR family; silicibact 97.98
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 97.97
3oop_A143 LIN2960 protein; protein structure initiative, PSI 97.97
2frh_A127 SARA, staphylococcal accessory regulator A; winged 97.96
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 97.96
4h1x_A265 PBP 2, phosphate-binding protein PSTS 2; periplasm 97.95
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 97.95
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 97.95
3e6m_A161 MARR family transcriptional regulator; APC88769, s 97.93
2nyx_A168 Probable transcriptional regulatory protein, RV14; 97.92
3boq_A160 Transcriptional regulator, MARR family; MARR famil 97.9
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 97.9
2pex_A153 Transcriptional regulator OHRR; transcription regu 97.9
3p7i_A321 PHND, subunit of alkylphosphonate ABC transporter; 97.89
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 97.89
3hrs_A214 Metalloregulator SCAR; DTXR/MNTR family member, tr 97.87
3s2w_A159 Transcriptional regulator, MARR family; structural 97.87
4ef1_A246 Pheromone COB1/lipoprotein, YAEC family; periplasm 97.87
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 97.86
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 97.84
3n5l_A310 Binding protein component of ABC phosphonate TRAN; 97.84
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 97.82
4aik_A151 Transcriptional regulator SLYA; transcription, tra 97.8
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 97.77
1yyv_A131 Putative transcriptional regulator; reductive meth 97.77
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 97.76
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 97.73
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 97.73
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 97.72
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 97.7
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 97.7
3nqo_A189 MARR-family transcriptional regulator; structural 97.7
1bja_A95 Transcription regulatory protein MOTA; activation 97.68
4a5n_A131 Uncharacterized HTH-type transcriptional regulato; 97.68
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 97.65
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 97.65
1fx7_A230 Iron-dependent repressor IDER; DTXR, iron-dependen 97.64
3k2d_A237 ABC-type metal ION transport system, periplasmic; 97.62
1sw5_A275 Osmoprotection protein (PROX); binding-protein, co 97.57
3qsl_A346 Putative exported protein; unknown, structural gen 97.57
4edp_A351 ABC transporter, substrate-binding protein; clostr 97.54
3uif_A 348 Sulfonate ABC transporter, periplasmic sulfonate- 97.53
3un6_A341 Hypothetical protein saouhsc_00137; structural gen 97.49
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 97.48
3f6o_A118 Probable transcriptional regulator, ARSR family pr 97.46
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 97.45
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 97.45
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 97.44
2g29_A 417 Nitrate transport protein NRTA; solute-binding pro 97.42
1xs5_A241 29 kDa protein, membrane lipoprotein TPN32; peripl 97.42
2wte_A244 CSA3; antiviral protein, viral resistance, winged 97.41
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 97.4
2oqg_A114 Possible transcriptional regulator, ARSR family P; 97.39
3tqw_A240 Methionine-binding protein; transport and binding 97.39
1sfx_A109 Conserved hypothetical protein AF2008; structural 97.36
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 97.33
3gxa_A275 Outer membrane lipoprotein GNA1946; periplasmic, L 97.32
2rin_A298 Putative glycine betaine-binding ABC transporter p 97.31
1y0u_A96 Arsenical resistance operon repressor, putative; s 97.28
2fxa_A207 Protease production regulatory protein HPR; protea 97.24
3up9_A245 Putative uncharacterized protein; membrane lipopro 97.2
3jth_A98 Transcription activator HLYU; transcription factor 97.15
2kko_A108 Possible transcriptional regulatory protein (possi 97.1
3o66_A282 Glycine betaine/carnitine/choline ABC transporter; 97.09
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 97.07
2p8t_A200 Hypothetical protein PH0730; pyrococcus horikoshii 97.04
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 97.0
4ib2_A252 Putative lipoprotein; putative methionine-bindning 96.99
3f6v_A151 Possible transcriptional regulator, ARSR family pr 96.94
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 96.91
1r9l_A309 Glycine betaine-binding periplasmic protein; perip 96.9
1okr_A123 MECI, methicillin resistance regulatory protein ME 96.85
3ir1_A245 Outer membrane lipoprotein GNA1946; D-methionine c 96.85
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 96.83
1g2h_A61 Transcriptional regulatory protein TYRR homolog; p 96.81
4got_A249 Methionine-binding lipoprotein METQ; NLPA lipoprot 96.79
3r6u_A284 Choline-binding protein; substrate binding protein 96.75
1zbm_A280 Hypothetical protein AF1704; alpha-beta protein, s 96.74
1p99_A295 Hypothetical protein PG110; structural genomics, P 96.68
2x7q_A321 Ca3427, possible thiamine biosynthesis enzyme; unk 96.65
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 96.55
1hsj_A487 Fusion protein consisting of staphylococcus access 96.52
1umq_A81 Photosynthetic apparatus regulatory protein; DNA-b 96.5
3e7l_A63 Transcriptional regulator (NTRC family); sigma43 a 96.48
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 96.46
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 96.43
2i49_A 429 Bicarbonate transporter; alpha-beta protein, C-cla 96.42
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 96.37
3onq_A262 Regulator of polyketide synthase expression; struc 96.29
3r0a_A123 Putative transcriptional regulator; structural gen 96.27
3hn0_A283 Nitrate transport protein; ABC transporter, struct 96.25
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 96.25
1ntc_A91 Protein (nitrogen regulation protein (NTRC)); heli 96.23
2o0m_A345 Transcriptional regulator, SORC family; structural 96.21
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 96.2
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 96.2
1mkm_A249 ICLR transcriptional regulator; structural genomic 96.18
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 96.16
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 96.11
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 96.09
2hin_A71 GP39, repressor protein; transcription factor, dim 96.08
2f5x_A312 BUGD; periplasmic binding protein, transport prote 95.98
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 95.96
2w25_A150 Probable transcriptional regulatory protein; trans 95.94
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 95.89
3h5t_A366 Transcriptional regulator, LACI family; DNA-depend 95.89
3l7w_A108 Putative uncharacterized protein SMU.1704; PADR, t 95.83
3c57_A95 Two component transcriptional regulatory protein; 95.77
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 95.72
3pu5_A333 Extracellular solute-binding protein; structural g 95.7
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 95.66
1eto_A98 FIS, factor for inversion stimulation; transcripti 95.64
1xma_A145 Predicted transcriptional regulator; southea colla 95.64
2esh_A118 Conserved hypothetical protein TM0937; APC5794, st 95.62
2dvz_A314 BUGE, putative exported protein; periplamsic bindi 95.58
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 95.46
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 95.43
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 95.42
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 95.4
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 95.38
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 95.38
3u1d_A151 Uncharacterized protein; GNTR-superfamily, structu 95.37
3f8b_A116 Transcriptional regulator, PADR-like family; winge 95.37
2czl_A272 Hypothetical protein TTHA1568; conserved hypotheti 95.35
2qpq_A301 Protein BUG27; alpha/beta domain, venus flytrap, t 95.32
4esb_A115 Transcriptional regulator, PADR family; DNA bindin 95.31
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 95.3
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 95.25
1xvx_A312 YFUA; periplasmic iron binding protein, iron bindi 95.19
4esf_A117 PADR-like transcriptional regulator; PADR family, 95.14
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 95.13
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 95.09
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 95.09
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 95.05
1ku9_A152 Hypothetical protein MJ223; putative transcription 94.97
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 94.97
1uly_A192 Hypothetical protein PH1932; helix-turn-helix, str 94.94
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 94.88
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 94.83
1nh8_A304 ATP phosphoribosyltransferase; prtase, de novo His 94.77
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 94.72
3rkx_A323 Biotin-[acetyl-COA-carboxylase] ligase; biotin pro 94.68
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 94.67
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 94.66
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 94.64
2xrn_A241 HTH-type transcriptional regulator TTGV; DNA-bindi 94.54
1j5y_A187 Transcriptional regulator, biotin repressor famil; 94.52
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 94.44
1sbp_A310 Sulfate-binding protein; 1.70A {Salmonella typhimu 94.42
4esw_A 342 Pyrimidine biosynthesis enzyme THI13; thiamin pyri 94.39
1o63_A219 ATP phosphoribosyltransferase; structural genomics 94.32
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 94.29
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 94.28
3hhh_A116 Transcriptional regulator, PADR family; PF03551, s 94.27
1qbj_A81 Protein (double-stranded RNA specific adenosine D 94.17
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 94.14
3elk_A117 Putative transcriptional regulator TA0346; structu 94.09
1rzs_A61 Antirepressor, regulatory protein CRO; helix-turn- 94.07
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 94.02
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 93.93
2g7u_A257 Transcriptional regulator; ICLR family, structural 93.92
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 93.91
2cob_A70 LCOR protein; MLR2, KIAA1795, helix-turn-helix, st 93.9
4i1d_A324 ABC transporter substrate-binding protein; structu 93.84
4g6q_A182 Putative uncharacterized protein; structural genom 93.81
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 93.77
1bia_A321 BIRA bifunctional protein; transcription regulatio 93.73
2p4w_A202 Transcriptional regulatory protein ARSR family; ar 93.72
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 93.71
3k2z_A196 LEXA repressor; winged helix-turn-helix, SOS syste 93.6
2vd2_A214 ATP phosphoribosyltransferase; HISG, glycosyltrans 93.52
1h3d_A299 ATP-phosphoribosyltransferase; hisitidine biosynth 93.44
2co5_A99 Viral protein F93; viral protein-winged helix comp 93.17
2o0y_A260 Transcriptional regulator; ICLR-family, structural 93.15
2vd3_A289 ATP phosphoribosyltransferase; metal-binding, glyc 93.01
3szt_A237 QCSR, quorum-sensing control repressor; quorum sen 92.9
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 92.88
4euo_A320 ABC transporter, substrate binding protein (polya; 92.84
2q0o_A236 Probable transcriptional activator protein TRAR; h 92.84
3e13_X322 Putative iron-uptake ABC transport system, peripla 92.75
1gtk_A313 Porphobilinogen deaminase; lyase, biosynthesis of 92.75
3ri2_A123 Transcriptional regulator, PADR-like family; PSI-b 92.72
3mq0_A275 Transcriptional repressor of the blcabc operon; he 92.7
2b4l_A268 Glycine betaine-binding protein; substrate-binding 92.69
1u78_A141 TC3 transposase, transposable element TC3 transpos 92.62
4h1x_A 265 PBP 2, phosphate-binding protein PSTS 2; periplasm 92.57
2w7n_A101 TRFB transcriptional repressor protein; INCP, plas 92.52
2vxz_A165 Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Py 92.45
1yg2_A179 Gene activator APHA; virulence factor, winged heli 92.07
2dql_A115 PEX protein; circadian clock associated protein, c 92.0
1z7m_E208 ATP phosphoribosyltransferase; ATP-PRT, histidine 91.99
2nxo_A291 Hypothetical protein SCO4506; PFAM, DUF178, NYSGXR 91.97
2jt1_A77 PEFI protein; solution structure, winged helix-tur 91.83
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding prote 91.79
1ve4_A206 ATP phosphoribosyltransferase; riken structural ge 91.77
1l3l_A234 Transcriptional activator protein TRAR; helix-turn 91.74
3qp6_A265 CVIR transcriptional regulator; quorum sensing, ag 91.34
4gl0_A333 LMO0810 protein; structural genomics, IDP05673, sp 91.33
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 91.27
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 91.21
2vn2_A128 DNAD, chromosome replication initiation protein; D 91.12
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 91.05
3rpw_A365 ABC transporter; structural genomics, PSI-biology, 90.95
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 90.94
1neq_A74 DNA-binding protein NER; NMR {Enterobacteria phage 90.7
2yu3_A95 DNA-directed RNA polymerase III 39 kDa polypeptide 90.34
2qlz_A232 Transcription factor PF0095; 2.50A {Pyrococcus fur 90.32
3r4k_A260 Transcriptional regulator, ICLR family; DNA/RNA-bi 90.29
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 90.18
1j1v_A94 Chromosomal replication initiator protein DNAA, 5' 90.1
2pfz_A301 Putative exported protein; extracytoplasmic solute 90.06
2hzl_A365 Trap-T family sorbitol/mannitol transporter, perip 89.96
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 89.93
2ia2_A265 Putative transcriptional regulator; SAD, PSI-2, st 89.85
1zx4_A192 P1 PARB, plasmid partition PAR B protein, PARB; tr 89.84
2k27_A159 Paired box protein PAX-8; paired domain, solution 89.77
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 89.7
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 89.66
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 89.15
3kjx_A344 Transcriptional regulator, LACI family; LACL famil 89.11
3kor_A119 Possible Trp repressor; putative DNA-binding Trp r 88.71
1p6r_A82 Penicillinase repressor; transcription regulation, 88.56
2e1n_A138 PEX, period extender; circadian clock, DNA binding 88.55
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 88.16
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 87.99
2jrt_A95 Uncharacterized protein; solution, structure, NESG 87.78
3e3m_A355 Transcriptional regulator, LACI family; structural 87.39
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 87.35
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 87.13
3by6_A126 Predicted transcriptional regulator; structural ge 86.96
3c9h_A355 ABC transporter, substrate binding protein; struct 86.95
2l8n_A67 Transcriptional repressor CYTR; bacterial gene rep 86.92
2pfy_A301 Putative exported protein; extracytoplasmic solute 86.87
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 86.83
3h5o_A339 Transcriptional regulator GNTR; transcription regu 86.75
4eqb_A330 Spermidine/putrescine ABC superfamily ATP binding 86.63
2zfw_A148 PEX; five alpha-helices + one beta-sheet, circadia 86.37
1jhg_A101 Trp operon repressor; complex (regulatory protein- 86.35
1qpz_A340 PURA, protein (purine nucleotide synthesis repress 85.87
3c3w_A225 Two component transcriptional regulatory protein; 85.19
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 85.15
3jvd_A333 Transcriptional regulators; structural genomics, P 85.15
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial 85.03
1nnf_A309 Iron-utilization periplasmic protein; iron-binding 84.83
3o6p_A229 Peptide ABC transporter, peptide-binding protein; 84.75
3bd1_A79 CRO protein; transcription factor, helix-turn-heli 83.96
2p5k_A64 Arginine repressor; DNA-binding domain, winged hel 83.85
4eq9_A246 ABC transporter substrate-binding protein-amino A 83.72
1iej_A 332 Ovotransferrin; iron, metal binding protein; 1.65A 83.71
1h45_A 334 Lactoferrin; metal transport, iron transport, meta 83.64
2rn7_A108 IS629 ORFA; helix, all alpha, unknown function, st 83.53
2oa4_A101 SIR5; structure, structural genomics, PSI-2, prote 83.53
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 83.52
3c7j_A237 Transcriptional regulator, GNTR family; structural 83.2
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 83.11
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 83.06
1i3j_A116 I-TEVI, intron-associated endonuclease 1; protein- 83.03
2l0k_A93 Stage III sporulation protein D; SPOIIID, solution 82.71
2qry_A330 Thiamine-binding periplasmic protein; thiamin bind 82.51
3u5c_T144 40S ribosomal protein S19-A; translation, ribosome 82.41
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 82.04
3g63_A 381 Pfluding; subatomic resolution, phosphate binding, 82.03
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 81.31
3iz6_S146 40S ribosomal protein S19 (S19E); eukaryotic ribos 81.27
3pvv_A101 Chromosomal replication initiator protein DNAA; he 81.21
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 80.64
1b4a_A149 Arginine repressor; helix turn helix; 2.50A {Geoba 80.62
1yio_A208 Response regulatory protein; transcription regulat 80.61
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 80.45
2auw_A170 Hypothetical protein NE0471; alpha-beta structure, 80.35
>1ixc_A CBNR, LYSR-type regulatory protein; long alpha helix connecting DNA binding and regulatory domai binding protein; 2.20A {Cupriavidus necator} SCOP: a.4.5.37 c.94.1.1 PDB: 1iz1_A Back     alignment and structure
Probab=100.00  E-value=1.3e-60  Score=390.65  Aligned_cols=291  Identities=15%  Similarity=0.157  Sum_probs=265.3

Q ss_pred             CchhhHHHHHHHHHhcCCHHHHHHHhCCCchHHHHHHHHHHHHcCceeEEecCCCccccCHhHHHHHHHHHHHHHHHHHH
Q psy3760           1 MNLHQFRFVREAVRQNFNLTEAAKALYTSQPGVSKAIIELEEELSIDIFIRHGKRIRGLTKPGQAILRSIEIIMQEIEGL   80 (306)
Q Consensus         1 m~~~~l~~f~~v~~~~~s~~~aA~~l~isq~~~s~~i~~LE~~lg~~Lf~R~~~~~~~lT~~G~~l~~~a~~il~~~~~~   80 (306)
                      ||+++|++|++|+++| ||++||++||+||||||++|++||++||++||+|+++|+ +||++|+.|+++++++++.++++
T Consensus         1 m~l~~l~~f~~v~~~g-s~s~AA~~L~isq~avS~~i~~LE~~lg~~Lf~R~~~~~-~lT~~G~~l~~~a~~~l~~~~~~   78 (294)
T 1ixc_A            1 MEFRQLKYFIAVAEAG-NMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGI-ELTAAGHAFLEDARRILELAGRS   78 (294)
T ss_dssp             CCHHHHHHHHHHHHHS-SHHHHHHHHTCCHHHHHHHHHHHHHHHTSCCBC-----C-CBCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CcHHHHHHHHHHHHcC-CHHHHHHHhCCCcchHHHHHHHHHHHHCCEEEEeCCCCe-eECHhHHHHHHHHHHHHHHHHHH
Confidence            8999999999999999 999999999999999999999999999999999999999 89999999999999999999999


Q ss_pred             HHHHHhhccCCCCcEEEEecccchhhhhHHHHHHHHHhCCCcEEEEEeCChhHHHHHHHcCCeeEEEEccccCCCCCcee
Q psy3760          81 KKIGKEFSAYDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLIS  160 (306)
Q Consensus        81 ~~~~~~~~~~~~~~l~I~~~~~~~~~~l~~~l~~~~~~~p~~~i~~~~~~~~~~~~~l~~~~~Di~i~~~~~~~~~~~~~  160 (306)
                      ...++.......|.|+||++++++..++++++..|.+.||++++++...++.++.+.|.+|++|++|+..+ ...+++..
T Consensus        79 ~~~~~~~~~~~~g~l~Ig~~~~~~~~~l~~~l~~f~~~~P~i~l~~~~~~~~~~~~~l~~g~~Dl~i~~~~-~~~~~l~~  157 (294)
T 1ixc_A           79 GDRSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFF-PRHPGIEI  157 (294)
T ss_dssp             HHHHHHHHHTCCEEEEEEECSGGGGTHHHHHHHHHHHHCTTEEEEEEECCHHHHHHHHHHTSCSEEEESCC-CCCTTEEE
T ss_pred             HHHHHHHhcCCCceEEEEEccchhHHHHHHHHHHHHHHCCCcEEEEEeCCHHHHHHHHHCCCccEEEEecC-CCCCCceE
Confidence            99998877778899999999999999999999999999999999999999999999999999999999654 55788999


Q ss_pred             eccccceEEEEecCCCCCCCCCCcChhhhcCCCeEeecC--CCCcHHHHHHHHHhCCCceeEEEEecCHHHHHHHHHhcc
Q psy3760         161 IPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDL--SFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRM  238 (306)
Q Consensus       161 ~~l~~~~~~~v~~~~~~l~~~~~i~~~dl~~~~~i~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~g~  238 (306)
                      .++++++++++++++||++.+..++++||.++|+|.+..  +...+..+++++...|+.+++.+++++..++..++.+|.
T Consensus       158 ~~l~~~~~~~v~~~~~pl~~~~~~~~~dL~~~~~i~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~v~~g~  237 (294)
T 1ixc_A          158 VNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGA  237 (294)
T ss_dssp             EEEEEEEEEEEEEGGGGGGTCSEECGGGGTTCEEEECCCSSSSCHHHHHHHHHHHTTCCCEEEEECSSHHHHHHHHHTTS
T ss_pred             EEEeeccEEEEEeCCCccccCCccCHHHHcCCCEEeeCCCCCchHHHHHHHHHHHCCCCcceeeecCCHHHHHHHHHcCC
Confidence            999999999999999999988899999999999999883  456678889999999999999999999999999999999


Q ss_pred             ceeeeecceecccccCCceeeecCCCCccceEEEEEeCCccccHHHHHHHHHHhHHhh
Q psy3760         239 GIGIIASIAFDSNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLN  296 (306)
Q Consensus       239 gi~~~p~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~  296 (306)
                      |++++|.++.. ...++++.+|+++.....++|++|+++. .+|.+++|++++++.++
T Consensus       238 Gia~lp~~~~~-~~~~~l~~~~l~~~~~~~~~~l~~~~~~-~~~~~~~f~~~l~~~~~  293 (294)
T 1ixc_A          238 ASSIVPASVAA-IRWPDIAFARIVGTRVKVPISCIFRKEK-QPPILARFVEHVRRSAK  293 (294)
T ss_dssp             CBEEEEHHHHT-SCCTTEEEEEECCTTCEEEEEEEEESSS-CCHHHHHHHHHHHHHHC
T ss_pred             eEEEechhhhh-cCCCceEEEECcCCCcceeEEEEEcCCC-CCHHHHHHHHHHHHHhc
Confidence            99999998743 3567899999987556789999999986 59999999999988764



>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A 3n6t_A 3n6u_A* Back     alignment and structure
>3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, structure initiative; 2.71A {Pseudomonas aeruginosa PA01} Back     alignment and structure
>2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein struc initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1 Back     alignment and structure
>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1 Back     alignment and structure
>2h9b_A HTH-type transcriptional regulator BENM; LTTR, transcriptional activator, LYSR-type transcripti regulator; 1.80A {Acinetobacter SP} PDB: 2h99_A 3k1m_A 3k1n_A 3k1p_A 2f7a_A* 2f6p_A 2f78_A 2f6g_A* 2f8d_A 2f97_A* Back     alignment and structure
>2h98_A HTH-type transcriptional regulator CATM; BENM, LTTR; 1.80A {Acinetobacter SP} PDB: 2h9q_A* 2f7b_A 2f7c_A* 3glb_A* 3m1e_A Back     alignment and structure
>1uth_A LYSR-type regulatory protein; transcription regulation, transcriptional regulator; 2.2A {Burkholderia SP} SCOP: c.94.1.1 PDB: 1utb_A 1utb_B 1uth_B 2uyf_A 2uye_A Back     alignment and structure
>3szp_A Transcriptional regulator, LYSR family; winged helix-turn helix, DNA-binding, transcription factor; 2.20A {Vibrio cholerae} PDB: 3t1b_B Back     alignment and structure
>3hhg_A Transcriptional regulator, LYSR family; transcription factor, structur genomics, oxford protein production facility, OPPF; 3.20A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3isp_A HTH-type transcriptional regulator RV1985C/MT2039; ROD shaped structure, DNA binding domain, regulatory domain, DNA-binding; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>3mz1_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative, MI center for STR uctural genomics, MCSG; 1.88A {Sinorhizobium meliloti} Back     alignment and structure
>2hxr_A HTH-type transcriptional regulator CYNR; CYNR transcriptional regulator LYSR struc genomics, PSI-2, protein structure initiative; 2.05A {Escherichia coli} PDB: 3hfu_A Back     alignment and structure
>2fyi_A HTH-type transcriptional regulator CBL; Lys-R family, cofactor-binding DO cysteine biosynthesis; 2.80A {Escherichia coli K12} SCOP: c.94.1.1 Back     alignment and structure
>3oxn_A Putative transcriptional regulator, LYSR family; structural genomics, PSI-2, protein structure initiative; 2.70A {Vibrio parahaemolyticus} Back     alignment and structure
>4ab5_A Transcriptional regulator, LYSR family; transcription factors; 2.51A {Neisseria meningitidis serogroup B} PDB: 4ab6_A Back     alignment and structure
>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis} Back     alignment and structure
>2y7p_A LYSR-type regulatory protein; transcription regulator, DNA-binding, transcription, transcr factor, transcription regulation; HET: SAL PEU; 1.85A {Burkholderia SP} PDB: 2y7k_A* 2y84_A 2y7w_A 2y7r_A Back     alignment and structure
>2ql3_A Probable transcriptional regulator, LYSR family P; APC7314, rhodococcus RHA1, structural genomics, PSI-2; HET: MSE; 2.05A {Rhodococcus SP} Back     alignment and structure
>3jv9_A OXYR, transcriptional regulator, LYSR family; LYSR-type transcriptional regulator, LTTR, redox, structural genomics, OPPF; 2.39A {Neisseria meningitidis} Back     alignment and structure
>1i6a_A OXYR, hydrogen peroxide-inducible genes activator; OXYR regulatory domain, oxidized form, transcription; 2.30A {Escherichia coli} SCOP: c.94.1.1 PDB: 1i69_A Back     alignment and structure
>3hhf_B Transcriptional regulator, LYSR family; transcription factor, structur genomics, oxford protein production facility, OPPF; 2.30A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3onm_A Transcriptional regulator LRHA; LYSR, ROVM, transcription factor, virulence factor; 2.40A {Yersinia pseudotuberculosis} Back     alignment and structure
>2qsx_A Putative transcriptional regulator, LYSR family; the putative transcriptional regulator, PSI-2, structure initiative, MCSG; 1.64A {Vibrio parahaemolyticus} Back     alignment and structure
>3kos_A HTH-type transcriptional activator AMPR; alpha-beta sandwich, DNA-binding, transcription regulation; HET: MES; 1.83A {Citrobacter freundii} PDB: 3kot_A Back     alignment and structure
>3fd3_A Chromosome replication initiation inhibitor prote; structural genomics, LYSR, PSI-2, structure initiative; HET: MSE P33 PG4; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ijl_A AGR_C_4647P, molybdenum-binding transcriptional repressor; structural GE DNA-binding protein, PSI-2, PROT structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1twy_A ABC transporter, periplasmic substrate-binding PR; nysgxrc target, structural genomics, protei structure initiative, PSI; 1.65A {Vibrio cholerae o1 biovar eltor} SCOP: c.94.1.1 Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure
>3cvg_A Putative metal binding protein; PSI-II, NYSGXRC, periplasmic, structural GENO protein structure initiative; 1.97A {Coccidioides immitis} Back     alignment and structure
>1b9m_A Protein (mode); DNA-binding, gene regulation, winged helix turn helix, molybdate, OB fold, transcription; 1.75A {Escherichia coli} SCOP: a.4.5.8 b.40.6.2 b.40.6.2 PDB: 1b9n_A 1o7l_A 1h9s_A 1h9r_A 1h9s_B Back     alignment and structure
>4ecf_A ABC-type phosphate transport system, periplasmic; ABC transporter, phosphate transport receptor; HET: MSE; 1.55A {Lactobacillus brevis} Back     alignment and structure
>4exl_A PBP 1, phosphate-binding protein PSTS 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; 1.70A {Streptococcus pneumoniae} Back     alignment and structure
>1ixh_A Phosphate-binding protein; phosphate transport, ultra high resolution, phosphate bindin protein; 0.98A {Escherichia coli} SCOP: c.94.1.1 PDB: 2abh_A 1a54_A* 1a55_A 1ixi_A 1quk_A 1ixg_A 1oib_A 1pbp_A 1qul_A 1qui_A 1quj_A 1a40_A 2z22_X Back     alignment and structure
>1atg_A MODA, periplasmic molybdate-binding protein; tungstate, ABC transporter; 1.20A {Azotobacter vinelandii} SCOP: c.94.1.1 Back     alignment and structure
>3muq_A Uncharacterized conserved protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.05A {Vibrio parahaemolyticus} Back     alignment and structure
>3lr1_A Tungstate ABC transporter, periplasmic tungstate- binding protein; the tungstate ABC transporter, structural genomics, PSI, MCSG; 1.80A {Geobacter sulfurreducens} Back     alignment and structure
>3kn3_A Putative periplasmic protein; alpha-beta structure, periplasmic binding protein fold, STRU genomics, PSI-2, protein structure initiative; HET: GSH CIT; 2.41A {Wolinella succinogenes} Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>4gd5_A Phosphate ABC transporter, phosphate-binding PROT; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.70A {Clostridium perfringens} Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>3r26_A Molybdate-binding periplasmic protein; protein binding; 1.70A {Escherichia coli} SCOP: c.94.1.1 PDB: 3axf_A 1amf_A 1wod_A Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>3cij_A UPF0100 protein AF_0094; archaeal periplasmic binding protein, unknown function, metal binding protein, transport protein; 1.07A {Archaeoglobus fulgidus} PDB: 2ons_A 2onk_E 2onr_A Back     alignment and structure
>3cfx_A UPF0100 protein MA_0280; ABC transporter, binding protein, molybdate, tungstate, LIGA unknown function, transport protein; 1.60A {Methanosarcina acetivorans} Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>2ovg_A Phage lambda CRO; transcription factor, helix-turn-helix, bacteriophage, flexi transcription; 1.35A {Enterobacteria phage lambda} PDB: 2ecs_A 1cop_D 4cro_A* 5cro_O 1orc_A 2orc_A 2a63_A 1d1l_A 6cro_A* 3orc_A* 1d1m_B Back     alignment and structure
>3cfz_A UPF0100 protein MJ1186; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2hxw_A Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A* Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>3k6v_A Solute-binding protein MA_0280; MODA, molybdate, periplasmic BIN protein, ABC transporter, transport protein, ligand, metal- protein; HET: CIT; 1.69A {Methanosarcina acetivorans} PDB: 3k6u_A* 3k6w_A 3k6x_A Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>3cg1_A UPF0100 protein PF0080; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Pyrococcus furiosus} PDB: 3cg3_A Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>4ddd_A Immunogenic protein; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, immune system; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} Back     alignment and structure
>2cw1_A SN4M; lambda CRO fold, de novo protein; NMR {Synthetic} SCOP: k.46.1.1 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>3tmg_A Glycine betaine, L-proline ABC transporter, glycine/betaine/L-proline-binding protein...; ssgcid, structural genomics; 1.90A {Borrelia burgdorferi} Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>3l6g_A Betaine ABC transporter permease and substrate BI protein; glycine betaine binding, substrate binding domain, venus FLY cell membrane; HET: B3P; 1.90A {Lactococcus lactis} PDB: 3l6h_A Back     alignment and structure
>2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>4h1x_A PBP 2, phosphate-binding protein PSTS 2; periplasmic binding protein, PF12849 family; HET: MSE CIT; 1.77A {Streptococcus pneumoniae} Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>4ef1_A Pheromone COB1/lipoprotein, YAEC family; periplasmic methionine binding protein, NLPA lipoprotein, ST genomics; 1.90A {Enterococcus faecalis} PDB: 4ef2_A* Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A Back     alignment and structure
>4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>3k2d_A ABC-type metal ION transport system, periplasmic; alpha/beta domain, immune system; 2.60A {Vibrio vulnificus} Back     alignment and structure
>1sw5_A Osmoprotection protein (PROX); binding-protein, compatible solutes, cation-PI interactions, classical hydrogen bonds, protein binding; 1.80A {Archaeoglobus fulgidus} SCOP: c.94.1.1 PDB: 1sw4_A 1sw1_A 1sw2_A 3mam_A* Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>4edp_A ABC transporter, substrate-binding protein; clostridium PERF ATCC 13124, center for structural genomics of infectious DI csgid; 1.85A {Clostridium perfringens} Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>2g29_A Nitrate transport protein NRTA; solute-binding protein, alpha-beta protein; 1.50A {Synechocystis SP} Back     alignment and structure
>1xs5_A 29 kDa protein, membrane lipoprotein TPN32; periplasmic binding protein, methionine, membrane protein; 1.85A {Treponema pallidum} SCOP: c.94.1.1 Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>3tqw_A Methionine-binding protein; transport and binding proteins, transport protein; HET: MSE; 2.00A {Coxiella burnetii} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>3gxa_A Outer membrane lipoprotein GNA1946; periplasmic, L-methionine bingding, protein binding; 2.25A {Neisseria meningitidis} Back     alignment and structure
>2rin_A Putative glycine betaine-binding ABC transporter protein; type II binding protein, aromatic BOX, acetylcholine, protein binding; HET: ACH; 1.80A {Rhizobium meliloti} PDB: 2rej_A 2rf1_A 2reg_A* 3hcq_A Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3up9_A Putative uncharacterized protein; membrane lipoprotein, L-methionine binding protein, NLPA LIP structural genomics; HET: PG4 PE4; 2.35A {Actinomyces odontolyticus} SCOP: c.94.1.0 Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3o66_A Glycine betaine/carnitine/choline ABC transporter; structural genomics, PSI-2, protein structure initiative; HET: PGE; 1.86A {Staphylococcus aureus subsp} SCOP: c.94.1.0 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>2p8t_A Hypothetical protein PH0730; pyrococcus horikoshii OT3, STR genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.72 d.74.4.2 Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>4ib2_A Putative lipoprotein; putative methionine-bindning, NLPA lipoprotein, PF03180 FAMI structural genomics, joint center for structural genomics; 1.76A {Ruminococcus gnavus} Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>1r9l_A Glycine betaine-binding periplasmic protein; periplasmic binding protein, cation-PI interactions, tryptophan BOX, protein binding; 1.59A {Escherichia coli} SCOP: c.94.1.1 PDB: 1r9q_A* Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>3ir1_A Outer membrane lipoprotein GNA1946; D-methionine cultured, protein binding; 2.15A {Neisseria meningitidis} Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>1g2h_A Transcriptional regulatory protein TYRR homolog; protein structure, , DNA-binding domain, helix- turn-helix motif; NMR {Haemophilus influenzae} SCOP: a.4.1.12 Back     alignment and structure
>4got_A Methionine-binding lipoprotein METQ; NLPA lipoprotein, PF03180 family, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.95A {Bacillus subtilis subsp} Back     alignment and structure
>3r6u_A Choline-binding protein; substrate binding protein, ABC-transporter, extracellular, transport protein; 1.61A {Bacillus subtilis} SCOP: c.94.1.0 PDB: 3ppq_A 3ppo_A* 3ppp_A 3ppn_A 3ppr_A* Back     alignment and structure
>1zbm_A Hypothetical protein AF1704; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.30A {Archaeoglobus fulgidus} SCOP: c.94.1.1 Back     alignment and structure
>1p99_A Hypothetical protein PG110; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Staphylococcus aureus subsp} SCOP: c.94.1.1 Back     alignment and structure
>2x7q_A Ca3427, possible thiamine biosynthesis enzyme; unknown function; 2.00A {Candida albicans} PDB: 2x7p_A Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>2i49_A Bicarbonate transporter; alpha-beta protein, C-clamp, ABC transporter, periplasmic SO binding protein, bicarbonate-binding protein; 1.35A {Synechocystis SP} PDB: 2i48_A 2i4b_A 2i4c_A Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>3onq_A Regulator of polyketide synthase expression; structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Bifidobacterium adolescentis} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3hn0_A Nitrate transport protein; ABC transporter, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; 1.75A {Parabacteroides distasonis} Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1ntc_A Protein (nitrogen regulation protein (NTRC)); helix-turn-helix, FIS, four-helix bundle, transcription regulation; NMR {Salmonella typhimurium} SCOP: a.4.1.12 Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2hin_A GP39, repressor protein; transcription factor, dimer interface, helix-turn-helix; 1.05A {Enterobacteria phage N15} PDB: 3qws_A Back     alignment and structure
>2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I} Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3pu5_A Extracellular solute-binding protein; structural genomics, PSI-2, protein structure initiative; 2.05A {Bordetella parapertussis} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>1eto_A FIS, factor for inversion stimulation; transcriptional activation region, DNA-binding protein, transcription activator; 1.90A {Escherichia coli} SCOP: a.4.1.12 PDB: 1etq_A 1ety_A 1fia_A 3fis_A 3iv5_A* 3jr9_A* 3jra_A* 3jrb_A* 3jrc_A* 3jrd_A* 3jre_A* 3jrf_A* 3jrg_A* 3jrh_A* 3jri_A* 1f36_A 1etv_A 1etk_A 1etx_A 1fip_A ... Back     alignment and structure
>1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 Back     alignment and structure
>2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 Back     alignment and structure
>2dvz_A BUGE, putative exported protein; periplamsic binding proteins, carboxylate binding, glutamate, transport protein; HET: GLU; 2.30A {Bordetella pertussis} Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} Back     alignment and structure
>3f8b_A Transcriptional regulator, PADR-like family; winged helix turn helix, transcription regulator; 2.00A {Lactococcus lactis subsp} SCOP: a.4.5.0 PDB: 3f8c_A* 3f8f_A* Back     alignment and structure
>2czl_A Hypothetical protein TTHA1568; conserved hypothetical protein, extremely thermoph bacteria, structural genomics, NPPSFA; HET: CME TLA XPE; 1.55A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 2dbp_A* 3a3u_A* Back     alignment and structure
>2qpq_A Protein BUG27; alpha/beta domain, venus flytrap, transport protein; HET: CIT; 1.92A {Bordetella pertussis} Back     alignment and structure
>4esb_A Transcriptional regulator, PADR family; DNA binding protein, HTH fold; 2.50A {Bacillus cereus} Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>1xvx_A YFUA; periplasmic iron binding protein, iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A* Back     alignment and structure
>4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1nh8_A ATP phosphoribosyltransferase; prtase, de novo His biosynthesis, PRPP, structural genomics, PSI, protei structure initiative; HET: AMP HIS; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.94.1.1 d.58.5.3 PDB: 1nh7_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>1sbp_A Sulfate-binding protein; 1.70A {Salmonella typhimurium} SCOP: c.94.1.1 Back     alignment and structure
>4esw_A Pyrimidine biosynthesis enzyme THI13; thiamin pyrimidine biosynthesis, transferase; HET: CIT; 1.60A {Candida albicans} PDB: 4esx_A* Back     alignment and structure
>1o63_A ATP phosphoribosyltransferase; structural genomics; 2.00A {Thermotoga maritima} SCOP: c.94.1.1 PDB: 1o64_A 1usy_E* 1usy_H* Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>3elk_A Putative transcriptional regulator TA0346; structural genomics, PSI-2, prote structure initiative; 1.70A {Thermoplasma acidophilum} Back     alignment and structure
>1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 Back     alignment and structure
>4i1d_A ABC transporter substrate-binding protein; structural genomics, PSI-biology; 2.20A {Bradyrhizobium japonicum} Back     alignment and structure
>4g6q_A Putative uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.08A {Kribbella flavida} Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>2vd2_A ATP phosphoribosyltransferase; HISG, glycosyltransferase, histidine biosynthes amino-acid biosynthesis; 2.85A {Bacillus subtilis} Back     alignment and structure
>1h3d_A ATP-phosphoribosyltransferase; hisitidine biosynthesis, glycosyltransferase; HET: AMP TLA; 2.7A {Escherichia coli} SCOP: c.94.1.1 d.58.5.3 PDB: 1q1k_A* Back     alignment and structure
>2co5_A Viral protein F93; viral protein-winged helix complex, winged helix, DNA-bindin WHTH, disulfide bond, STIV; 2.2A {Sulfolobus turreted icosahedral virus} SCOP: a.4.5.48 Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>2vd3_A ATP phosphoribosyltransferase; metal-binding, glycosyltransferase, HISG, histidine, magnesi transferase; HET: HIS; 2.45A {Methanobacterium thermoautotrophicum} Back     alignment and structure
>3szt_A QCSR, quorum-sensing control repressor; quorum sensing acyl-homoserine lactone, helix-turn-helix, transcription factor, 3-OXO-C12 HSL; HET: OHN; 2.55A {Pseudomonas aeruginosa} Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>4euo_A ABC transporter, substrate binding protein (polya; class D of PBP, GABA-binding, transport protein; 1.28A {Agrobacterium tumefaciens} PDB: 4eq7_A Back     alignment and structure
>2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} Back     alignment and structure
>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} SCOP: c.94.1.1 PDB: 1y4t_A Back     alignment and structure
>1gtk_A Porphobilinogen deaminase; lyase, biosynthesis of linear tetrapyrrole, all alpha/beta; HET: DPM; 1.66A {Escherichia coli} SCOP: c.94.1.1 d.50.2.1 PDB: 1ah5_A* 2ypn_A* 1ypn_A* 1pda_A* Back     alignment and structure
>3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} Back     alignment and structure
>2b4l_A Glycine betaine-binding protein; substrate-binding protein, closed liganded, ABC-transporter, compatible solutes, transport protein; 2.00A {Bacillus subtilis} PDB: 2b4m_A* 3chg_D Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>4h1x_A PBP 2, phosphate-binding protein PSTS 2; periplasmic binding protein, PF12849 family; HET: MSE CIT; 1.77A {Streptococcus pneumoniae} Back     alignment and structure
>2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} Back     alignment and structure
>2vxz_A Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Pyrobaculum spherical virus} Back     alignment and structure
>1yg2_A Gene activator APHA; virulence factor, winged helix, transcripti factor, transcription; 2.20A {Vibrio cholerae} SCOP: a.4.5.61 Back     alignment and structure
>2dql_A PEX protein; circadian clock associated protein, circadian clock protein; 1.70A {Anabaena SP} Back     alignment and structure
>1z7m_E ATP phosphoribosyltransferase; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: c.94.1.1 PDB: 1z7n_E* Back     alignment and structure
>2nxo_A Hypothetical protein SCO4506; PFAM, DUF178, NYSGXRC, 10093F, PSI-2, structural genomics, protein structure initiative; 2.04A {Streptomyces coelicolor} SCOP: c.94.1.1 Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>1ve4_A ATP phosphoribosyltransferase; riken structural genomics/proteomics initiative structural genomics; 1.20A {Thermus thermophilus} SCOP: c.94.1.1 Back     alignment and structure
>1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* Back     alignment and structure
>3qp6_A CVIR transcriptional regulator; quorum sensing, agonist, antagonist, LUXR, acylated homoseri lactone, transcription factor; HET: HL6; 2.00A {Chromobacterium violaceum} PDB: 3qp5_A* Back     alignment and structure
>4gl0_A LMO0810 protein; structural genomics, IDP05673, spermidine, putrescine, ABC transporter, niaid; HET: MSE PGE PG4; 1.92A {Listeria monocytogenes} Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>3rpw_A ABC transporter; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE; 1.65A {Rhodopseudomonas palustris} Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A Back     alignment and structure
>2yu3_A DNA-directed RNA polymerase III 39 kDa polypeptide F variant; winged helix domain, RNA polymerase III C39 subunit, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 Back     alignment and structure
>2pfz_A Putative exported protein; extracytoplasmic solute receptor, tripartite ATP independent periplasmic transport, pyroglutamic acid; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>2hzl_A Trap-T family sorbitol/mannitol transporter, periplasmic binding protein, SMOM; trap transporter, periplasmic subunit, ligand binding; 1.40A {Rhodobacter sphaeroides 2} PDB: 2hzk_A Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>2e1n_A PEX, period extender; circadian clock, DNA binding protein, circadian clock protei; 1.80A {Synechococcus elongatus pcc 7942} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>3c9h_A ABC transporter, substrate binding protein; structural genom MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>2l8n_A Transcriptional repressor CYTR; bacterial gene repressor, helix turn helix binding domain, L family, transcription regulation, binding protein; NMR {Escherichia coli} PDB: 2lcv_A Back     alignment and structure
>2pfy_A Putative exported protein; extracytoplasmic solute receptor, tripartite ATP independent periplasmic transport, pyroglutamic acid; 1.95A {Bordetella pertussis tohama I} Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>4eqb_A Spermidine/putrescine ABC superfamily ATP binding transporter, binding protein; structural genomics, niaid; HET: EPE; 1.50A {Streptococcus pneumoniae TCH8431} Back     alignment and structure
>2zfw_A PEX; five alpha-helices + one beta-sheet, circadian clock protein; 2.90A {Synechococcus SP} Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 3od7_A 3odb_A 1qvs_A 2o6a_A 2o68_A 3kn8_A 3kn7_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A Back     alignment and structure
>3o6p_A Peptide ABC transporter, peptide-binding protein; structural genomics, PSI-2, protein structure initiative; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution, transcription; 1.40A {Xylella fastidiosa} Back     alignment and structure
>2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* Back     alignment and structure
>1h45_A Lactoferrin; metal transport, iron transport, metal binding; 1.95A {Homo sapiens} SCOP: c.94.1.2 PDB: 1eh3_A 2pms_A* 1h43_A 1h44_A 1dsn_A 1lct_A 1hse_A 1vfe_A 1l5t_A 1vfd_A 1lgb_C* 1z6v_A 1z6w_A Back     alignment and structure
>2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} Back     alignment and structure
>2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>3c7j_A Transcriptional regulator, GNTR family; structural genomics, PSI-2, protein structure initiative, midwest center for STR genomics; HET: MSE; 2.10A {Pseudomonas syringae PV} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>1i3j_A I-TEVI, intron-associated endonuclease 1; protein-DNA complex, extended structure, Zn-finger, minor groove helix, helix-turn-helix; 2.20A {Enterobacteria phage T4} SCOP: d.285.1.1 PDB: 1t2t_A Back     alignment and structure
>2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} Back     alignment and structure
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Back     alignment and structure
>3u5c_T 40S ribosomal protein S19-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_S 3o30_M 3o2z_M 3u5g_T 3jyv_T* Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>3iz6_S 40S ribosomal protein S19 (S19E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3pvv_A Chromosomal replication initiator protein DNAA; helix-turn-helix motif, interacting with DNAA-BOX, DNAA-box; HET: DNA; 2.00A {Mycobacterium tuberculosis} PDB: 3pvp_A* Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>1b4a_A Arginine repressor; helix turn helix; 2.50A {Geobacillus stearothermophilus} SCOP: a.4.5.3 d.74.2.1 PDB: 1f9n_A Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>2auw_A Hypothetical protein NE0471; alpha-beta structure, structural genomics, PSI, protein STRU initiative; 1.85A {Nitrosomonas europaea} SCOP: a.35.1.10 d.331.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 306
d1al3a_237 c.94.1.1 (A:) Cofactor-binding fragment of LysR-ty 5e-34
d2fyia1220 c.94.1.1 (A:88-307) LysR-type regulatory protein C 4e-24
d1i6aa_212 c.94.1.1 (A:) Hydrogen peroxide-inducible genes Ly 1e-15
d2esna189 a.4.5.37 (A:3-91) Probable LysR-type transcription 4e-11
d2esna2212 c.94.1.1 (A:92-303) Probable LysR-type transcripti 1e-10
d1utha_219 c.94.1.1 (A:) LysR-type regulatory protein DntR {B 4e-10
d1ixca189 a.4.5.37 (A:1-89) LysR-type regulatory protein Cbn 7e-09
d1ixca2205 c.94.1.1 (A:90-294) LysR-type regulatory protein C 2e-06
d1b9ma1127 a.4.5.8 (A:-1-126) N-terminal domain of molybdate- 5e-05
>d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type protein CysB {Klebsiella aerogenes [TaxId: 28451]} Length = 237 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Cofactor-binding fragment of LysR-type protein CysB
species: Klebsiella aerogenes [TaxId: 28451]
 Score =  122 bits (306), Expect = 5e-34
 Identities = 93/214 (43%), Positives = 139/214 (64%)

Query: 91  DTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTE 150
           D G+L +ATTHTQARYALP +IK F  ++P+V L + QG+P QI E +    AD AI TE
Sbjct: 4   DKGSLYVATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATE 63

Query: 151 ILSPSDKLISIPCYQWEYVIIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDRE 210
            L   D L+ +PCY W   I+V  +HPL    S+S++E++ YPL+TY   F+GR +LD  
Sbjct: 64  ALHLYDDLVMLPCYHWNRSIVVTPEHPLATKGSVSIEELAQYPLVTYTFGFTGRSELDTA 123

Query: 211 FSLQKLTPYIVLETINSDIIKTYVELRMGIGIIASIAFDSNRDKNLRSISASHLFGTTIS 270
           F+   LTP IV    ++D+IKTYV L +G+G+IAS+A D   D +L  + A+ +F  + +
Sbjct: 124 FNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPVSDPDLVKLDANGIFSHSTT 183

Query: 271 RVIIKQGTYLRSYVYSFIKLLSPKLNRKFINKIL 304
           ++  ++ T+LRSY+Y FI+  +P L R  ++  +
Sbjct: 184 KIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAV 217


>d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]} Length = 220 Back     information, alignment and structure
>d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]} Length = 212 Back     information, alignment and structure
>d2esna1 a.4.5.37 (A:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Length = 89 Back     information, alignment and structure
>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d1utha_ c.94.1.1 (A:) LysR-type regulatory protein DntR {Burkholderia sp. [TaxId: 36773]} Length = 219 Back     information, alignment and structure
>d1ixca1 a.4.5.37 (A:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} Length = 89 Back     information, alignment and structure
>d1ixca2 c.94.1.1 (A:90-294) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} Length = 205 Back     information, alignment and structure
>d1b9ma1 a.4.5.8 (A:-1-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]} Length = 127 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d2fyia1220 LysR-type regulatory protein Cbl {Escherichia coli 100.0
d1al3a_237 Cofactor-binding fragment of LysR-type protein Cys 100.0
d1i6aa_212 Hydrogen peroxide-inducible genes LysR-type activa 100.0
d1utha_219 LysR-type regulatory protein DntR {Burkholderia sp 99.97
d1ixca2205 LysR-type regulatory protein CbnR {Ralstonia eutro 99.97
d2esna2212 Probable LysR-type transcriptional regulator PA047 99.97
d1ixca189 LysR-type regulatory protein CbnR {Ralstonia eutro 99.96
d2esna189 Probable LysR-type transcriptional regulator PA047 99.95
d1b9ma1127 N-terminal domain of molybdate-dependent transcrip 99.91
d1twya_249 ABC transporter, periplasmic substrate-binding pro 99.49
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 98.29
d1atga_231 Molybdate-binding protein, ModA {Azotobacter vinel 98.08
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 98.05
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 98.04
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 98.03
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 97.99
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 97.94
d1ixha_321 Phosphate-binding protein {Escherichia coli [TaxId 97.93
d1xs5a_240 Putative lipoprotein (NlpA family) {Treponema pall 97.89
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 97.87
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 97.86
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 97.85
d1pc3a_333 Phosphate-binding protein {Mycobacterium tuberculo 97.83
d1amfa_231 Molybdate-binding protein, ModA {Escherichia coli 97.82
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 97.8
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 97.79
d2fbka1172 Transcriptional regulator DR1159 {Deinococcus radi 97.79
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 97.75
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 97.73
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 97.73
d1us5a_298 Putative GluR0 ligand binding core {Thermus thermo 97.67
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 97.67
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 97.67
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 97.59
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 97.55
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 97.52
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 97.48
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 97.39
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 97.38
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 97.32
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.3
d1z91a1137 Organic hydroperoxide resistance transcriptional r 97.26
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 97.21
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 97.2
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 97.18
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 97.18
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 97.15
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 97.12
d1g2ha_61 Transcriptional regulator TyrR, C-terminal domain 97.11
d1z7ua1108 Hypothetical protein EF0647 {Enterococcus faecalis 97.05
d1umqa_60 Photosynthetic apparatus regulatory protein PprA ( 97.02
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 96.92
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu 96.82
d1d1la_61 cro lambda repressor {Bacteriophage lambda [TaxId: 96.8
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 96.71
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 96.62
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 96.61
d2hzta195 Putative transcriptional regulator YtcD {Bacillus 96.57
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 96.54
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 96.51
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 96.51
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 96.5
d1yyva1114 Putative transcriptional regulator YtfH {Salmonell 96.47
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 96.43
d2fswa1102 Hypothetical protein PG0823 {Porphyromonas gingiva 96.4
d1ntca_91 DNA-binding domain of NTRC {Salmonella typhimurium 96.4
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 96.38
d2f2ea1142 Hypothetical protein PA1607 {Pseudomonas aeruginos 96.26
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 96.23
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 96.23
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 96.17
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 96.17
d1p4wa_87 Transcriptional regulator RcsB {Erwinia amylovora 96.14
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 96.13
d1etxa_89 FIS protein {Escherichia coli [TaxId: 562]} 96.13
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 96.01
d1yioa170 Response regulatory protein StyR, C-terminal domai 95.98
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 95.86
d1mkma175 Transcriptional regulator IclR, N-terminal domain 95.84
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 95.83
d1p99a_255 Putative lipoprotein (NlpA family) {Staphylococcus 95.82
d1sbpa_309 Sulphate-binding protein {Salmonella typhimurium [ 95.28
d1ulya_190 Hypothetical protein PH1932 {Pyrococcus horikoshii 94.87
d1xvxa_311 Ferric-binding protein FbpA {Yersinia enterocoliti 94.57
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 94.23
d1sw5a_270 Osmoprotection protein ProX {Archaeoglobus fulgidu 94.1
d1rzsa_61 cro p22 {Bacteriophage p22 [TaxId: 10754]} 94.01
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escheri 93.7
d1h3da1220 ATP phosphoribosyltransferase (ATP-PRTase, HisG), 93.69
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [T 93.63
d1pdaa1217 Porphobilinogen deaminase (hydroxymethylbilane syn 93.62
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 93.5
d2p4wa1194 Transcriptional regulatory protein PF1790 {Pyrococ 93.47
d1u3em269 Intron-encoded homing endonuclease I-HmuI {Bacteri 92.75
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 92.72
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 92.7
d2nxoa1277 Hypothetical protein SCo4506 {Streptomyces coelico 92.39
d2p8ta169 Hypothetical protein PH0730 {Pyrococcus horikoshii 92.32
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 91.61
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 91.55
d2obpa181 Putative DNA-binding protein ReutB4095 {Ralstonia 91.06
d1qpza157 Purine repressor (PurR), N-terminal domain {Escher 90.93
d1zyba173 Probable transcription regulator BT4300, C-termina 90.9
d1i3ja_96 DNA-binding domain of intron endonuclease I-TevI { 90.81
d1o63a_203 ATP phosphoribosyltransferase (ATP-PRTase, HisG), 90.79
d1uxda_59 Fructose repressor (FruR), N-terminal domain {Esch 90.7
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 90.42
d1i5za169 Catabolite gene activator protein (CAP), C-termina 89.59
d1tw3a185 Carminomycin 4-O-methyltransferase {Streptomyces p 89.59
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 89.56
d1vz0a193 Putative partitioning protein ParB/Spo0J {Thermus 89.09
d2onsa1311 Molybdate-binding protein, ModA {Archaeoglobus ful 88.93
d1nh8a1210 ATP phosphoribosyltransferase (ATP-PRTase, HisG), 88.65
d1stza187 Heat-inducible transcription repressor HrcA, N-ter 88.35
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 88.21
d1efaa159 Lac repressor (LacR), N-terminal domain {Escherich 88.01
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 86.87
d1y0ua_89 Putative arsenical resistance operon repressor AF0 86.45
d2qmwa1184 Prephenate dehydratase {Staphylococcus aureus [Tax 86.33
d1r9la_309 Glycine betaine-binding periplasmic protein ProX { 86.31
d1q35a_318 Ferric-binding protein FbpA {Mannheimia haemolytic 85.27
d1j9ia_68 Terminase gpNU1 subunit domain {Bacteriophage lamb 85.22
d1r71a_114 Transcriptional repressor protein KorB DNA-binding 85.19
d1hlva166 DNA-binding domain of centromere binding protein B 85.0
d1hw1a174 Fatty acid responsive transcription factor FadR, N 84.87
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 83.52
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 82.95
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 82.81
d1qzza192 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 82.67
d2p5ka163 Arginine repressor (ArgR), N-terminal DNA-binding 82.45
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 81.39
d1xmaa_103 Predicted transcriptional regulator {Clostridium t 81.31
d2b0la191 GTP-sensing transcriptional pleiotropic repressor 81.28
d2icta187 Antitoxin HigA {Escherichia coli [TaxId: 562]} 80.47
d2esha1114 Hypothetical protein TM0937 {Thermotoga maritima [ 80.24
d2o3fa183 Putative transcriptional regulator YbbH {Bacillus 80.03
>d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: LysR-type regulatory protein Cbl
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.5e-35  Score=229.96  Aligned_cols=213  Identities=40%  Similarity=0.729  Sum_probs=199.3

Q ss_pred             CCCCcEEEEecccchhhhhHHHHHHHHHhCCCcEEEEEeCChhHHHHHHHcCCeeEEEEccccCCCCCceeeccccceEE
Q psy3760          90 YDTGNLTIATTHTQARYALPKIIKEFTIQFPKVKLSLLQGNPKQITEMIRNDQADIAIVTEILSPSDKLISIPCYQWEYV  169 (306)
Q Consensus        90 ~~~~~l~I~~~~~~~~~~l~~~l~~~~~~~p~~~i~~~~~~~~~~~~~l~~~~~Di~i~~~~~~~~~~~~~~~l~~~~~~  169 (306)
                      ..+|+||||++++++..++|+++..|.++||++++++...++.++.+.|.+|++|++|+..+....+++...++.+++++
T Consensus         3 ~~sG~l~i~~~~~~~~~~Lp~~l~~f~~~~P~i~l~i~~~~~~~~~~~l~~g~~Di~i~~~~~~~~~~~~~~~l~~~~~~   82 (220)
T d2fyia1           3 DTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHS   82 (220)
T ss_dssp             TCCEEEEEEECHHHHHHTHHHHHHHHHHHCTTEEEEEEECCHHHHHHHHHHTSCSEEEESSSSTTCTTEEEEEEEEECEE
T ss_pred             CCCEEEEEEEEHHHHHHHHHHHHHHHHHHCCCcEEEEEECCcHHHHHHHHhhhhhhhhhcccccccccccccccccccce
Confidence            46899999999999999999999999999999999999999999999999999999999766555678999999999999


Q ss_pred             EEecCCCCCCCCCCcChhhhcCCCeEeecCCCCcHHHHHHHHHhCCCceeEEEEecCHHHHHHHHHhccceeeeecceec
Q psy3760         170 IIVPLDHPLLLLNSISLKEISNYPLITYDLSFSGRIKLDREFSLQKLTPYIVLETINSDIIKTYVELRMGIGIIASIAFD  249 (306)
Q Consensus       170 ~v~~~~~~l~~~~~i~~~dl~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~g~gi~~~p~~~~~  249 (306)
                      ++++++||++.++.++++||.++||+.+..++..+..+..++...++.|++.+++++...+..++.+|.|++++|.+.+.
T Consensus        83 ~v~~~~~~~~~~~~~~~~dL~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~g~gi~ilp~~~~~  162 (220)
T d2fyia1          83 LLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSG  162 (220)
T ss_dssp             EEEETTCGGGTSSSCCHHHHTTSCEEEECTTSTTHHHHHHHHHHTTCCCCEEEEESSHHHHHHHHHHTSCEEEEEGGGGS
T ss_pred             eeccccccccccCcchhhhhccccccccccccchHHHHHHHHhhcccCCceeEEEccHHHHHHHHhhcceEEeCcHHHHH
Confidence            99999999999999999999999999999988889999999999999999999999999999999999999999998887


Q ss_pred             ccccCCceeeecCCCCccceEEEEEeCCccccHHHHHHHHHHhHHhhHHHHHh
Q psy3760         250 SNRDKNLRSISASHLFGTTISRVIIKQGTYLRSYVYSFIKLLSPKLNRKFINK  302 (306)
Q Consensus       250 ~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  302 (306)
                      ....++++.+++.+......+|++|++++..+|.++.|++++++.+....+++
T Consensus       163 ~~~~~~l~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~Fi~~~~~~~~~~~~~~  215 (220)
T d2fyia1         163 EQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKR  215 (220)
T ss_dssp             TTCCTTEEEECCTTTSCCEEEEEEEETTCCBCHHHHHHHHHHCSSSCHHHHHH
T ss_pred             HHhcCCEEEEeCCCCCCceEEEEEEECCCcCCHHHHHHHHHHHHcCCHHHHHH
Confidence            76667799999988777889999999999999999999999999998777743



>d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type protein CysB {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1utha_ c.94.1.1 (A:) LysR-type regulatory protein DntR {Burkholderia sp. [TaxId: 36773]} Back     information, alignment and structure
>d1ixca2 c.94.1.1 (A:90-294) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ixca1 a.4.5.37 (A:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d2esna1 a.4.5.37 (A:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ixha_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xs5a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Treponema pallidum [TaxId: 160]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pc3a_ c.94.1.1 (A:) Phosphate-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1us5a_ c.94.1.1 (A:) Putative GluR0 ligand binding core {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g2ha_ a.4.1.12 (A:) Transcriptional regulator TyrR, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d1la_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ntca_ a.4.1.12 (A:) DNA-binding domain of NTRC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p99a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sw5a_ c.94.1.1 (A:) Osmoprotection protein ProX {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rzsa_ a.35.1.2 (A:) cro p22 {Bacteriophage p22 [TaxId: 10754]} Back     information, alignment and structure
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h3da1 c.94.1.1 (A:5-224) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pdaa1 c.94.1.1 (A:3-219) Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u3em2 d.285.1.1 (M:106-174) Intron-encoded homing endonuclease I-HmuI {Bacteriophage SP01 [TaxId: 10685]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2nxoa1 c.94.1.1 (A:5-281) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1i3ja_ d.285.1.1 (A:) DNA-binding domain of intron endonuclease I-TevI {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1o63a_ c.94.1.1 (A:) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2onsa1 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nh8a1 c.94.1.1 (A:1-210) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ua_ a.4.5.5 (A:) Putative arsenical resistance operon repressor AF0168 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qmwa1 c.94.1.1 (A:1-184) Prephenate dehydratase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r9la_ c.94.1.1 (A:) Glycine betaine-binding periplasmic protein ProX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} Back     information, alignment and structure
>d1j9ia_ a.6.1.5 (A:) Terminase gpNU1 subunit domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2p5ka1 a.4.5.3 (A:2-64) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2b0la1 a.4.5.66 (A:167-257) GTP-sensing transcriptional pleiotropic repressor CodY, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esha1 a.4.5.61 (A:4-117) Hypothetical protein TM0937 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure