Psyllid ID: psy3769
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 974 | 2.2.26 [Sep-21-2011] | |||||||
| Q13UH9 | 389 | Succinyl-CoA ligase [ADP- | yes | N/A | 0.328 | 0.822 | 0.593 | 1e-109 | |
| B2AHC1 | 388 | Succinyl-CoA ligase [ADP- | yes | N/A | 0.328 | 0.824 | 0.593 | 1e-109 | |
| Q0KE75 | 388 | Succinyl-CoA ligase [ADP- | yes | N/A | 0.328 | 0.824 | 0.593 | 1e-109 | |
| B2UGE2 | 388 | Succinyl-CoA ligase [ADP- | no | N/A | 0.328 | 0.824 | 0.593 | 1e-108 | |
| B2SYE8 | 389 | Succinyl-CoA ligase [ADP- | yes | N/A | 0.328 | 0.822 | 0.590 | 1e-108 | |
| Q39D96 | 388 | Succinyl-CoA ligase [ADP- | yes | N/A | 0.328 | 0.824 | 0.590 | 1e-108 | |
| A9AFT3 | 388 | Succinyl-CoA ligase [ADP- | yes | N/A | 0.328 | 0.824 | 0.590 | 1e-108 | |
| Q8Y1Y3 | 388 | Succinyl-CoA ligase [ADP- | yes | N/A | 0.328 | 0.824 | 0.590 | 1e-108 | |
| Q63WW2 | 388 | Succinyl-CoA ligase [ADP- | yes | N/A | 0.328 | 0.824 | 0.593 | 1e-108 | |
| A3N693 | 388 | Succinyl-CoA ligase [ADP- | no | N/A | 0.328 | 0.824 | 0.593 | 1e-108 |
| >sp|Q13UH9|SUCC_BURXL Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia xenovorans (strain LB400) GN=sucC PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 396 bits (1017), Expect = e-109, Method: Compositional matrix adjust.
Identities = 193/325 (59%), Positives = 250/325 (76%), Gaps = 5/325 (1%)
Query: 1 MNIYEYQGKEILRKFNVTIPKGILCMNVDEAIKAAKKIGGNSWVIKAQIHAGGRGKCGGI 60
M I+EYQGKEILRKF V +P+G +VD+A+KAA+++GG WV+KAQIHAGGRGK GG+
Sbjct: 1 MKIHEYQGKEILRKFGVAVPRGKPVFSVDDAVKAAEELGGPVWVVKAQIHAGGRGKGGGV 60
Query: 61 KLAQSLEQVEKYTKKILGMQLITSQTNQEGENVFCVLIEEYIDIKKELYISFMTDRVQQN 120
K+A+SLEQV +Y +ILGMQL+T QT EG+ V +LIEE DIKKELY+ + DRV Q
Sbjct: 61 KVAKSLEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADIKKELYVGLVIDRVSQK 120
Query: 121 IIFMGSNKGGMDIEIISKNSPELLYKTIIDPLIGLTKNNIDNISKKISIPKNSLINFYEE 180
I+ M S++GGMD+E +++ +PEL++K +DP GL D ++ KI +P SL
Sbjct: 121 IVVMASSEGGMDVEEVAEKTPELIHKIAVDPATGLKDAEADELATKIGVPAASLPQARAI 180
Query: 181 IQNIYKSYWETDSLLLEINPLVINSKNKIISLDIKFNFDTNALFRHPEIISYQYAHKKYI 240
+Q +YK++WETD+ L EINPL++ K+I+LD KFNFD+NALFRHPEI++Y + +
Sbjct: 181 LQGLYKAFWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAY-----RDL 235
Query: 241 NKIDLMEIEASKFDLTYIPLNGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDIGGGATI 300
++ D E+EASKFDL YI L+GNIGCLVNGAGLAMATMDTIKLFGGEPANFLD+GGGAT
Sbjct: 236 DEEDPAEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATT 295
Query: 301 KTITEAFKIMMQQNNLKTILVNIFG 325
+ +TEAFKIM++ NL ILVNIFG
Sbjct: 296 EKVTEAFKIMLKNPNLTAILVNIFG 320
|
Burkholderia xenovorans (strain LB400) (taxid: 266265) EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: 5 |
| >sp|B2AHC1|SUCC_CUPTR Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=sucC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q0KE75|SUCC_CUPNH Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sucC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B2UGE2|SUCC_RALPJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ralstonia pickettii (strain 12J) GN=sucC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B2SYE8|SUCC_BURPP Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=sucC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q39D96|SUCC_BURS3 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia sp. (strain 383) GN=sucC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A9AFT3|SUCC_BURM1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=sucC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8Y1Y3|SUCC_RALSO Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ralstonia solanacearum (strain GMI1000) GN=sucC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q63WW2|SUCC_BURPS Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain K96243) GN=sucC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A3N693|SUCC_BURP6 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain 668) GN=sucC PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 974 | ||||||
| 399018698 | 388 | succinyl-CoA synthetase, beta subunit [H | 0.328 | 0.824 | 0.615 | 1e-113 | |
| 427400452 | 389 | succinyl-CoA ligase [ADP-forming] subuni | 0.328 | 0.822 | 0.603 | 1e-112 | |
| 445499464 | 389 | succinyl-CoA ligase subunit beta [Janthi | 0.328 | 0.822 | 0.615 | 1e-111 | |
| 340788983 | 388 | succinyl-CoA ligase [ADP-forming] subuni | 0.328 | 0.824 | 0.609 | 1e-111 | |
| 398836504 | 388 | succinyl-CoA synthetase, beta subunit [H | 0.328 | 0.824 | 0.606 | 1e-111 | |
| 409404535 | 386 | succinyl-CoA synthetase, beta chain prot | 0.328 | 0.829 | 0.609 | 1e-110 | |
| 300309992 | 386 | succinyl-CoA synthetase subunit beta [He | 0.328 | 0.829 | 0.606 | 1e-110 | |
| 329906524 | 388 | Succinyl-CoA ligase (ADP-forming) beta c | 0.328 | 0.824 | 0.596 | 1e-110 | |
| 415905542 | 386 | Succinyl-CoA synthetase protein, beta ch | 0.328 | 0.829 | 0.606 | 1e-110 | |
| 395764123 | 389 | succinyl-CoA synthetase subunit beta [Ja | 0.328 | 0.822 | 0.6 | 1e-109 |
| >gi|399018698|ref|ZP_10720868.1| succinyl-CoA synthetase, beta subunit [Herbaspirillum sp. CF444] gi|398100522|gb|EJL90760.1| succinyl-CoA synthetase, beta subunit [Herbaspirillum sp. CF444] | Back alignment and taxonomy information |
|---|
Score = 414 bits (1065), Expect = e-113, Method: Compositional matrix adjust.
Identities = 200/325 (61%), Positives = 261/325 (80%), Gaps = 5/325 (1%)
Query: 1 MNIYEYQGKEILRKFNVTIPKGILCMNVDEAIKAAKKIGGNSWVIKAQIHAGGRGKCGGI 60
M I+EYQGKEILR+F VT+P+GI C +V++A+KAA+ +GG WV+KAQIHAGGRGK GG+
Sbjct: 1 MKIHEYQGKEILRQFGVTVPRGIPCQSVEDAVKAAETLGGPVWVVKAQIHAGGRGKGGGV 60
Query: 61 KLAQSLEQVEKYTKKILGMQLITSQTNQEGENVFCVLIEEYIDIKKELYISFMTDRVQQN 120
K+A+SLEQV++Y +ILGMQLIT QT EG+ V +LIEE DIKKELY+S +TDRV Q
Sbjct: 61 KVAKSLEQVKEYAGQILGMQLITHQTGPEGQKVRRLLIEEGADIKKELYVSMVTDRVSQR 120
Query: 121 IIFMGSNKGGMDIEIISKNSPELLYKTIIDPLIGLTKNNIDNISKKISIPKNSLINFYEE 180
++ M S++GGMDIE ++++ PEL+++ IDP GLT + D+I+ KI +P S+ + ++
Sbjct: 121 VVLMASSEGGMDIEEVAESHPELIHQIAIDPATGLTDADADSIATKIGVPAASVADARKQ 180
Query: 181 IQNIYKSYWETDSLLLEINPLVINSKNKIISLDIKFNFDTNALFRHPEIISYQYAHKKYI 240
+Q +YK+YWETD+ L EINPL++ K+I+LD KFNFD+NALFRHPEI++Y + +
Sbjct: 181 LQGLYKAYWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAY-----RDL 235
Query: 241 NKIDLMEIEASKFDLTYIPLNGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDIGGGATI 300
++ D EIEASKFDL YI L+GNIGCLVNGAGLAMATMDTIKLFGGEPANFLD+GGGAT
Sbjct: 236 DEEDPAEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATT 295
Query: 301 KTITEAFKIMMQQNNLKTILVNIFG 325
+ +TEAFKIM++ LK ILVNIFG
Sbjct: 296 EKVTEAFKIMLKNPELKAILVNIFG 320
|
Source: Herbaspirillum sp. CF444 Species: Herbaspirillum sp. CF444 Genus: Herbaspirillum Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|427400452|ref|ZP_18891690.1| succinyl-CoA ligase [ADP-forming] subunit beta [Massilia timonae CCUG 45783] gi|425720492|gb|EKU83413.1| succinyl-CoA ligase [ADP-forming] subunit beta [Massilia timonae CCUG 45783] | Back alignment and taxonomy information |
|---|
| >gi|445499464|ref|ZP_21466319.1| succinyl-CoA ligase subunit beta [Janthinobacterium sp. HH01] gi|444789459|gb|ELX11007.1| succinyl-CoA ligase subunit beta [Janthinobacterium sp. HH01] | Back alignment and taxonomy information |
|---|
| >gi|340788983|ref|YP_004754448.1| succinyl-CoA ligase [ADP-forming] subunit beta [Collimonas fungivorans Ter331] gi|340554250|gb|AEK63625.1| Succinyl-CoA ligase [ADP-forming] beta chain [Collimonas fungivorans Ter331] | Back alignment and taxonomy information |
|---|
| >gi|398836504|ref|ZP_10593838.1| succinyl-CoA synthetase, beta subunit [Herbaspirillum sp. YR522] gi|398211617|gb|EJM98234.1| succinyl-CoA synthetase, beta subunit [Herbaspirillum sp. YR522] | Back alignment and taxonomy information |
|---|
| >gi|409404535|ref|ZP_11253014.1| succinyl-CoA synthetase, beta chain protein [Herbaspirillum sp. GW103] gi|386436054|gb|EIJ48877.1| succinyl-CoA synthetase, beta chain protein [Herbaspirillum sp. GW103] | Back alignment and taxonomy information |
|---|
| >gi|300309992|ref|YP_003774084.1| succinyl-CoA synthetase subunit beta [Herbaspirillum seropedicae SmR1] gi|124483474|emb|CAM32610.1| Succinyl-CoA synthetase protein, beta chain protein [Herbaspirillum seropedicae] gi|300072777|gb|ADJ62176.1| succinyl-CoA synthetase, beta chain protein [Herbaspirillum seropedicae SmR1] | Back alignment and taxonomy information |
|---|
| >gi|329906524|ref|ZP_08274406.1| Succinyl-CoA ligase (ADP-forming) beta chain [Oxalobacteraceae bacterium IMCC9480] gi|327547280|gb|EGF32126.1| Succinyl-CoA ligase (ADP-forming) beta chain [Oxalobacteraceae bacterium IMCC9480] | Back alignment and taxonomy information |
|---|
| >gi|415905542|ref|ZP_11552570.1| Succinyl-CoA synthetase protein, beta chain protein [Herbaspirillum frisingense GSF30] gi|407763291|gb|EKF71977.1| Succinyl-CoA synthetase protein, beta chain protein [Herbaspirillum frisingense GSF30] | Back alignment and taxonomy information |
|---|
| >gi|395764123|ref|ZP_10444792.1| succinyl-CoA synthetase subunit beta [Janthinobacterium lividum PAMC 25724] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 974 | ||||||
| TIGR_CMR|BA_3974 | 386 | BA_3974 "succinyl-CoA synthase | 0.328 | 0.829 | 0.476 | 1.1e-80 | |
| TIGR_CMR|CBU_1397 | 390 | CBU_1397 "succinyl-CoA synthet | 0.328 | 0.820 | 0.457 | 1.2e-74 | |
| TIGR_CMR|GSU_1059 | 291 | GSU_1059 "succinyl-CoA synthas | 0.245 | 0.821 | 0.618 | 1.5e-74 | |
| TIGR_CMR|BA_3973 | 300 | BA_3973 "succinyl-CoA synthase | 0.253 | 0.823 | 0.587 | 4e-74 | |
| TIGR_CMR|SPO_1568 | 399 | SPO_1568 "malate--CoA ligase, | 0.329 | 0.804 | 0.437 | 3.6e-73 | |
| TIGR_CMR|GSU_1058 | 385 | GSU_1058 "succinyl-CoA synthas | 0.327 | 0.828 | 0.452 | 2.5e-72 | |
| TIGR_CMR|SO_1932 | 388 | SO_1932 "succinyl-CoA synthase | 0.328 | 0.824 | 0.421 | 1.3e-70 | |
| TIGR_CMR|CPS_2221 | 388 | CPS_2221 "succinyl-CoA synthas | 0.328 | 0.824 | 0.415 | 2.1e-70 | |
| TIGR_CMR|ECH_0979 | 387 | ECH_0979 "succinyl-CoA synthet | 0.328 | 0.826 | 0.458 | 1.1e-69 | |
| UNIPROTKB|P0A836 | 388 | sucC [Escherichia coli K-12 (t | 0.328 | 0.824 | 0.421 | 1.4e-69 |
| TIGR_CMR|BA_3974 BA_3974 "succinyl-CoA synthase, beta subunit" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Score = 810 (290.2 bits), Expect = 1.1e-80, P = 1.1e-80
Identities = 155/325 (47%), Positives = 220/325 (67%)
Query: 1 MNIYEYQGKEILRKFNVTIPKGILCMNVDEAIKAAKKIGGNSWVIKAQIHAGGRGKCGGI 60
MNI+EYQGK +LR + V++P G + V+EA++AAK++G + V+KAQIHAGGRGK GG+
Sbjct: 1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVVKAQIHAGGRGKAGGV 60
Query: 61 KLAQSLEQVEKYTKKILGMQLITSQTNQEGENVFCVLIEEYIDIKKELYISFMTDRVQQN 120
K+A++L++V Y + ILG L+T QT EG+ V +LIEE DIKKE Y+ + DR
Sbjct: 61 KVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ 120
Query: 121 IIFMGSNKGGMDIEIISKNSPELLYKTIIDPLIGLTXXXXXXXXXXXXXXXXXXXXFYEE 180
++ M S +GG +IE +++ +PE ++K IDP +GL +
Sbjct: 121 VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF 180
Query: 181 IQNIYKSYWETDSLLLEINPLVINSKNKIISLDIKFNFDTNALFRHPEIISYQYAHKKYI 240
+ +Y+++ E D + EINPLV K+++LD K NFD+NAL+RH +I+ + +
Sbjct: 181 MMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDILEL-----RDL 235
Query: 241 NKIDLMEIEASKFDLTYIPLNGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDIGGGATI 300
++ D EIEASK+DL YIPL+GNIGC+VNGAGLAMATMD IK + G+PANFLD+GGGAT
Sbjct: 236 DEEDAKEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATA 295
Query: 301 KTITEAFKIMMQQNNLKTILVNIFG 325
+ +TEAFKI++ N+K I VNIFG
Sbjct: 296 EKVTEAFKIILSDKNVKGIFVNIFG 320
|
|
| TIGR_CMR|CBU_1397 CBU_1397 "succinyl-CoA synthetase, beta subunit" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1059 GSU_1059 "succinyl-CoA synthase, alpha subunit" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_3973 BA_3973 "succinyl-CoA synthase, alpha subunit" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1568 SPO_1568 "malate--CoA ligase, beta subunit" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1058 GSU_1058 "succinyl-CoA synthase, beta subunit" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1932 SO_1932 "succinyl-CoA synthase, beta subunit" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_2221 CPS_2221 "succinyl-CoA synthase, beta subunit" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0979 ECH_0979 "succinyl-CoA synthetase, beta subunit" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A836 sucC [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q0BC71 | SUCC_BURCM | 6, ., 2, ., 1, ., 5 | 0.5876 | 0.3285 | 0.8247 | yes | N/A |
| Q0KE75 | SUCC_CUPNH | 6, ., 2, ., 1, ., 5 | 0.5938 | 0.3285 | 0.8247 | yes | N/A |
| Q62MG7 | SUCC_BURMA | 6, ., 2, ., 1, ., 5 | 0.5938 | 0.3285 | 0.8247 | yes | N/A |
| A2S8U3 | SUCC_BURM9 | 6, ., 2, ., 1, ., 5 | 0.5938 | 0.3285 | 0.8247 | yes | N/A |
| B1XRZ4 | SUCC_POLNS | 6, ., 2, ., 1, ., 5 | 0.5938 | 0.3285 | 0.8226 | yes | N/A |
| A4G230 | SUCC_HERAR | 6, ., 2, ., 1, ., 5 | 0.5784 | 0.3285 | 0.8247 | yes | N/A |
| A9AFT3 | SUCC_BURM1 | 6, ., 2, ., 1, ., 5 | 0.5907 | 0.3285 | 0.8247 | yes | N/A |
| Q13UH9 | SUCC_BURXL | 6, ., 2, ., 1, ., 5 | 0.5938 | 0.3285 | 0.8226 | yes | N/A |
| Q8Y1Y3 | SUCC_RALSO | 6, ., 2, ., 1, ., 5 | 0.5907 | 0.3285 | 0.8247 | yes | N/A |
| B1YVY6 | SUCC_BURA4 | 6, ., 2, ., 1, ., 5 | 0.5876 | 0.3285 | 0.8247 | yes | N/A |
| Q63WW2 | SUCC_BURPS | 6, ., 2, ., 1, ., 5 | 0.5938 | 0.3285 | 0.8247 | yes | N/A |
| Q3JVL5 | SUCC_BURP1 | 6, ., 2, ., 1, ., 5 | 0.5938 | 0.3285 | 0.8247 | yes | N/A |
| A1V6W8 | SUCC_BURMS | 6, ., 2, ., 1, ., 5 | 0.5938 | 0.3285 | 0.8247 | yes | N/A |
| A4SZY0 | SUCC_POLSQ | 6, ., 2, ., 1, ., 5 | 0.5907 | 0.3285 | 0.8226 | yes | N/A |
| A6SUY3 | SUCC_JANMA | 6, ., 2, ., 1, ., 5 | 0.5753 | 0.3285 | 0.8247 | yes | N/A |
| Q39D96 | SUCC_BURS3 | 6, ., 2, ., 1, ., 5 | 0.5907 | 0.3285 | 0.8247 | yes | N/A |
| B2AHC1 | SUCC_CUPTR | 6, ., 2, ., 1, ., 5 | 0.5938 | 0.3285 | 0.8247 | yes | N/A |
| B2SYE8 | SUCC_BURPP | 6, ., 2, ., 1, ., 5 | 0.5907 | 0.3285 | 0.8226 | yes | N/A |
| A3MH60 | SUCC_BURM7 | 6, ., 2, ., 1, ., 5 | 0.5938 | 0.3285 | 0.8247 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.2.1 | 0.691 |
| 4th Layer | 6.2.1.5 | 0.737 |
| 3rd Layer | 2.3.3.8 | LOW CONFIDENCE prediction! |
| 3rd Layer | 2.3.3 | 0.691 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 974 | |||
| PRK00696 | 388 | PRK00696, sucC, succinyl-CoA synthetase subunit be | 1e-151 | |
| PRK05678 | 291 | PRK05678, PRK05678, succinyl-CoA synthetase subuni | 1e-146 | |
| TIGR01019 | 286 | TIGR01019, sucCoAalpha, succinyl-CoA synthetase, a | 1e-121 | |
| COG0045 | 387 | COG0045, SucC, Succinyl-CoA synthetase, beta subun | 1e-121 | |
| COG0074 | 293 | COG0074, SucD, Succinyl-CoA synthetase, alpha subu | 1e-120 | |
| PTZ00187 | 317 | PTZ00187, PTZ00187, succinyl-CoA synthetase alpha | 1e-113 | |
| PRK14046 | 392 | PRK14046, PRK14046, malate--CoA ligase subunit bet | 1e-112 | |
| TIGR01016 | 386 | TIGR01016, sucCoAbeta, succinyl-CoA synthetase, be | 1e-109 | |
| PLN00125 | 300 | PLN00125, PLN00125, Succinyl-CoA ligase [GDP-formi | 1e-95 | |
| PLN00124 | 422 | PLN00124, PLN00124, succinyl-CoA ligase [GDP-formi | 2e-84 | |
| pfam08442 | 202 | pfam08442, ATP-grasp_2, ATP-grasp domain | 3e-70 | |
| TIGR03717 | 176 | TIGR03717, R_switched_YjbE, integral membrane prot | 4e-56 | |
| pfam03741 | 184 | pfam03741, TerC, Integral membrane protein TerC fa | 2e-34 | |
| COG0861 | 254 | COG0861, TerC, Membrane protein TerC, possibly inv | 2e-31 | |
| smart00881 | 100 | smart00881, CoA_binding, CoA binding domain | 5e-23 | |
| PRK00122 | 172 | PRK00122, rimM, 16S rRNA-processing protein RimM; | 3e-22 | |
| TIGR02273 | 165 | TIGR02273, 16S_RimM, 16S rRNA processing protein R | 1e-21 | |
| pfam00549 | 128 | pfam00549, Ligase_CoA, CoA-ligase | 4e-20 | |
| PRK00040 | 75 | PRK00040, rpsP, 30S ribosomal protein S16; Reviewe | 2e-19 | |
| COG0806 | 174 | COG0806, RimM, RimM protein, required for 16S rRNA | 3e-18 | |
| pfam02629 | 96 | pfam02629, CoA_binding, CoA binding domain | 2e-16 | |
| pfam00886 | 61 | pfam00886, Ribosomal_S16, Ribosomal protein S16 | 3e-16 | |
| PLN02522 | 608 | PLN02522, PLN02522, ATP citrate (pro-S)-lyase | 4e-16 | |
| COG0228 | 87 | COG0228, RpsP, Ribosomal protein S16 [Translation, | 1e-14 | |
| pfam00549 | 128 | pfam00549, Ligase_CoA, CoA-ligase | 4e-14 | |
| PRK14523 | 137 | PRK14523, rpsP, 30S ribosomal protein S16; Provisi | 7e-13 | |
| pfam01782 | 84 | pfam01782, RimM, RimM N-terminal domain | 2e-11 | |
| TIGR00002 | 78 | TIGR00002, S16, ribosomal protein S16 | 3e-11 | |
| PRK14525 | 88 | PRK14525, rpsP, 30S ribosomal protein S16; Provisi | 6e-11 | |
| TIGR03716 | 215 | TIGR03716, R_switched_YkoY, integral membrane prot | 1e-09 | |
| PRK06091 | 555 | PRK06091, PRK06091, membrane protein FdrA; Validat | 5e-09 | |
| TIGR02717 | 447 | TIGR02717, AcCoA-syn-alpha, acetyl coenzyme A synt | 7e-09 | |
| COG0151 | 428 | COG0151, PurD, Phosphoribosylamine-glycine ligase | 2e-07 | |
| PRK14520 | 155 | PRK14520, rpsP, 30S ribosomal protein S16; Provisi | 5e-06 | |
| PRK14524 | 94 | PRK14524, rpsP, 30S ribosomal protein S16; Provisi | 7e-06 | |
| PLN02235 | 423 | PLN02235, PLN02235, ATP citrate (pro-S)-lyase | 9e-06 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 9e-06 | |
| COG1042 | 598 | COG1042, COG1042, Acyl-CoA synthetase (NDP forming | 9e-06 | |
| PRK14592 | 165 | PRK14592, rimM, 16S rRNA-processing protein RimM; | 1e-05 | |
| CHL00005 | 82 | CHL00005, rps16, ribosomal protein S16 | 1e-05 | |
| pfam13607 | 138 | pfam13607, Succ_CoA_lig, Succinyl-CoA ligase like | 3e-04 | |
| TIGR01369 | 1050 | TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth | 0.001 | |
| pfam02786 | 211 | pfam02786, CPSase_L_D2, Carbamoyl-phosphate syntha | 0.001 | |
| PRK14590 | 171 | PRK14590, rimM, 16S rRNA-processing protein RimM; | 0.002 | |
| pfam13535 | 183 | pfam13535, ATP-grasp_4, ATP-grasp domain | 0.002 | |
| PRK14522 | 116 | PRK14522, rpsP, 30S ribosomal protein S16; Provisi | 0.004 |
| >gnl|CDD|234813 PRK00696, sucC, succinyl-CoA synthetase subunit beta; Provisional | Back alignment and domain information |
|---|
Score = 452 bits (1166), Expect = e-151
Identities = 166/328 (50%), Positives = 235/328 (71%), Gaps = 6/328 (1%)
Query: 1 MNIYEYQGKEILRKFNVTIPKGILCMNVDEAIKAAKKIGGNSWVIKAQIHAGGRGKCGGI 60
MN++EYQ KE+ K+ V +P+GI+ +EA++AA+++GG WV+KAQ+HAGGRGK GG+
Sbjct: 1 MNLHEYQAKELFAKYGVPVPRGIVATTPEEAVEAAEELGGGVWVVKAQVHAGGRGKAGGV 60
Query: 61 KLAQSLEQVEKYTKKILGMQLITSQTNQEGENVFCVLIEEYIDIKKELYISFMTDRVQQN 120
KLA+S E+ ++ K+ILGM L+T QT +G+ V VL+EE DI KE Y+S + DR +
Sbjct: 61 KLAKSPEEAREFAKQILGMTLVTHQTGPKGQPVNKVLVEEGADIAKEYYLSIVLDRATRR 120
Query: 121 IIFMGSNKGGMDIEIISKNSPELLYKTIIDPLIGLTKNNIDNISKKISIPKNSLINFYEE 180
++FM S +GGMDIE +++ +PE ++K IDPL GL I+ K+ +P + F +
Sbjct: 121 VVFMASTEGGMDIEEVAEETPEKIHKVAIDPLTGLQPFQAREIAFKLGLPGEQVKQFAKI 180
Query: 181 IQNIYKSYWETDSLLLEINPLVINSKNKIISLDIKFNFDTNALFRHPEIISYQYAHKKYI 240
+ +YK++ E D+ L+EINPLV+ +I+LD K NFD NALFRHP++ + +
Sbjct: 181 LMGLYKAFVEKDASLVEINPLVVTKDGDLIALDAKINFDDNALFRHPDLAELR-----DL 235
Query: 241 NKIDLMEIEASKFDLTYIPLNGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDIGGGATI 300
++ D +E EASK+ L Y+ L+GNIGC+VNGAGLAMATMD IKL+GGEPANFLD+GGGAT
Sbjct: 236 SEEDPLEAEASKYGLNYVKLDGNIGCMVNGAGLAMATMDIIKLYGGEPANFLDVGGGATA 295
Query: 301 KTITEAFKIMMQQNNLKTILVNIF-GIT 327
+ + EAFKI++ N+K ILVNIF GIT
Sbjct: 296 ERVAEAFKIILSDPNVKAILVNIFGGIT 323
|
Length = 388 |
| >gnl|CDD|180194 PRK05678, PRK05678, succinyl-CoA synthetase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130091 TIGR01019, sucCoAalpha, succinyl-CoA synthetase, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223123 COG0045, SucC, Succinyl-CoA synthetase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223152 COG0074, SucD, Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|240307 PTZ00187, PTZ00187, succinyl-CoA synthetase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237594 PRK14046, PRK14046, malate--CoA ligase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233234 TIGR01016, sucCoAbeta, succinyl-CoA synthetase, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|215066 PLN00125, PLN00125, Succinyl-CoA ligase [GDP-forming] subunit alpha | Back alignment and domain information |
|---|
| >gnl|CDD|177736 PLN00124, PLN00124, succinyl-CoA ligase [GDP-forming] subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219843 pfam08442, ATP-grasp_2, ATP-grasp domain | Back alignment and domain information |
|---|
| >gnl|CDD|163429 TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family | Back alignment and domain information |
|---|
| >gnl|CDD|217707 pfam03741, TerC, Integral membrane protein TerC family | Back alignment and domain information |
|---|
| >gnl|CDD|223930 COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|214881 smart00881, CoA_binding, CoA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|234650 PRK00122, rimM, 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233805 TIGR02273, 16S_RimM, 16S rRNA processing protein RimM | Back alignment and domain information |
|---|
| >gnl|CDD|215988 pfam00549, Ligase_CoA, CoA-ligase | Back alignment and domain information |
|---|
| >gnl|CDD|234588 PRK00040, rpsP, 30S ribosomal protein S16; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223877 COG0806, RimM, RimM protein, required for 16S rRNA processing [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|202320 pfam02629, CoA_binding, CoA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|216173 pfam00886, Ribosomal_S16, Ribosomal protein S16 | Back alignment and domain information |
|---|
| >gnl|CDD|178137 PLN02522, PLN02522, ATP citrate (pro-S)-lyase | Back alignment and domain information |
|---|
| >gnl|CDD|223306 COG0228, RpsP, Ribosomal protein S16 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|215988 pfam00549, Ligase_CoA, CoA-ligase | Back alignment and domain information |
|---|
| >gnl|CDD|172989 PRK14523, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216696 pfam01782, RimM, RimM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|129114 TIGR00002, S16, ribosomal protein S16 | Back alignment and domain information |
|---|
| >gnl|CDD|172991 PRK14525, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234326 TIGR03716, R_switched_YkoY, integral membrane protein, YkoY family | Back alignment and domain information |
|---|
| >gnl|CDD|180395 PRK06091, PRK06091, membrane protein FdrA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|131764 TIGR02717, AcCoA-syn-alpha, acetyl coenzyme A synthetase (ADP forming), alpha domain | Back alignment and domain information |
|---|
| >gnl|CDD|223229 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184724 PRK14520, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172990 PRK14524, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177879 PLN02235, PLN02235, ATP citrate (pro-S)-lyase | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223972 COG1042, COG1042, Acyl-CoA synthetase (NDP forming) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|173056 PRK14592, rimM, 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176950 CHL00005, rps16, ribosomal protein S16 | Back alignment and domain information |
|---|
| >gnl|CDD|205785 pfam13607, Succ_CoA_lig, Succinyl-CoA ligase like flavodoxin domain | Back alignment and domain information |
|---|
| >gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|190425 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|173054 PRK14590, rimM, 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222206 pfam13535, ATP-grasp_4, ATP-grasp domain | Back alignment and domain information |
|---|
| >gnl|CDD|172988 PRK14522, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 974 | |||
| COG0045 | 387 | SucC Succinyl-CoA synthetase, beta subunit [Energy | 100.0 | |
| PLN00124 | 422 | succinyl-CoA ligase [GDP-forming] subunit beta; Pr | 100.0 | |
| PLN02235 | 423 | ATP citrate (pro-S)-lyase | 100.0 | |
| PRK14046 | 392 | malate--CoA ligase subunit beta; Provisional | 100.0 | |
| KOG1447|consensus | 412 | 100.0 | ||
| TIGR01016 | 386 | sucCoAbeta succinyl-CoA synthetase, beta subunit. | 100.0 | |
| KOG2799|consensus | 434 | 100.0 | ||
| PRK00696 | 388 | sucC succinyl-CoA synthetase subunit beta; Provisi | 100.0 | |
| PRK05678 | 291 | succinyl-CoA synthetase subunit alpha; Validated | 100.0 | |
| TIGR01019 | 286 | sucCoAalpha succinyl-CoA synthetase, alpha subunit | 100.0 | |
| PLN00125 | 300 | Succinyl-CoA ligase [GDP-forming] subunit alpha | 100.0 | |
| TIGR02717 | 447 | AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP | 100.0 | |
| PTZ00187 | 317 | succinyl-CoA synthetase alpha subunit; Provisional | 100.0 | |
| PF08442 | 202 | ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 | 100.0 | |
| COG1042 | 598 | Acyl-CoA synthetase (NDP forming) [Energy producti | 100.0 | |
| PLN02522 | 608 | ATP citrate (pro-S)-lyase | 100.0 | |
| COG0074 | 293 | SucD Succinyl-CoA synthetase, alpha subunit [Energ | 100.0 | |
| KOG1255|consensus | 329 | 100.0 | ||
| TIGR03716 | 215 | R_switched_YkoY integral membrane protein, YkoY fa | 100.0 | |
| PF03741 | 183 | TerC: Integral membrane protein TerC family; Inter | 100.0 | |
| TIGR03717 | 176 | R_switched_YjbE integral membrane protein, YjbE fa | 100.0 | |
| COG0861 | 254 | TerC Membrane protein TerC, possibly involved in t | 100.0 | |
| TIGR03718 | 302 | R_switched_Alx integral membrane protein, TerC fam | 100.0 | |
| PRK06091 | 555 | membrane protein FdrA; Validated | 100.0 | |
| PF13549 | 222 | ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A. | 100.0 | |
| PF13607 | 138 | Succ_CoA_lig: Succinyl-CoA ligase like flavodoxin | 99.97 | |
| PRK14591 | 169 | rimM 16S rRNA-processing protein RimM; Provisional | 99.97 | |
| COG0806 | 174 | RimM RimM protein, required for 16S rRNA processin | 99.97 | |
| PRK00122 | 172 | rimM 16S rRNA-processing protein RimM; Provisional | 99.96 | |
| PRK14590 | 171 | rimM 16S rRNA-processing protein RimM; Provisional | 99.96 | |
| PRK14594 | 166 | rimM 16S rRNA-processing protein RimM; Provisional | 99.96 | |
| PRK14592 | 165 | rimM 16S rRNA-processing protein RimM; Provisional | 99.95 | |
| TIGR02273 | 165 | 16S_RimM 16S rRNA processing protein RimM. This fa | 99.95 | |
| PRK14593 | 184 | rimM 16S rRNA-processing protein RimM; Provisional | 99.95 | |
| PRK13829 | 162 | rimM 16S rRNA-processing protein RimM; Provisional | 99.95 | |
| PRK13828 | 161 | rimM 16S rRNA-processing protein RimM; Provisional | 99.93 | |
| PRK00040 | 75 | rpsP 30S ribosomal protein S16; Reviewed | 99.9 | |
| TIGR00002 | 78 | S16 ribosomal protein S16. This model describes ri | 99.9 | |
| CHL00005 | 82 | rps16 ribosomal protein S16 | 99.89 | |
| COG0228 | 87 | RpsP Ribosomal protein S16 [Translation, ribosomal | 99.89 | |
| PRK14524 | 94 | rpsP 30S ribosomal protein S16; Provisional | 99.89 | |
| PRK14525 | 88 | rpsP 30S ribosomal protein S16; Provisional | 99.89 | |
| PRK14523 | 137 | rpsP 30S ribosomal protein S16; Provisional | 99.89 | |
| KOG3419|consensus | 112 | 99.88 | ||
| PRK14013 | 338 | hypothetical protein; Provisional | 99.88 | |
| PRK14520 | 155 | rpsP 30S ribosomal protein S16; Provisional | 99.87 | |
| PRK14521 | 186 | rpsP 30S ribosomal protein S16; Provisional | 99.87 | |
| PRK14522 | 116 | rpsP 30S ribosomal protein S16; Provisional | 99.86 | |
| PF00886 | 62 | Ribosomal_S16: Ribosomal protein S16; InterPro: IP | 99.84 | |
| PF13380 | 116 | CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 | 99.83 | |
| COG1832 | 140 | Predicted CoA-binding protein [General function pr | 99.72 | |
| PF01782 | 84 | RimM: RimM N-terminal domain; InterPro: IPR002676 | 99.72 | |
| ), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071 | 194 | GARS_A: Phosphoribosylglycinamide synthetase, ATP- | 99.38 | |
| COG2899 | 346 | Uncharacterized protein conserved in bacteria [Fun | 99.29 | |
| PF04332 | 294 | DUF475: Protein of unknown function (DUF475); Inte | 99.27 | |
| COG0151 | 428 | PurD Phosphoribosylamine-glycine ligase [Nucleotid | 99.15 | |
| PLN02257 | 434 | phosphoribosylamine--glycine ligase | 99.05 | |
| PRK13789 | 426 | phosphoribosylamine--glycine ligase; Provisional | 99.04 | |
| PF07478 | 203 | Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In | 99.03 | |
| KOG1254|consensus | 600 | 99.0 | ||
| TIGR01161 | 352 | purK phosphoribosylaminoimidazole carboxylase, Pur | 98.99 | |
| PRK01372 | 304 | ddl D-alanine--D-alanine ligase; Reviewed | 98.98 | |
| PF02786 | 211 | CPSase_L_D2: Carbamoyl-phosphate synthase L chain, | 98.98 | |
| PF02222 | 172 | ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T | 98.95 | |
| PRK06019 | 372 | phosphoribosylaminoimidazole carboxylase ATPase su | 98.94 | |
| TIGR00514 | 449 | accC acetyl-CoA carboxylase, biotin carboxylase su | 98.93 | |
| PRK13790 | 379 | phosphoribosylamine--glycine ligase; Provisional | 98.91 | |
| PRK12815 | 1068 | carB carbamoyl phosphate synthase large subunit; R | 98.9 | |
| PLN02948 | 577 | phosphoribosylaminoimidazole carboxylase | 98.89 | |
| PRK00885 | 420 | phosphoribosylamine--glycine ligase; Provisional | 98.88 | |
| TIGR00877 | 423 | purD phosphoribosylamine--glycine ligase. This enz | 98.88 | |
| PRK01966 | 333 | ddl D-alanyl-alanine synthetase A; Reviewed | 98.87 | |
| PRK09288 | 395 | purT phosphoribosylglycinamide formyltransferase 2 | 98.86 | |
| PRK05586 | 447 | biotin carboxylase; Validated | 98.85 | |
| COG1042 | 598 | Acyl-CoA synthetase (NDP forming) [Energy producti | 98.85 | |
| PF00549 | 153 | Ligase_CoA: CoA-ligase; InterPro: IPR005811 This e | 98.85 | |
| PRK14572 | 347 | D-alanyl-alanine synthetase A; Provisional | 98.84 | |
| PRK14568 | 343 | vanB D-alanine--D-lactate ligase; Provisional | 98.81 | |
| PF13535 | 184 | ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A | 98.81 | |
| PRK08591 | 451 | acetyl-CoA carboxylase biotin carboxylase subunit; | 98.81 | |
| PRK07178 | 472 | pyruvate carboxylase subunit A; Validated | 98.8 | |
| PRK12833 | 467 | acetyl-CoA carboxylase biotin carboxylase subunit; | 98.8 | |
| PRK14570 | 364 | D-alanyl-alanine synthetase A; Provisional | 98.79 | |
| PRK14569 | 296 | D-alanyl-alanine synthetase A; Provisional | 98.78 | |
| TIGR01142 | 380 | purT phosphoribosylglycinamide formyltransferase 2 | 98.77 | |
| TIGR01205 | 315 | D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a | 98.76 | |
| PRK08654 | 499 | pyruvate carboxylase subunit A; Validated | 98.75 | |
| PLN02735 | 1102 | carbamoyl-phosphate synthase | 98.74 | |
| PRK14573 | 809 | bifunctional D-alanyl-alanine synthetase A/UDP-N-a | 98.74 | |
| PRK06111 | 450 | acetyl-CoA carboxylase biotin carboxylase subunit; | 98.74 | |
| PLN02735 | 1102 | carbamoyl-phosphate synthase | 98.72 | |
| PRK08462 | 445 | biotin carboxylase; Validated | 98.72 | |
| PRK08463 | 478 | acetyl-CoA carboxylase subunit A; Validated | 98.68 | |
| PRK05294 | 1066 | carB carbamoyl phosphate synthase large subunit; R | 98.67 | |
| TIGR01369 | 1050 | CPSaseII_lrg carbamoyl-phosphate synthase, large s | 98.67 | |
| PF02629 | 96 | CoA_binding: CoA binding domain; InterPro: IPR0037 | 98.66 | |
| PRK06395 | 435 | phosphoribosylamine--glycine ligase; Provisional | 98.65 | |
| COG0026 | 375 | PurK Phosphoribosylaminoimidazole carboxylase (NCA | 98.64 | |
| COG0458 | 400 | CarB Carbamoylphosphate synthase large subunit (sp | 98.64 | |
| PRK05784 | 486 | phosphoribosylamine--glycine ligase; Provisional | 98.63 | |
| COG0439 | 449 | AccC Biotin carboxylase [Lipid metabolism] | 98.63 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 98.61 | |
| PRK07206 | 416 | hypothetical protein; Provisional | 98.55 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 98.53 | |
| PRK14571 | 299 | D-alanyl-alanine synthetase A; Provisional | 98.51 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 98.51 | |
| TIGR01369 | 1050 | CPSaseII_lrg carbamoyl-phosphate synthase, large s | 98.5 | |
| PRK06524 | 493 | biotin carboxylase-like protein; Validated | 98.46 | |
| PRK02186 | 887 | argininosuccinate lyase; Provisional | 98.45 | |
| PRK05294 | 1066 | carB carbamoyl phosphate synthase large subunit; R | 98.44 | |
| PRK10446 | 300 | ribosomal protein S6 modification protein; Provisi | 98.43 | |
| COG0027 | 394 | PurT Formate-dependent phosphoribosylglycinamide f | 98.42 | |
| KOG0237|consensus | 788 | 98.37 | ||
| PRK14016 | 727 | cyanophycin synthetase; Provisional | 98.35 | |
| KOG1254|consensus | 600 | 98.34 | ||
| PRK12815 | 1068 | carB carbamoyl phosphate synthase large subunit; R | 98.34 | |
| PF08443 | 190 | RimK: RimK-like ATP-grasp domain; InterPro: IPR013 | 98.34 | |
| TIGR02068 | 864 | cya_phycin_syn cyanophycin synthetase. Cyanophycin | 98.33 | |
| TIGR02144 | 280 | LysX_arch Lysine biosynthesis enzyme LysX. The fam | 98.32 | |
| TIGR00768 | 277 | rimK_fam alpha-L-glutamate ligases, RimK family. T | 98.28 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 98.28 | |
| KOG0238|consensus | 670 | 98.25 | ||
| PRK12767 | 326 | carbamoyl phosphate synthase-like protein; Provisi | 98.23 | |
| PRK13278 | 358 | purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D | 98.22 | |
| TIGR01435 | 737 | glu_cys_lig_rel glutamate--cysteine ligase/gamma-g | 98.21 | |
| PRK02471 | 752 | bifunctional glutamate--cysteine ligase/glutathion | 98.1 | |
| PF00549 | 153 | Ligase_CoA: CoA-ligase; InterPro: IPR005811 This e | 98.05 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 97.91 | |
| COG0189 | 318 | RimK Glutathione synthase/Ribosomal protein S6 mod | 97.88 | |
| COG1181 | 317 | DdlA D-alanine-D-alanine ligase and related ATP-gr | 97.78 | |
| PRK06849 | 389 | hypothetical protein; Provisional | 97.75 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 97.67 | |
| PRK13277 | 366 | 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo | 97.59 | |
| PF15632 | 329 | ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa | 97.55 | |
| KOG0369|consensus | 1176 | 97.52 | ||
| TIGR00036 | 266 | dapB dihydrodipicolinate reductase. | 97.51 | |
| TIGR03717 | 176 | R_switched_YjbE integral membrane protein, YjbE fa | 97.45 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 97.41 | |
| PF03741 | 183 | TerC: Integral membrane protein TerC family; Inter | 97.25 | |
| TIGR02717 | 447 | AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP | 97.02 | |
| PF01914 | 203 | MarC: MarC family integral membrane protein; Inter | 97.0 | |
| PF02655 | 161 | ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 | 96.93 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 96.88 | |
| PF05239 | 79 | PRC: PRC-barrel domain; InterPro: IPR007903 The PR | 96.75 | |
| TIGR02291 | 317 | rimK_rel_E_lig alpha-L-glutamate ligase-related pr | 96.7 | |
| PRK10739 | 197 | putative antibiotic transporter; Provisional | 96.65 | |
| PLN02941 | 328 | inositol-tetrakisphosphate 1-kinase | 96.63 | |
| TIGR00427 | 201 | membrane protein, MarC family. MarC is a protein t | 96.58 | |
| KOG0370|consensus | 1435 | 96.52 | ||
| COG2095 | 203 | MarC Multiple antibiotic transporter [Intracellula | 96.52 | |
| PRK11111 | 214 | hypothetical protein; Provisional | 96.32 | |
| PLN02775 | 286 | Probable dihydrodipicolinate reductase | 96.31 | |
| TIGR03716 | 215 | R_switched_YkoY integral membrane protein, YkoY fa | 96.15 | |
| TIGR03718 | 302 | R_switched_Alx integral membrane protein, TerC fam | 96.14 | |
| PRK10995 | 221 | inner membrane protein; Provisional | 96.12 | |
| COG0289 | 266 | DapB Dihydrodipicolinate reductase [Amino acid tra | 96.09 | |
| COG0861 | 254 | TerC Membrane protein TerC, possibly involved in t | 96.02 | |
| COG1971 | 190 | Predicted membrane protein [Function unknown] | 95.99 | |
| KOG0368|consensus | 2196 | 95.97 | ||
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 95.86 | |
| PRK12458 | 338 | glutathione synthetase; Provisional | 95.8 | |
| TIGR02130 | 275 | dapB_plant dihydrodipicolinate reductase. This nar | 95.78 | |
| PRK11469 | 188 | hypothetical protein; Provisional | 95.68 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 95.66 | |
| PF01810 | 191 | LysE: LysE type translocator; InterPro: IPR001123 | 95.61 | |
| COG3919 | 415 | Predicted ATP-grasp enzyme [General function predi | 95.56 | |
| COG2344 | 211 | AT-rich DNA-binding protein [General function pred | 95.47 | |
| COG1759 | 361 | 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofu | 95.15 | |
| TIGR01380 | 312 | glut_syn glutathione synthetase, prokaryotic. This | 95.07 | |
| PRK13303 | 265 | L-aspartate dehydrogenase; Provisional | 95.05 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 94.87 | |
| PF03596 | 191 | Cad: Cadmium resistance transporter; InterPro: IPR | 94.82 | |
| PF14397 | 285 | ATPgrasp_ST: Sugar-transfer associated ATP-grasp | 94.34 | |
| TIGR03855 | 229 | NAD_NadX aspartate dehydrogenase. Members of this | 93.98 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 93.45 | |
| COG2119 | 190 | Predicted membrane protein [Function unknown] | 93.4 | |
| PRK10958 | 212 | leucine export protein LeuE; Provisional | 93.19 | |
| PRK10323 | 195 | cysteine/O-acetylserine exporter; Provisional | 92.94 | |
| KOG0370|consensus | 1435 | 92.93 | ||
| COG1280 | 208 | RhtB Putative threonine efflux protein [Amino acid | 92.64 | |
| TIGR01761 | 343 | thiaz-red thiazolinyl imide reductase. This reduct | 92.64 | |
| PRK05472 | 213 | redox-sensing transcriptional repressor Rex; Provi | 92.57 | |
| COG0673 | 342 | MviM Predicted dehydrogenases and related proteins | 91.75 | |
| PRK09304 | 207 | arginine exporter protein; Provisional | 91.71 | |
| PRK10206 | 344 | putative oxidoreductase; Provisional | 90.46 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 90.25 | |
| PRK11579 | 346 | putative oxidoreductase; Provisional | 90.24 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 90.19 | |
| TIGR00949 | 185 | 2A76 The Resistance to Homoserine/Threonine (RhtB) | 90.07 | |
| PRK00696 | 388 | sucC succinyl-CoA synthetase subunit beta; Provisi | 90.04 | |
| TIGR01016 | 386 | sucCoAbeta succinyl-CoA synthetase, beta subunit. | 89.88 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 89.84 | |
| PRK05246 | 316 | glutathione synthetase; Provisional | 89.72 | |
| PRK10520 | 205 | rhtB homoserine/homoserine lactone efflux protein; | 89.51 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 89.38 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 88.9 | |
| TIGR01692 | 288 | HIBADH 3-hydroxyisobutyrate dehydrogenase. This en | 88.89 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 88.58 | |
| TIGR02840 | 206 | spore_YtaF putative sporulation protein YtaF. This | 88.54 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 87.89 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 86.99 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 86.96 | |
| PF02955 | 173 | GSH-S_ATP: Prokaryotic glutathione synthetase, ATP | 86.63 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 86.54 | |
| PRK14046 | 392 | malate--CoA ligase subunit beta; Provisional | 85.92 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 85.82 | |
| PRK10229 | 206 | threonine efflux system; Provisional | 85.48 | |
| COG2451 | 100 | Ribosomal protein L35AE/L33A [Translation, ribosom | 84.02 | |
| PF07991 | 165 | IlvN: Acetohydroxy acid isomeroreductase, catalyti | 83.93 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 83.66 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 83.38 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 83.03 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 82.74 | |
| TIGR01745 | 366 | asd_gamma aspartate-semialdehyde dehydrogenase, ga | 82.59 | |
| PRK14013 | 338 | hypothetical protein; Provisional | 82.47 | |
| COG0059 | 338 | IlvC Ketol-acid reductoisomerase [Amino acid trans | 82.34 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 82.12 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 81.71 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 81.37 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 81.35 | |
| COG1279 | 202 | Lysine efflux permease [General function predictio | 81.1 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 80.53 | |
| PLN02256 | 304 | arogenate dehydrogenase | 80.17 |
| >COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.8e-87 Score=726.52 Aligned_cols=337 Identities=45% Similarity=0.756 Sum_probs=322.6
Q ss_pred CCCCHHHHHHHHHHcCCCCCCceeeCCHHHHHHHHHHcCCCcEEEEeeeecCcccccCeEEEeCCHHHHHHHHHHHHhcc
Q psy3769 1 MNIYEYQGKEILRKFNVTIPKGILCMNVDEAIKAAKKIGGNSWVIKAQIHAGGRGKCGGIKLAQSLEQVEKYTKKILGMQ 80 (974)
Q Consensus 1 m~L~E~~ak~lL~~~GIpvp~~~~~~s~eea~~~a~~ig~~PvVvK~qi~~ggrgk~GGV~l~~s~ee~~~a~~~~l~~~ 80 (974)
|+|||||+|++|++||||||++.++++++|+.++++++|..|+|||+|++.|||||+|||++++|++|+++++++|+++.
T Consensus 1 M~lhEYqaKelf~~~GiPvp~g~v~~s~eea~~~a~~lg~~~~VvKaQV~aGGRGKaGGVk~~~s~~ea~~~a~~~lg~~ 80 (387)
T COG0045 1 MNLHEYQAKELFAKYGIPVPPGYVATSPEEAEEAAKELGGGPVVVKAQVHAGGRGKAGGVKLAKSPEEAKEAAEEILGKN 80 (387)
T ss_pred CcHHHHHHHHHHHHcCCCCCCceeeeCHHHHHHHHHHhCCCcEEEEeeeeecCccccCceEEeCCHHHHHHHHHHHhCcc
Confidence 99999999999999999999999999999999999999878999999999999999999999999999999999999987
Q ss_pred ccccccCCCCCceeEEEEEEEecc-ceeEEEEEEEeccCCceeeeccCCCCcceeeccccCCcceEEEEeCCCCCCCHHH
Q psy3769 81 LITSQTNQEGENVFCVLIEEYIDI-KKELYISFMTDRVQQNIIFMGSNKGGMDIEIISKNSPELLYKTIIDPLIGLTKNN 159 (974)
Q Consensus 81 ~~t~q~~~~g~~~~~vLVee~v~~-~~E~ylgi~~Dr~~~~pvii~s~~GGv~iE~~~d~~p~~i~~~~i~p~~gl~~~~ 159 (974)
+|+++.|++++++||||++++ .+|||+++..||+.++|++|+|.+||||||++++++|++|++++++|..|+++++
T Consensus 81 ---~q~~~~G~~v~~vlvee~~~~~~~E~Ylsiv~DR~~~~p~~~~S~eGGmDIEeVa~~~PekI~k~~idp~~g~~~~~ 157 (387)
T COG0045 81 ---YQTDIKGEPVNKVLVEEAVDIIKKEYYLSIVLDRSSRRPVLMASTEGGMDIEEVAEKTPEKIVKVSVDPLTGLRPYQ 157 (387)
T ss_pred ---cccCcCCceeeEEEEEecCCCccceEEEEEEEEcCCCcEEEEEecCCCccHHHhhhhChhheeEEEeCCccCCCHHH
Confidence 799999999999999999994 5599999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHCCCChhhHHHHHHHHHHHHhhcccCCeeEEeeceeEEccC-CcEEEEEEEEeeeCccccCCccccccccchhh
Q psy3769 160 IDNISKKISIPKNSLINFYEEIQNIYKSYWETDSLLLEINPLVINSK-NKIISLDIKFNFDTNALFRHPEIISYQYAHKK 238 (974)
Q Consensus 160 a~~~~~~lg~~~~~~~~l~~~l~~L~~l~~~~d~~~lEINPL~v~~~-g~~~alDaki~ldd~a~~r~~~~~~~~~~~~~ 238 (974)
+|+++..+|+++...+++.+++.+||++|.++|++++|||||++|++ |+++|||||+.+||||.||||++..+++.+++
T Consensus 158 aR~la~~lgl~~~~~~~~~~ii~~Ly~~f~~~Da~lvEINPLvvt~~~g~v~aLDaKi~~DdnAlfRHp~~~~~~d~~~e 237 (387)
T COG0045 158 ARELAFKLGLEGELVKQVADIIKKLYKLFVEKDATLVEINPLVVTPDGGDVLALDAKITLDDNALFRHPDLAELRDESEE 237 (387)
T ss_pred HHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHcCCcEEEeeccEEeCCCCcEEEEeeeeeccCcccccCcchhhhhccccc
Confidence 99999999999999999999999999999999999999999999995 48999999999999999999999999999998
Q ss_pred hcccCChhhhhhccCCCeEeecCCeEEEEecCcchhhHHHHHHHhcCCCCceeeecCCCCCHHHHHHHHHHHhhcCCeEE
Q psy3769 239 YINKIDLMEIEASKFDLTYIPLNGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDIGGGATIKTITEAFKIMMQQNNLKT 318 (974)
Q Consensus 239 ~~~~~~~~e~~a~~~~l~yv~l~G~Ig~~~nGaGlam~t~D~i~~~gg~panfld~GG~a~~~~v~~a~~~il~~~~~~~ 318 (974)
|++|.+|++++++||+||||||||+|||||+|+|||+|+.+||+||||||+||+||.++|+++|+++++||++|+
T Consensus 238 -----d~~e~~a~~~~l~yV~LdG~IG~ivNGAGLaMaTmDii~~~Gg~PANFLDvGGgA~~e~v~~a~~~il~d~~vk~ 312 (387)
T COG0045 238 -----DPREAEASGYGLNYVELDGNIGCIVNGAGLAMATMDIVKLYGGKPANFLDVGGGATAERVKEAFKLILSDPNVKA 312 (387)
T ss_pred -----ChhHHHhhhCCCceEEecCcEEEEecChhHHHHHHHHHHHcCCCCcceeecCCCCCHHHHHHHHHHHhcCCCccE
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEcccc-ccCc--ccccchhhhhccCCCC
Q psy3769 319 ILVNIFG-ITGK--TGRFHTNLCLNYGNGK 345 (974)
Q Consensus 319 i~vni~G-~~~k--~G~~v~~~l~~~g~~g 345 (974)
||||||| +++| ...-+.+.+.+.+-+-
T Consensus 313 IfVNIfGGI~rcD~vA~GIi~Al~e~~~~v 342 (387)
T COG0045 313 IFVNIFGGITRCDEVAEGIIAALKEVGVNV 342 (387)
T ss_pred EEEEEccCcCccHHHHHHHHHHHHhcCCCC
Confidence 9999999 6665 4455666666766443
|
|
| >PLN00124 succinyl-CoA ligase [GDP-forming] subunit beta; Provisional | Back alignment and domain information |
|---|
| >PLN02235 ATP citrate (pro-S)-lyase | Back alignment and domain information |
|---|
| >PRK14046 malate--CoA ligase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG1447|consensus | Back alignment and domain information |
|---|
| >TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit | Back alignment and domain information |
|---|
| >KOG2799|consensus | Back alignment and domain information |
|---|
| >PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK05678 succinyl-CoA synthetase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit | Back alignment and domain information |
|---|
| >PLN00125 Succinyl-CoA ligase [GDP-forming] subunit alpha | Back alignment and domain information |
|---|
| >TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain | Back alignment and domain information |
|---|
| >PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PF08442 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 The ATP-grasp superfamily currently includes 17 groups of enzymes, catalyzing ATP-dependent ligation of a carboxylate containing molecule to an amino or thiol group-containing molecule [] | Back alignment and domain information |
|---|
| >COG1042 Acyl-CoA synthetase (NDP forming) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02522 ATP citrate (pro-S)-lyase | Back alignment and domain information |
|---|
| >COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1255|consensus | Back alignment and domain information |
|---|
| >TIGR03716 R_switched_YkoY integral membrane protein, YkoY family | Back alignment and domain information |
|---|
| >PF03741 TerC: Integral membrane protein TerC family; InterPro: IPR005496 A family containining a number of integral membrane proteins is named after TerC protein | Back alignment and domain information |
|---|
| >TIGR03717 R_switched_YjbE integral membrane protein, YjbE family | Back alignment and domain information |
|---|
| >COG0861 TerC Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03718 R_switched_Alx integral membrane protein, TerC family | Back alignment and domain information |
|---|
| >PRK06091 membrane protein FdrA; Validated | Back alignment and domain information |
|---|
| >PF13549 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A | Back alignment and domain information |
|---|
| >PF13607 Succ_CoA_lig: Succinyl-CoA ligase like flavodoxin domain; PDB: 2CSU_A | Back alignment and domain information |
|---|
| >PRK14591 rimM 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >COG0806 RimM RimM protein, required for 16S rRNA processing [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00122 rimM 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >PRK14590 rimM 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >PRK14594 rimM 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >PRK14592 rimM 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >TIGR02273 16S_RimM 16S rRNA processing protein RimM | Back alignment and domain information |
|---|
| >PRK14593 rimM 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >PRK13829 rimM 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >PRK13828 rimM 16S rRNA-processing protein RimM; Provisional | Back alignment and domain information |
|---|
| >PRK00040 rpsP 30S ribosomal protein S16; Reviewed | Back alignment and domain information |
|---|
| >TIGR00002 S16 ribosomal protein S16 | Back alignment and domain information |
|---|
| >CHL00005 rps16 ribosomal protein S16 | Back alignment and domain information |
|---|
| >COG0228 RpsP Ribosomal protein S16 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14524 rpsP 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >PRK14525 rpsP 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >PRK14523 rpsP 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >KOG3419|consensus | Back alignment and domain information |
|---|
| >PRK14013 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14520 rpsP 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >PRK14521 rpsP 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >PRK14522 rpsP 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >PF00886 Ribosomal_S16: Ribosomal protein S16; InterPro: IPR000307 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A | Back alignment and domain information |
|---|
| >COG1832 Predicted CoA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF01782 RimM: RimM N-terminal domain; InterPro: IPR002676 The RimM protein is essential for efficient processing of 16S rRNA [] | Back alignment and domain information |
|---|
| >PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 | Back alignment and domain information |
|---|
| >COG2899 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04332 DUF475: Protein of unknown function (DUF475); InterPro: IPR007427 This entry contains proteins that are predicted to be an integral membrane proteins with multiple transmembrane domains | Back alignment and domain information |
|---|
| >COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02257 phosphoribosylamine--glycine ligase | Back alignment and domain information |
|---|
| >PRK13789 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 | Back alignment and domain information |
|---|
| >KOG1254|consensus | Back alignment and domain information |
|---|
| >TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein | Back alignment and domain information |
|---|
| >PRK01372 ddl D-alanine--D-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) | Back alignment and domain information |
|---|
| >PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis | Back alignment and domain information |
|---|
| >PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit | Back alignment and domain information |
|---|
| >PRK13790 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02948 phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
| >PRK00885 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR00877 purD phosphoribosylamine--glycine ligase | Back alignment and domain information |
|---|
| >PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed | Back alignment and domain information |
|---|
| >PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated | Back alignment and domain information |
|---|
| >PRK05586 biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >COG1042 Acyl-CoA synthetase (NDP forming) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00549 Ligase_CoA: CoA-ligase; InterPro: IPR005811 This entry represents a domain found in both the alpha and beta chains of succinyl-CoA synthase (6 | Back alignment and domain information |
|---|
| >PRK14572 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >PRK14568 vanB D-alanine--D-lactate ligase; Provisional | Back alignment and domain information |
|---|
| >PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A | Back alignment and domain information |
|---|
| >PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
| >PRK07178 pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14570 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >PRK14569 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 | Back alignment and domain information |
|---|
| >TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase | Back alignment and domain information |
|---|
| >PRK08654 pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >PLN02735 carbamoyl-phosphate synthase | Back alignment and domain information |
|---|
| >PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
| >PLN02735 carbamoyl-phosphate synthase | Back alignment and domain information |
|---|
| >PRK08462 biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >PRK08463 acetyl-CoA carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases | Back alignment and domain information |
|---|
| >PRK06395 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05784 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >COG0439 AccC Biotin carboxylase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >PRK07206 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK14571 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >PRK06524 biotin carboxylase-like protein; Validated | Back alignment and domain information |
|---|
| >PRK02186 argininosuccinate lyase; Provisional | Back alignment and domain information |
|---|
| >PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK10446 ribosomal protein S6 modification protein; Provisional | Back alignment and domain information |
|---|
| >COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0237|consensus | Back alignment and domain information |
|---|
| >PRK14016 cyanophycin synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1254|consensus | Back alignment and domain information |
|---|
| >PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] | Back alignment and domain information |
|---|
| >TIGR02068 cya_phycin_syn cyanophycin synthetase | Back alignment and domain information |
|---|
| >TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX | Back alignment and domain information |
|---|
| >TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG0238|consensus | Back alignment and domain information |
|---|
| >PRK12767 carbamoyl phosphate synthase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type | Back alignment and domain information |
|---|
| >PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional | Back alignment and domain information |
|---|
| >PF00549 Ligase_CoA: CoA-ligase; InterPro: IPR005811 This entry represents a domain found in both the alpha and beta chains of succinyl-CoA synthase (6 | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK06849 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional | Back alignment and domain information |
|---|
| >PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon | Back alignment and domain information |
|---|
| >KOG0369|consensus | Back alignment and domain information |
|---|
| >TIGR00036 dapB dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >TIGR03717 R_switched_YjbE integral membrane protein, YjbE family | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PF03741 TerC: Integral membrane protein TerC family; InterPro: IPR005496 A family containining a number of integral membrane proteins is named after TerC protein | Back alignment and domain information |
|---|
| >TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain | Back alignment and domain information |
|---|
| >PF01914 MarC: MarC family integral membrane protein; InterPro: IPR002771 Members of this family are integral membrane proteins that includes the antibiotic resistance protein MarC | Back alignment and domain information |
|---|
| >PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PF05239 PRC: PRC-barrel domain; InterPro: IPR007903 The PRC-barrel is an all beta barrel domain found in photosynthetic reaction centre subunit H of the purple bacteria | Back alignment and domain information |
|---|
| >TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein | Back alignment and domain information |
|---|
| >PRK10739 putative antibiotic transporter; Provisional | Back alignment and domain information |
|---|
| >PLN02941 inositol-tetrakisphosphate 1-kinase | Back alignment and domain information |
|---|
| >TIGR00427 membrane protein, MarC family | Back alignment and domain information |
|---|
| >KOG0370|consensus | Back alignment and domain information |
|---|
| >COG2095 MarC Multiple antibiotic transporter [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11111 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02775 Probable dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >TIGR03716 R_switched_YkoY integral membrane protein, YkoY family | Back alignment and domain information |
|---|
| >TIGR03718 R_switched_Alx integral membrane protein, TerC family | Back alignment and domain information |
|---|
| >PRK10995 inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0861 TerC Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1971 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0368|consensus | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12458 glutathione synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02130 dapB_plant dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >PRK11469 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PF01810 LysE: LysE type translocator; InterPro: IPR001123 Lysine exporter protein is involved in the efflux of excess L-lysine as a control for intracellular levels of L-lysine | Back alignment and domain information |
|---|
| >COG3919 Predicted ATP-grasp enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >COG2344 AT-rich DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01380 glut_syn glutathione synthetase, prokaryotic | Back alignment and domain information |
|---|
| >PRK13303 L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03596 Cad: Cadmium resistance transporter; InterPro: IPR004676 These proteins are members of the Cadmium Resistance (CadD) Family | Back alignment and domain information |
|---|
| >PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp | Back alignment and domain information |
|---|
| >TIGR03855 NAD_NadX aspartate dehydrogenase | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >COG2119 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10958 leucine export protein LeuE; Provisional | Back alignment and domain information |
|---|
| >PRK10323 cysteine/O-acetylserine exporter; Provisional | Back alignment and domain information |
|---|
| >KOG0370|consensus | Back alignment and domain information |
|---|
| >COG1280 RhtB Putative threonine efflux protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01761 thiaz-red thiazolinyl imide reductase | Back alignment and domain information |
|---|
| >PRK05472 redox-sensing transcriptional repressor Rex; Provisional | Back alignment and domain information |
|---|
| >COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09304 arginine exporter protein; Provisional | Back alignment and domain information |
|---|
| >PRK10206 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK11579 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00949 2A76 The Resistance to Homoserine/Threonine (RhtB) Family protein | Back alignment and domain information |
|---|
| >PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05246 glutathione synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK10520 rhtB homoserine/homoserine lactone efflux protein; Provisional | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >TIGR02840 spore_YtaF putative sporulation protein YtaF | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14046 malate--CoA ligase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK10229 threonine efflux system; Provisional | Back alignment and domain information |
|---|
| >COG2451 Ribosomal protein L35AE/L33A [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial | Back alignment and domain information |
|---|
| >PRK14013 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >COG1279 Lysine efflux permease [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 974 | ||||
| 1cqi_B | 385 | Crystal Structure Of The Complex Of Adp And Mg2+ Wi | 5e-77 | ||
| 1scu_B | 388 | The Crystal Structure Of Succinyl-Coa Synthetase Fr | 5e-77 | ||
| 1jll_B | 388 | Crystal Structure Analysis Of The E197betaa Mutant | 3e-76 | ||
| 1cqi_A | 286 | Crystal Structure Of The Complex Of Adp And Mg2+ Wi | 6e-70 | ||
| 1jkj_A | 288 | E. Coli Scs Length = 288 | 7e-70 | ||
| 2nu7_A | 288 | C123as Mutant Of E. Coli Succinyl-Coa Synthetase Le | 1e-68 | ||
| 2nu8_A | 288 | C123at Mutant Of E. Coli Succinyl-Coa Synthetase Le | 2e-68 | ||
| 2nua_A | 288 | C123av Mutant Of E. Coli Succinyl-Coa Synthetase Le | 2e-68 | ||
| 2scu_A | 288 | A Detailed Description Of The Structure Of Succinyl | 6e-66 | ||
| 2nu6_A | 288 | C123aa Mutant Of E. Coli Succinyl-Coa Synthetase Le | 1e-64 | ||
| 2nu9_A | 288 | C123at Mutant Of E. Coli Succinyl-Coa Synthetase Or | 1e-64 | ||
| 2yv2_A | 297 | Crystal Structure Of Succinyl-Coa Synthetase Alpha | 3e-63 | ||
| 3ufx_B | 397 | Thermus Aquaticus Succinyl-coa Synthetase In Comple | 2e-60 | ||
| 1euc_A | 311 | Crystal Structure Of Dephosphorylated Pig Heart, Gt | 5e-60 | ||
| 2fpg_A | 305 | Crystal Structure Of Pig Gtp-Specific Succinyl-Coa | 6e-60 | ||
| 1eud_A | 311 | Crystal Structure Of Phosphorylated Pig Heart, Gtp- | 3e-58 | ||
| 2fp4_A | 305 | Crystal Structure Of Pig Gtp-Specific Succinyl-Coa | 3e-58 | ||
| 2fp4_B | 395 | Crystal Structure Of Pig Gtp-Specific Succinyl-Coa | 4e-58 | ||
| 1eud_B | 396 | Crystal Structure Of Phosphorylated Pig Heart, Gtp- | 2e-57 | ||
| 1euc_B | 396 | Crystal Structure Of Dephosphorylated Pig Heart, Gt | 2e-57 | ||
| 2yv1_A | 294 | Crystal Structure Of Succinyl-Coa Synthetase Alpha | 3e-57 | ||
| 3ufx_A | 296 | Thermus Aquaticus Succinyl-coa Synthetase In Comple | 2e-56 | ||
| 1oi7_A | 288 | The Crystal Structure Of Succinyl-Coa Synthetase Al | 2e-56 | ||
| 3fih_P | 80 | Ternary Complex-Bound E.Coli 70s Ribosome. This Ent | 8e-10 | ||
| 2gy9_P | 78 | Structure Of The 30s Subunit Of A Pre-Translocation | 8e-10 | ||
| 1p6g_P | 82 | Real Space Refined Coordinates Of The 30s Subunit F | 8e-10 | ||
| 3h9n_A | 177 | Crystal Structure Of The Ribosome Maturation Factor | 1e-09 | ||
| 3pff_A | 829 | Truncated Human Atp-Citrate Lyase With Adp And Tart | 2e-07 | ||
| 3mwe_B | 335 | Truncated Human Atp-Citrate Lyase With Tartrate Bou | 2e-07 | ||
| 3mwd_B | 334 | Truncated Human Atp-Citrate Lyase With Citrate Boun | 9e-07 | ||
| 3mwe_A | 425 | Truncated Human Atp-Citrate Lyase With Tartrate Bou | 3e-06 | ||
| 1pns_P | 83 | Crystal Structure Of A Streptomycin Dependent Ribos | 4e-06 | ||
| 1jgo_S | 91 | Crystal Structure Of The Ribosome At 5.5 A Resoluti | 4e-06 | ||
| 3fic_P | 84 | T. Thermophilus 70s Ribosome In Complex With Mrna, | 4e-06 | ||
| 1emw_A | 88 | Solution Structure Of The Ribosomal Protein S16 Fro | 4e-06 | ||
| 3mwd_A | 425 | Truncated Human Atp-Citrate Lyase With Citrate Boun | 8e-06 | ||
| 2f1l_A | 187 | Crystal Structure Of A Putative 16s Ribosomal Rna P | 6e-05 |
| >pdb|1CQI|B Chain B, Crystal Structure Of The Complex Of Adp And Mg2+ With Dephosphorylated E. Coli Succinyl-Coa Synthetase Length = 385 | Back alignment and structure |
|
| >pdb|1SCU|B Chain B, The Crystal Structure Of Succinyl-Coa Synthetase From Escherichia Coli At 2.5 Angstroms Resolution Length = 388 | Back alignment and structure |
| >pdb|1JLL|B Chain B, Crystal Structure Analysis Of The E197betaa Mutant Of E. Coli Scs Length = 388 | Back alignment and structure |
| >pdb|1CQI|A Chain A, Crystal Structure Of The Complex Of Adp And Mg2+ With Dephosphorylated E. Coli Succinyl-Coa Synthetase Length = 286 | Back alignment and structure |
| >pdb|1JKJ|A Chain A, E. Coli Scs Length = 288 | Back alignment and structure |
| >pdb|2NU7|A Chain A, C123as Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 | Back alignment and structure |
| >pdb|2NU8|A Chain A, C123at Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 | Back alignment and structure |
| >pdb|2NUA|A Chain A, C123av Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 | Back alignment and structure |
| >pdb|2SCU|A Chain A, A Detailed Description Of The Structure Of Succinyl-Coa Synthetase From Escherichia Coli Length = 288 | Back alignment and structure |
| >pdb|2NU6|A Chain A, C123aa Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 | Back alignment and structure |
| >pdb|2NU9|A Chain A, C123at Mutant Of E. Coli Succinyl-Coa Synthetase Orthorhombic Crystal Form Length = 288 | Back alignment and structure |
| >pdb|2YV2|A Chain A, Crystal Structure Of Succinyl-Coa Synthetase Alpha Chain From Aeropyrum Pernix K1 Length = 297 | Back alignment and structure |
| >pdb|3UFX|B Chain B, Thermus Aquaticus Succinyl-coa Synthetase In Complex With Gdp-mn2+ Length = 397 | Back alignment and structure |
| >pdb|1EUC|A Chain A, Crystal Structure Of Dephosphorylated Pig Heart, Gtp- Specific Succinyl-Coa Synthetase Length = 311 | Back alignment and structure |
| >pdb|2FPG|A Chain A, Crystal Structure Of Pig Gtp-Specific Succinyl-Coa Synthetase In Complex With Gdp Length = 305 | Back alignment and structure |
| >pdb|1EUD|A Chain A, Crystal Structure Of Phosphorylated Pig Heart, Gtp-Specific Succinyl-Coa Synthetase Length = 311 | Back alignment and structure |
| >pdb|2FP4|A Chain A, Crystal Structure Of Pig Gtp-Specific Succinyl-Coa Synthetase In Complex With Gtp Length = 305 | Back alignment and structure |
| >pdb|2FP4|B Chain B, Crystal Structure Of Pig Gtp-Specific Succinyl-Coa Synthetase In Complex With Gtp Length = 395 | Back alignment and structure |
| >pdb|1EUD|B Chain B, Crystal Structure Of Phosphorylated Pig Heart, Gtp-Specific Succinyl-Coa Synthetase Length = 396 | Back alignment and structure |
| >pdb|1EUC|B Chain B, Crystal Structure Of Dephosphorylated Pig Heart, Gtp- Specific Succinyl-Coa Synthetase Length = 396 | Back alignment and structure |
| >pdb|2YV1|A Chain A, Crystal Structure Of Succinyl-Coa Synthetase Alpha Chain From Methanocaldococcus Jannaschii Dsm 2661 Length = 294 | Back alignment and structure |
| >pdb|3UFX|A Chain A, Thermus Aquaticus Succinyl-coa Synthetase In Complex With Gdp-mn2+ Length = 296 | Back alignment and structure |
| >pdb|1OI7|A Chain A, The Crystal Structure Of Succinyl-Coa Synthetase Alpha Subunit From Thermus Thermophilus Length = 288 | Back alignment and structure |
| >pdb|3FIH|P Chain P, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 80 | Back alignment and structure |
| >pdb|2GY9|P Chain P, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 78 | Back alignment and structure |
| >pdb|1P6G|P Chain P, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 82 | Back alignment and structure |
| >pdb|3H9N|A Chain A, Crystal Structure Of The Ribosome Maturation Factor Rimm (Hi0203) From H.Influenzae. Northeast Structural Genomics Consortium Target Ir66 Length = 177 | Back alignment and structure |
| >pdb|3PFF|A Chain A, Truncated Human Atp-Citrate Lyase With Adp And Tartrate Bound Length = 829 | Back alignment and structure |
| >pdb|3MWE|B Chain B, Truncated Human Atp-Citrate Lyase With Tartrate Bound Length = 335 | Back alignment and structure |
| >pdb|3MWD|B Chain B, Truncated Human Atp-Citrate Lyase With Citrate Bound Length = 334 | Back alignment and structure |
| >pdb|3MWE|A Chain A, Truncated Human Atp-Citrate Lyase With Tartrate Bound Length = 425 | Back alignment and structure |
| >pdb|1PNS|P Chain P, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 83 | Back alignment and structure |
| >pdb|3FIC|P Chain P, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 30s Subunit And The Ligands Length = 84 | Back alignment and structure |
| >pdb|1EMW|A Chain A, Solution Structure Of The Ribosomal Protein S16 From Thermus Thermophilus Length = 88 | Back alignment and structure |
| >pdb|3MWD|A Chain A, Truncated Human Atp-Citrate Lyase With Citrate Bound Length = 425 | Back alignment and structure |
| >pdb|2F1L|A Chain A, Crystal Structure Of A Putative 16s Ribosomal Rna Processing Protein Rimm (Pa3744) From Pseudomonas Aeruginosa At 2.46 A Resolution Length = 187 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* Length = 388 | Back alignment and structure |
|---|
Score = 472 bits (1217), Expect = e-159
Identities = 138/325 (42%), Positives = 207/325 (63%), Gaps = 5/325 (1%)
Query: 1 MNIYEYQGKEILRKFNVTIPKGILCMNVDEAIKAAKKIGGNSWVIKAQIHAGGRGKCGGI 60
MN++EYQ K++ ++ + P G C EA +AA KIG WV+K Q+HAGGRGK GG+
Sbjct: 1 MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV 60
Query: 61 KLAQSLEQVEKYTKKILGMQLITSQTNQEGENVFCVLIEEYIDIKKELYISFMTDRVQQN 120
K+ S E + + + LG +L+T QT+ G+ V +L+E DI KELY+ + DR +
Sbjct: 61 KVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR 120
Query: 121 IIFMGSNKGGMDIEIISKNSPELLYKTIIDPLIGLTKNNIDNISKKISIPKNSLINFYEE 180
++FM S +GG++IE +++ +P L++K +DPL G ++ K+ + + F +
Sbjct: 121 VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI 180
Query: 181 IQNIYKSYWETDSLLLEINPLVINSKNKIISLDIKFNFDTNALFRHPEIISYQYAHKKYI 240
+ + E D L+EINPLVI + +I LD K D NALFR P++ +
Sbjct: 181 FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMR-----DQ 235
Query: 241 NKIDLMEIEASKFDLTYIPLNGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDIGGGATI 300
++ D E +A++++L Y+ L+GNIGC+VNGAGLAM TMD +KL GGEPANFLD+GGGAT
Sbjct: 236 SQEDPREAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATK 295
Query: 301 KTITEAFKIMMQQNNLKTILVNIFG 325
+ +TEAFKI++ + +K +LVNIFG
Sbjct: 296 ERVTEAFKIILSDDKVKAVLVNIFG 320
|
| >2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* Length = 395 | Back alignment and structure |
|---|
| >3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} Length = 397 | Back alignment and structure |
|---|
| >2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Length = 288 | Back alignment and structure |
|---|
| >1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Length = 288 | Back alignment and structure |
|---|
| >2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Length = 294 | Back alignment and structure |
|---|
| >2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Length = 305 | Back alignment and structure |
|---|
| >2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Length = 297 | Back alignment and structure |
|---|
| >3mwd_A ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_A* Length = 425 | Back alignment and structure |
|---|
| >3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* Length = 334 | Back alignment and structure |
|---|
| >3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Length = 829 | Back alignment and structure |
|---|
| >3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Length = 829 | Back alignment and structure |
|---|
| >3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, STRU genomics, protein structure initiative; 2.07A {Escherichia coli} Length = 480 | Back alignment and structure |
|---|
| >3h9n_A Ribosome maturation factor RIMM; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Haemophilus influenzae} Length = 177 | Back alignment and structure |
|---|
| >2f1l_A 16S rRNA processing protein; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS unknown function; HET: UNL; 2.46A {Pseudomonas aeruginosa} SCOP: b.41.1.4 b.43.3.4 Length = 187 | Back alignment and structure |
|---|
| >2qgg_A 16S rRNA-processing protein RIMM; X-RAY, NESG, ASR73, structural genomics, PSI-2, protein structure initiative; 2.40A {Acinetobacter calcoaceticus} Length = 182 | Back alignment and structure |
|---|
| >2dyi_A Probable 16S rRNA-processing protein RIMM; ribosomal protein S19, PRC-barrel, STRU genomics, NPPSFA; 2.00A {Thermus thermophilus} PDB: 3a1p_A 2dog_A Length = 162 | Back alignment and structure |
|---|
| >3pys_P 30S ribosomal protein S16; ribosome, IGR, IRES, PSIV, CRPV; 3.40A {Thermus thermophilus} PDB: 1pnx_P 1voq_P 1vos_P 1vov_P 1vox_P 1voz_P 1pns_P 3ms0_P 3mr8_P 3pyq_P 3pyn_P 3pyu_P 3fic_P* 1emw_A 1fjg_P* 1hnw_P* 1hnx_P* 1hnz_P* 1hr0_P 1i94_P* ... Length = 83 | Back alignment and structure |
|---|
| >3bn0_A 30S ribosomal protein S16; ribonucleoprotein, ribosome; 2.00A {Aquifex aeolicus} SCOP: d.27.1.1 Length = 112 | Back alignment and structure |
|---|
| >3bbn_P Ribosomal protein S16; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 88 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Length = 457 | Back alignment and structure |
|---|
| >4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Length = 403 | Back alignment and structure |
|---|
| >3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Length = 474 | Back alignment and structure |
|---|
| >1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} Length = 238 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 974 | |||
| 3pff_A | 829 | ATP-citrate synthase; phosphohistidine, organic ac | 100.0 | |
| 2fp4_B | 395 | Succinyl-COA ligase [GDP-forming] beta-chain, mito | 100.0 | |
| 2nu8_B | 388 | SCS-beta, succinyl-COA synthetase beta chain; citr | 100.0 | |
| 3ufx_B | 397 | Succinyl-COA synthetase beta subunit; ATP-grAsp fo | 100.0 | |
| 3mwd_A | 425 | ATP-citrate synthase; ATP-grAsp, phosphohistidine, | 100.0 | |
| 2yv2_A | 297 | Succinyl-COA synthetase alpha chain; COA-binding d | 100.0 | |
| 2fp4_A | 305 | Succinyl-COA ligase [GDP-forming] alpha-chain, mit | 100.0 | |
| 1oi7_A | 288 | Succinyl-COA synthetase alpha chain; SCS, ligase, | 100.0 | |
| 2yv1_A | 294 | Succinyl-COA ligase [ADP-forming] subunit alpha; C | 100.0 | |
| 2nu8_A | 288 | Succinyl-COA ligase [ADP-forming] subunit alpha; c | 100.0 | |
| 2csu_A | 457 | 457AA long hypothetical protein; structural genomi | 100.0 | |
| 3mwd_B | 334 | ATP-citrate synthase; ATP-grAsp, phosphohistidine, | 100.0 | |
| 3dmy_A | 480 | Protein FDRA; predicted actyl-COA synthetase, nysg | 100.0 | |
| 1wr2_A | 238 | Hypothetical protein PH1789; structural genomics, | 99.97 | |
| 2f1l_A | 187 | 16S rRNA processing protein; structural genomics, | 99.97 | |
| 3h9n_A | 177 | Ribosome maturation factor RIMM; structural genomi | 99.97 | |
| 2qgg_A | 182 | 16S rRNA-processing protein RIMM; X-RAY, NESG, ASR | 99.97 | |
| 2dyi_A | 162 | Probable 16S rRNA-processing protein RIMM; ribosom | 99.95 | |
| 3r8n_P | 82 | 30S ribosomal protein S16; protein biosynthesis, R | 99.91 | |
| 3pys_P | 83 | 30S ribosomal protein S16; ribosome, IGR, IRES, PS | 99.91 | |
| 3bn0_A | 112 | 30S ribosomal protein S16; ribonucleoprotein, ribo | 99.89 | |
| 3bbn_P | 88 | Ribosomal protein S16; small ribosomal subunit, sp | 99.88 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 99.84 | |
| 1iuk_A | 140 | Hypothetical protein TT1466; structural genomics, | 99.81 | |
| 2duw_A | 145 | Putative COA-binding protein; ligand binding prote | 99.8 | |
| 2d59_A | 144 | Hypothetical protein PH1109; COA binding, structur | 99.79 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 99.77 | |
| 3e5n_A | 386 | D-alanine-D-alanine ligase A; bacterial blight; 2. | 99.24 | |
| 4eg0_A | 317 | D-alanine--D-alanine ligase; structural genomics, | 99.18 | |
| 3i12_A | 364 | D-alanine-D-alanine ligase A; D-alanyl-alanine syn | 99.16 | |
| 2csu_A | 457 | 457AA long hypothetical protein; structural genomi | 99.11 | |
| 3tqt_A | 372 | D-alanine--D-alanine ligase; cell envelope; 1.88A | 99.06 | |
| 3lp8_A | 442 | Phosphoribosylamine-glycine ligase; ssgcid, NIH, n | 99.06 | |
| 3k3p_A | 383 | D-alanine--D-alanine ligase; D-alanyl-alanine synt | 99.06 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 99.04 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 99.03 | |
| 1ehi_A | 377 | LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g | 99.02 | |
| 3mjf_A | 431 | Phosphoribosylamine--glycine ligase; structural ge | 99.01 | |
| 3aw8_A | 369 | PURK, phosphoribosylaminoimidazole carboxylase, AT | 99.0 | |
| 3glk_A | 540 | Acetyl-COA carboxylase 2; ATP binding, alternative | 98.99 | |
| 3jrx_A | 587 | Acetyl-COA carboxylase 2; BC domain, soraphen A, a | 98.99 | |
| 1vkz_A | 412 | Phosphoribosylamine--glycine ligase; TM1250, struc | 98.97 | |
| 3se7_A | 346 | VANA; alpha-beta structure, D-alanine-D-lactate li | 98.96 | |
| 2cqy_A | 108 | Propionyl-COA carboxylase alpha chain, mitochondri | 98.96 | |
| 2i87_A | 364 | D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco | 98.94 | |
| 3ouz_A | 446 | Biotin carboxylase; structural genomics, center fo | 98.94 | |
| 4fu0_A | 357 | D-alanine--D-alanine ligase 7; vancomycin resistan | 98.93 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 98.91 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 98.91 | |
| 1ulz_A | 451 | Pyruvate carboxylase N-terminal domain; biotin car | 98.9 | |
| 3lwb_A | 373 | D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan | 98.88 | |
| 2yrx_A | 451 | Phosphoribosylglycinamide synthetase; glycinamide | 98.87 | |
| 3r5x_A | 307 | D-alanine--D-alanine ligase; alpha-beta structure, | 98.85 | |
| 1w96_A | 554 | ACC, acetyl-coenzyme A carboxylase; ligase, obesit | 98.84 | |
| 2vpq_A | 451 | Acetyl-COA carboxylase; bacteria, ATP-grAsp domain | 98.83 | |
| 1a9x_A | 1073 | Carbamoyl phosphate synthetase (large chain); amid | 98.83 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 98.82 | |
| 2z04_A | 365 | Phosphoribosylaminoimidazole carboxylase ATPase su | 98.81 | |
| 2yw2_A | 424 | Phosphoribosylamine--glycine ligase; glycinamide r | 98.81 | |
| 2xcl_A | 422 | Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- | 98.8 | |
| 1iow_A | 306 | DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho | 98.8 | |
| 2dzd_A | 461 | Pyruvate carboxylase; biotin carboxylase, ligase; | 98.8 | |
| 4dim_A | 403 | Phosphoribosylglycinamide synthetase; structural g | 98.79 | |
| 2dwc_A | 433 | PH0318, 433AA long hypothetical phosphoribosylglyc | 98.78 | |
| 3vmm_A | 474 | Alanine-anticapsin ligase BACD; ATP-grAsp domain, | 98.77 | |
| 3eth_A | 355 | Phosphoribosylaminoimidazole carboxylase ATPase su | 98.76 | |
| 1e4e_A | 343 | Vancomycin/teicoplanin A-type resistance protein; | 98.76 | |
| 2qk4_A | 452 | Trifunctional purine biosynthetic protein adenosi; | 98.74 | |
| 3vot_A | 425 | L-amino acid ligase, BL00235; ATP-grAsp motif, ATP | 98.72 | |
| 2w70_A | 449 | Biotin carboxylase; ligase, ATP-binding, fatty aci | 98.72 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 98.72 | |
| 2ip4_A | 417 | PURD, phosphoribosylamine--glycine ligase; GAR syn | 98.71 | |
| 3ax6_A | 380 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 98.66 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 98.64 | |
| 1a9x_A | 1073 | Carbamoyl phosphate synthetase (large chain); amid | 98.63 | |
| 2pvp_A | 367 | D-alanine-D-alanine ligase; 2.40A {Helicobacter py | 98.63 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 98.63 | |
| 2fb9_A | 322 | D-alanine:D-alanine ligase; 1.90A {Thermus caldoph | 98.61 | |
| 3ln6_A | 750 | Glutathione biosynthesis bifunctional protein GSH; | 98.59 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 98.58 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 98.41 | |
| 2r7k_A | 361 | 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib | 98.36 | |
| 3ln7_A | 757 | Glutathione biosynthesis bifunctional protein GSH; | 98.3 | |
| 2pn1_A | 331 | Carbamoylphosphate synthase large subunit; ZP_0053 | 98.24 | |
| 1uc8_A | 280 | LYSX, lysine biosynthesis enzyme; alpha-aminoadipa | 98.2 | |
| 2r85_A | 334 | PURP protein PF1517; ATP-grAsp superfamily, unknow | 98.19 | |
| 1z2n_X | 324 | Inositol 1,3,4-trisphosphate 5/6-kinase; inositol | 97.41 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 97.34 | |
| 3ijp_A | 288 | DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, | 97.33 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 97.29 | |
| 1i7n_A | 309 | Synapsin II; synapse, phosphorylation, neuropeptid | 97.24 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 96.99 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 96.93 | |
| 2p0a_A | 344 | Synapsin-3, synapsin III; neurotransmitter release | 96.93 | |
| 2pbz_A | 320 | Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt | 96.84 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 96.84 | |
| 3df7_A | 305 | Putative ATP-grAsp superfamily protein; putative p | 96.75 | |
| 3keo_A | 212 | Redox-sensing transcriptional repressor REX; DNA b | 96.6 | |
| 1gsa_A | 316 | Glutathione synthetase; ligase; HET: ADP GSH; 2.00 | 96.59 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 96.47 | |
| 2q7d_A | 346 | Inositol-tetrakisphosphate 1-kinase; inositol kina | 96.18 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 96.13 | |
| 3i23_A | 349 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 95.73 | |
| 3o9z_A | 312 | Lipopolysaccaride biosynthesis protein WBPB; oxido | 95.7 | |
| 4ew6_A | 330 | D-galactose-1-dehydrogenase protein; nysgrc, PSI-b | 95.66 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 95.5 | |
| 2dt5_A | 211 | AT-rich DNA-binding protein; REX, NADH, NAD, rossm | 95.47 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 95.29 | |
| 3dmy_A | 480 | Protein FDRA; predicted actyl-COA synthetase, nysg | 95.23 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 95.19 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 95.17 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 95.17 | |
| 3btv_A | 438 | Galactose/lactose metabolism regulatory protein GA | 95.16 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 95.13 | |
| 4gmf_A | 372 | Yersiniabactin biosynthetic protein YBTU; rossmann | 95.04 | |
| 3fhl_A | 362 | Putative oxidoreductase; NAD-binding domain, PSI-2 | 95.02 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 94.97 | |
| 3oa2_A | 318 | WBPB; oxidoreductase, sugar biosynthesis, dehydrog | 94.94 | |
| 3ufx_B | 397 | Succinyl-COA synthetase beta subunit; ATP-grAsp fo | 94.8 | |
| 2vt3_A | 215 | REX, redox-sensing transcriptional repressor REX; | 94.72 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 94.59 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 94.59 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 94.55 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 94.54 | |
| 3moi_A | 387 | Probable dehydrogenase; structural genomics, PSI2, | 94.52 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 94.49 | |
| 3e82_A | 364 | Putative oxidoreductase; NAD, GFO/IDH/MOCA family, | 94.44 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 94.43 | |
| 3gdo_A | 358 | Uncharacterized oxidoreductase YVAA; structural ge | 94.42 | |
| 2glx_A | 332 | 1,5-anhydro-D-fructose reductase; NADP(H) dependen | 94.38 | |
| 1j5p_A | 253 | Aspartate dehydrogenase; TM1643, structural genomi | 94.36 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 94.15 | |
| 3ohs_X | 334 | Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d | 94.14 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 93.94 | |
| 2p2s_A | 336 | Putative oxidoreductase; YP_050235.1, structural g | 93.69 | |
| 1f06_A | 320 | MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH | 93.52 | |
| 2nvw_A | 479 | Galactose/lactose metabolism regulatory protein GA | 93.5 | |
| 1ydw_A | 362 | AX110P-like protein; structural genomics, protein | 93.33 | |
| 1zh8_A | 340 | Oxidoreductase; TM0312, structural genomics, JO ce | 93.31 | |
| 3kux_A | 352 | Putative oxidoreductase; oxidoreductase family, cs | 93.26 | |
| 1lc0_A | 294 | Biliverdin reductase A; oxidoreductase, tetrapyrro | 93.23 | |
| 2ho3_A | 325 | Oxidoreductase, GFO/IDH/MOCA family; streptococcus | 93.01 | |
| 1h6d_A | 433 | Precursor form of glucose-fructose oxidoreductase; | 92.7 | |
| 1vm6_A | 228 | DHPR, dihydrodipicolinate reductase; TM1520, struc | 92.54 | |
| 3f4l_A | 345 | Putative oxidoreductase YHHX; structural genomics, | 92.15 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 92.01 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 91.92 | |
| 3u3x_A | 361 | Oxidoreductase; structural genomics, PSI-biology, | 91.62 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 91.41 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 90.76 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 90.66 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 90.64 | |
| 2fp4_B | 395 | Succinyl-COA ligase [GDP-forming] beta-chain, mito | 90.63 | |
| 2ixa_A | 444 | Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver | 90.44 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 90.31 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 90.3 | |
| 4had_A | 350 | Probable oxidoreductase protein; structural genomi | 90.23 | |
| 3m2t_A | 359 | Probable dehydrogenase; PSI, SGXNY, structural gen | 89.7 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 89.58 | |
| 2nu8_B | 388 | SCS-beta, succinyl-COA synthetase beta chain; citr | 89.43 | |
| 4fb5_A | 393 | Probable oxidoreductase protein; PSI-biology, nysg | 89.41 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 88.95 | |
| 3do5_A | 327 | HOM, homoserine dehydrogenase; NP_069768.1, putati | 88.8 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 88.4 | |
| 4gqa_A | 412 | NAD binding oxidoreductase; structural genomics, P | 88.37 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 87.94 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 87.93 | |
| 3oqb_A | 383 | Oxidoreductase; structural genomics, protein struc | 87.91 | |
| 3v5n_A | 417 | Oxidoreductase; structural genomics, PSI-biology, | 87.82 | |
| 1xea_A | 323 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 87.8 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 87.8 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 87.75 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 87.68 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 87.25 | |
| 3dty_A | 398 | Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram | 87.2 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 87.05 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 86.95 | |
| 3ip3_A | 337 | Oxidoreductase, putative; structural genomics, PSI | 86.53 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 86.35 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 86.3 | |
| 4h3v_A | 390 | Oxidoreductase domain protein; structural genomics | 85.69 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 85.65 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 85.61 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 85.02 | |
| 3nkl_A | 141 | UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo | 84.17 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 83.99 | |
| 3fr7_A | 525 | Putative ketol-acid reductoisomerase (OS05G057370 | 83.84 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 83.77 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 83.06 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 82.82 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 82.79 | |
| 3upl_A | 446 | Oxidoreductase; rossmann fold, NADPH binding; 1.50 | 82.72 | |
| 2ozp_A | 345 | N-acetyl-gamma-glutamyl-phosphate reductase; amino | 82.53 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 82.05 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 82.01 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 81.53 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 81.37 | |
| 3pzr_A | 370 | Aspartate-semialdehyde dehydrogenase; NADP, oxidor | 81.04 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 80.77 |
| >3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.7e-112 Score=1029.25 Aligned_cols=575 Identities=23% Similarity=0.331 Sum_probs=481.1
Q ss_pred CCHHHHHHHHHHcCCC------CCCceeeCCH---HHHHHHHHHcCCCcEEEEeeeecCcccccCeEEEeCCHHHHHHHH
Q psy3769 3 IYEYQGKEILRKFNVT------IPKGILCMNV---DEAIKAAKKIGGNSWVIKAQIHAGGRGKCGGIKLAQSLEQVEKYT 73 (974)
Q Consensus 3 L~E~~ak~lL~~~GIp------vp~~~~~~s~---eea~~~a~~ig~~PvVvK~qi~~ggrgk~GGV~l~~s~ee~~~a~ 73 (974)
++|||+|+||++|++| .+++.+++++ +||.++++++|.+|||||+|+++|||||+|||++++|++|+++++
T Consensus 6 i~Ey~aK~ll~~~~~~~~~~~~~~~~~~v~~~~~~~eA~~aa~~lg~~pvVvKaQv~~GgRGKaGGVkL~~s~eEa~~aa 85 (829)
T 3pff_A 6 ISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWL 85 (829)
T ss_dssp ECHHHHHHHHHHHCCCSSCBCSTTCCEEECTTCCHHHHHHHCTHHHHSCEEEEECSSCSCTTTTTCCEEEECHHHHHHHH
T ss_pred HhHHHHHHHHHHhCccccccccCCceEEeCCCCCHHHHHHHHHHhCCCCEEEEecccccCCCcCCeEEEECCHHHHHHHH
Confidence 6899999999999999 5688787765 888888888876899999999999999999999999999999999
Q ss_pred HHHHhccccccccCCCCCceeEEEEEEEecc--ceeEEEEEEEeccCCceeeeccCCCCcceeeccccCCcceEEEEeCC
Q psy3769 74 KKILGMQLITSQTNQEGENVFCVLIEEYIDI--KKELYISFMTDRVQQNIIFMGSNKGGMDIEIISKNSPELLYKTIIDP 151 (974)
Q Consensus 74 ~~~l~~~~~t~q~~~~g~~~~~vLVee~v~~--~~E~ylgi~~Dr~~~~pvii~s~~GGv~iE~~~d~~p~~i~~~~i~p 151 (974)
++|+++.. +++..+.++++||||+|+++ ++|+|+|+++||. +|++++|.+||++||+++|+. .+++++|
T Consensus 86 ~~iLg~~~---~~~~p~~~V~gvLVE~m~~~~~~~ElYvgI~~Dr~--gpvIm~s~eGGvdIE~vad~~----~~~~I~p 156 (829)
T 3pff_A 86 KPRLGQEA---TVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATRE--GDYVLFHHEGGVDVGDVDAKA----QKLLVGV 156 (829)
T ss_dssp TTTTTCEE---EETTEEEECCCEEEEECCCCCGGGEEEEEEEEETT--EEEEEEESSCSTTCCCHHHHS----EEEEEET
T ss_pred HHHHHHHH---hhcCCCceEEEEEEEecccCCCccEEEEEEEecCC--CCEEEEECCCCcchhhhhhhc----eEEecCC
Confidence 99998875 22334567899999999975 5999999999998 689999999999999999865 5689999
Q ss_pred CCCCCHHHHH-HHHHHCCCChhhHHHHHHHHHHHHhhcccCCeeEEeeceeEEccCCcEEEEEEEEeeeCccccCCcc-c
Q psy3769 152 LIGLTKNNID-NISKKISIPKNSLINFYEEIQNIYKSYWETDSLLLEINPLVINSKNKIISLDIKFNFDTNALFRHPE-I 229 (974)
Q Consensus 152 ~~gl~~~~a~-~~~~~lg~~~~~~~~l~~~l~~L~~l~~~~d~~~lEINPL~v~~~g~~~alDaki~ldd~a~~r~~~-~ 229 (974)
..+++.++++ +++. |+++.+.+++++++.+||++|.+.|++++|||||+++++| ++|+|||+.+||||.|||++ |
T Consensus 157 ~~gl~~~~a~~~ll~--g~~~~d~~ala~~L~~Ly~lf~d~d~t~lEINPLvvt~dg-v~ALDAKi~lDDnA~fR~~~~~ 233 (829)
T 3pff_A 157 DEKLNPEDIKKHLLV--HAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDG-VYVLDLAAKVDATADYICKVKW 233 (829)
T ss_dssp TCCCCHHHHHHTTTT--TSCGGGHHHHHHHHHHHHHHHHHTTEEEEEEEEEEEETTE-EEECCCEEEEEGGGHHHHHHHH
T ss_pred ccccCHHHHHHHHHc--CCCHHHHHHHHHHHHHHHHHHHhCCccEEEeeceEecCCc-eEEEeceeeeccchhhhCchhh
Confidence 9999999884 3332 6788999999999999999999999999999999999988 99999999999999999975 5
Q ss_pred cccccchhhhcccCChhhhhhc--------cCCCeEeecCCeEEEEecCcchhhHHHHHHHhcCC--CCceeeecCCCCC
Q psy3769 230 ISYQYAHKKYINKIDLMEIEAS--------KFDLTYIPLNGNIGCLVNGAGLAMATMDTIKLFGG--EPANFLDIGGGAT 299 (974)
Q Consensus 230 ~~~~~~~~~~~~~~~~~e~~a~--------~~~l~yv~l~G~Ig~~~nGaGlam~t~D~i~~~gg--~panfld~GG~a~ 299 (974)
..++++.+ +-.+.+++|.++. +++||||+||||||||||||||+|+|||+|+++|| +||||||+||+||
T Consensus 234 ~~~~~~~~-~~~~~~~~E~~~~e~~ak~~a~~~l~yv~ldG~Ig~mvNGaGlamaTmD~I~~~Gg~~~pANFlDvGGga~ 312 (829)
T 3pff_A 234 GDIEFPPP-FGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPS 312 (829)
T ss_dssp CSCCCCCC-SSCCCCHHHHHHHHHHHTSSSEEEEEESCTTCSEEECCBSHHHHHHHHHHHHHTTCTTTBCEEEEEESCCC
T ss_pred hhhhcccc-ccccCChhhhhhhhhhhhhccccCccEEecCCeEEeeccCchHHHHHHHHHHHcCCCCCCceeEEecCCCC
Confidence 55455421 1122377776543 47899999999999999999999999999999999 7999999999999
Q ss_pred HHHHHHH----HHHHhhcCCeEEEEEcccc-ccCc---------------------------------------------
Q psy3769 300 IKTITEA----FKIMMQQNNLKTILVNIFG-ITGK--------------------------------------------- 329 (974)
Q Consensus 300 ~~~v~~a----~~~il~~~~~~~i~vni~G-~~~k--------------------------------------------- 329 (974)
.++|+++ |+++++||++|+||||||| ++++
T Consensus 313 ~e~v~~~~~~~l~ii~~d~~vk~ilvNIfGGI~~cd~VA~tf~GIi~A~k~~~~~~~~~~vPiVVRl~GtN~eeg~~il~ 392 (829)
T 3pff_A 313 EQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMG 392 (829)
T ss_dssp HHHHHHHHHHHHHHTTSSCCTTCEEEEECBCBCSSCCHHHHHHHHHHHHHHHHHHHHHTTEEEEEECBSTTHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHhcCCCCCEEEEEecCCccchHHHHHHHhHHHHHHHHhhhhcccCCceEEEECCCCCHHHHHHHHH
Confidence 9999988 8899999999999999996 1100
Q ss_pred -cc-----------------------------------------------------------------------------
Q psy3769 330 -TG----------------------------------------------------------------------------- 331 (974)
Q Consensus 330 -~G----------------------------------------------------------------------------- 331 (974)
.|
T Consensus 393 ~~g~~lgl~i~v~g~e~~mt~iv~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 472 (829)
T 3pff_A 393 EVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKP 472 (829)
T ss_dssp HHHHHHCCCEEEECTTSCTTHHHHHHHTSSCCC-----------------------------------------------
T ss_pred hCccccCCcEEEeCCcccHHHHHHHHhcccCCCCCCCccccccceeccCCCCCCCCCCCccccccccccccCCccccccc
Confidence 00
Q ss_pred ---------------c------------------cchhhhhccCC----CCceEEEEecCCCCC--ccc------ccccc
Q psy3769 332 ---------------R------------------FHTNLCLNYGN----GKKAFVAGVNPKKNG--QKF------EEIPI 366 (974)
Q Consensus 332 ---------------~------------------~v~~~l~~~g~----~g~~~V~pVnP~~~g--~~i------~G~~~ 366 (974)
+ +..++|+++|| .+++.|++|||+.+| +++ .|+||
T Consensus 473 ~~~~~~~~~~~~~~~~~~~l~~~~trviV~G~tg~~~~~ml~~~~~~~~~~~~vVa~V~P~~~g~~~~~~~G~~~~Gvp~ 552 (829)
T 3pff_A 473 AMPQDSVPSPRSLQGKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPV 552 (829)
T ss_dssp --------------CCCSCCCCTTCCEEEESCCHHHHHHHHHHHHHTTCSSCSEEEEECTTSCSEEEEEEETTEEEEEEE
T ss_pred ccccccccccccccccceeeecCCCeEEEECCcHHHHHHHHHhcccccCCCCcEEEEEcCCCCCccceEEecCCcCCccc
Confidence 0 01244455554 233489999999863 344 58999
Q ss_pred ccchhhhcccC-CCcEEEEEecchhHHHHHHHHHH-cCCcEEEEEcCCCChHHHHHHHHHHhcCCCCceEEccCCccccc
Q psy3769 367 FDTVKNAKNET-GATVSVIYVPAIFATSAIWEAIE-SELELVICITEGIPVRDMLILKNKMKKNNSKTLLLGPNCPGLIV 444 (974)
Q Consensus 367 y~sl~dip~~~-~vDlavi~vp~~~v~~~v~e~~~-~gv~~~vi~s~G~~e~~~~~l~~~a~~~~~gi~viGPnc~G~~~ 444 (974)
|+|++|+|+.+ ++|++||++|++.++++++||++ +|+|.+||+|+||+|.++++|+++|| ++|+|++||||+|++|
T Consensus 553 y~sv~ea~~~~p~~DlaVI~vP~~~v~~av~ea~~~~Gvk~~Viis~Gf~e~~~~~l~~~A~--~~g~rliGPNc~Gii~ 630 (829)
T 3pff_A 553 FKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKAD--QKGVTIIGPATVGGIK 630 (829)
T ss_dssp ESSHHHHHHHCTTCCEEEECCCTTTHHHHHHHHTTSTTCCEEEECCSCCCHHHHHHHHHHHH--HHTCEEECSSCCCEEE
T ss_pred CCcHHHHhhccCCCcEEEEeCCHHHHHHHHHHHHhhCCCCEEEEeCCCCCHHHHHHHHHHHH--HcCCEEEcCCCcccCc
Confidence 99999998754 48999999999999999999999 99999999999999999999999999 9999999999999999
Q ss_pred cCccccc--------cCCCCCCCCCCEEEEeCChhhHHHHHHHHHHcCCceEEEeecCCCCCCCCCHHHHHHHhhhCCCc
Q psy3769 445 PEEIKIG--------IMPGNIHKKGRIGVVSRSGTLTYEVVCQLTELGFGQSSAVGIGGDPINGLKYIDILKLFNEDQNT 516 (974)
Q Consensus 445 ~~~~~~~--------~~~~~~~~~G~va~vSQSG~~~~~~~~~~~~~g~g~s~~vs~Gn~a~~dv~~~d~l~~l~~Dp~t 516 (974)
|+....+ ++++..++||+||+|||||++++++++|+.++|+|||++||+||+++.|+++.|+|+||.+||+|
T Consensus 631 p~~~~ig~~~g~lna~~~~~~~~~G~VgiVSqSGal~~~i~~~~~~~g~G~S~~VsiGnd~~~d~~~~D~L~~l~~Dp~T 710 (829)
T 3pff_A 631 PGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGV 710 (829)
T ss_dssp TTTEECTTTTCSHHHHHHTTTTSCCSEEEEESCHHHHHHHHHHHHHHSSCEEEEEECCSSSSCSSCHHHHHHHHHTCTTC
T ss_pred cccccccccccccccccccccCCCCcEEEEechhHHHHHHHHHHHHcCCCeEEEEecCCCCCCCCCHHHHHHHHhhCCCC
Confidence 9874433 55666789999999999999999999999999999999999999977799999999999999999
Q ss_pred cEEEEEEccCCCchHHHHHHHHh-cCCCCEEEEecccCCCC---CCCccCcccccccch----hceeeccccccceeeee
Q psy3769 517 DAVIMIGEIGGLDEIYAANWIKK-NMKKPVIGFIAGITAPP---GKRMGHAGALITEIK----KMTFLTASNGISIIQII 588 (974)
Q Consensus 517 ~~I~ly~E~~g~~~~~~~~f~~~-~~~KPVv~lk~Grs~~~---g~~~sHTgalag~~~----~~~a~~~q~gi~~~~li 588 (974)
++|++|+|..|..+.++.++++. +++||||++|+|||++. ++++|||||++|++. .++++++|+|+.++.
T Consensus 711 ~~Ivly~Ei~g~~f~~aA~~~~~~~~~KPVVa~kaGrsa~~~~~~~~~sHtGAlag~~~~ta~~~~aa~r~aGvi~v~-- 788 (829)
T 3pff_A 711 KMIVVLGEIGGTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALKEAGVFVPR-- 788 (829)
T ss_dssp CEEEEEEESSSSHHHHHHHHHHTTSCCSCEEEEEECSSTTC---------------CGGGSHHHHHHHHHHTTCBCCS--
T ss_pred CEEEEEEecCchHHHHHHHHHHhccCCCCEEEEEecCcCcccccccccccccccccCCcccHHHHHHHHHHcCCeEcC--
Confidence 99999999654444445555543 58899999999999643 566899999999988 899999999988754
Q ss_pred ehhhhc
Q psy3769 589 LIDILL 594 (974)
Q Consensus 589 ~le~~L 594 (974)
.++++.
T Consensus 789 ~~~el~ 794 (829)
T 3pff_A 789 SFDELG 794 (829)
T ss_dssp SGGGHH
T ss_pred CHHHHH
Confidence 344443
|
| >2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* | Back alignment and structure |
|---|
| >2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* | Back alignment and structure |
|---|
| >3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3mwd_A ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_A* | Back alignment and structure |
|---|
| >2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* | Back alignment and structure |
|---|
| >1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 | Back alignment and structure |
|---|
| >2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* | Back alignment and structure |
|---|
| >2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 | Back alignment and structure |
|---|
| >3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* | Back alignment and structure |
|---|
| >3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, STRU genomics, protein structure initiative; 2.07A {Escherichia coli} | Back alignment and structure |
|---|
| >1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2f1l_A 16S rRNA processing protein; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS unknown function; HET: UNL; 2.46A {Pseudomonas aeruginosa} SCOP: b.41.1.4 b.43.3.4 | Back alignment and structure |
|---|
| >3h9n_A Ribosome maturation factor RIMM; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2qgg_A 16S rRNA-processing protein RIMM; X-RAY, NESG, ASR73, structural genomics, PSI-2, protein structure initiative; 2.40A {Acinetobacter calcoaceticus} | Back alignment and structure |
|---|
| >2dyi_A Probable 16S rRNA-processing protein RIMM; ribosomal protein S19, PRC-barrel, STRU genomics, NPPSFA; 2.00A {Thermus thermophilus} PDB: 3a1p_A 2dog_A | Back alignment and structure |
|---|
| >3pys_P 30S ribosomal protein S16; ribosome, IGR, IRES, PSIV, CRPV; 3.40A {Thermus thermophilus} PDB: 1pnx_P 1voq_P 1vos_P 1vov_P 1vox_P 1voz_P 1pns_P 3ms0_P 3mr8_P 3pyq_P 3pyn_P 3pyu_P 3fic_P* 1emw_A 1fjg_P* 1hnw_P* 1hnx_P* 1hnz_P* 1hr0_P 1i94_P* ... | Back alignment and structure |
|---|
| >3bn0_A 30S ribosomal protein S16; ribonucleoprotein, ribosome; 2.00A {Aquifex aeolicus} SCOP: d.27.1.1 | Back alignment and structure |
|---|
| >3bbn_P Ribosomal protein S16; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A | Back alignment and structure |
|---|
| >2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* | Back alignment and structure |
|---|
| >4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A | Back alignment and structure |
|---|
| >3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* | Back alignment and structure |
|---|
| >2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 | Back alignment and structure |
|---|
| >3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 | Back alignment and structure |
|---|
| >3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A | Back alignment and structure |
|---|
| >3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A | Back alignment and structure |
|---|
| >3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* | Back alignment and structure |
|---|
| >1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 | Back alignment and structure |
|---|
| >3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} | Back alignment and structure |
|---|
| >2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* | Back alignment and structure |
|---|
| >3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* | Back alignment and structure |
|---|
| >4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 | Back alignment and structure |
|---|
| >3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A | Back alignment and structure |
|---|
| >3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* | Back alignment and structure |
|---|
| >1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A | Back alignment and structure |
|---|
| >2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A | Back alignment and structure |
|---|
| >2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* | Back alignment and structure |
|---|
| >1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* | Back alignment and structure |
|---|
| >2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* | Back alignment and structure |
|---|
| >3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* | Back alignment and structure |
|---|
| >1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* | Back alignment and structure |
|---|
| >2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} | Back alignment and structure |
|---|
| >2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* | Back alignment and structure |
|---|
| >2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* | Back alignment and structure |
|---|
| >3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* | Back alignment and structure |
|---|
| >3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} | Back alignment and structure |
|---|
| >2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* | Back alignment and structure |
|---|
| >2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* | Back alignment and structure |
|---|
| >1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* | Back alignment and structure |
|---|
| >3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* | Back alignment and structure |
|---|
| >1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A | Back alignment and structure |
|---|
| >3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* | Back alignment and structure |
|---|
| >4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, STRU genomics, protein structure initiative; 2.07A {Escherichia coli} | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* | Back alignment and structure |
|---|
| >3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A | Back alignment and structure |
|---|
| >2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} | Back alignment and structure |
|---|
| >1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* | Back alignment and structure |
|---|
| >2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A | Back alignment and structure |
|---|
| >1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A | Back alignment and structure |
|---|
| >1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} | Back alignment and structure |
|---|
| >1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* | Back alignment and structure |
|---|
| >1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* | Back alignment and structure |
|---|
| >1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 | Back alignment and structure |
|---|
| >3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* | Back alignment and structure |
|---|
| >2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* | Back alignment and structure |
|---|
| >4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} | Back alignment and structure |
|---|
| >3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* | Back alignment and structure |
|---|
| >2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 974 | ||||
| d2nu7b2 | 238 | d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta- | 1e-56 | |
| d1eucb2 | 246 | d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta- | 9e-49 | |
| d1euca1 | 130 | c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-c | 2e-35 | |
| d1oi7a1 | 121 | c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-c | 7e-33 | |
| d2nu7a1 | 119 | c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-c | 1e-32 | |
| d2nu7a2 | 166 | c.23.4.1 (A:122-287) Succinyl-CoA synthetase, alph | 2e-28 | |
| d1oi7a2 | 167 | c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alph | 5e-28 | |
| d1eucb1 | 148 | c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta | 6e-26 | |
| d1euca2 | 176 | c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alph | 7e-26 | |
| d2nu7b1 | 150 | c.23.4.1 (B:239-388) Succinyl-CoA synthetase, beta | 2e-24 | |
| d2csua2 | 161 | c.23.4.1 (A:130-290) Acetate-CoA ligase alpha chai | 2e-20 | |
| d2gy9p1 | 78 | d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherich | 2e-15 | |
| d2uubp1 | 83 | d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus t | 9e-13 | |
| d3bn0a1 | 101 | d.27.1.1 (A:2-102) Ribosomal protein S16 {Aquifex | 4e-12 | |
| d2f1la2 | 89 | b.43.3.4 (A:7-95) 16S rRNA processing protein RimM | 7e-12 | |
| d2csua3 | 163 | c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chai | 2e-08 | |
| d1a9xa5 | 275 | d.142.1.2 (A:128-402) Carbamoyl phosphate syntheta | 9e-06 | |
| d1a9xa6 | 259 | d.142.1.2 (A:677-935) Carbamoyl phosphate syntheta | 0.002 | |
| d2f1la1 | 75 | b.41.1.4 (A:101-175) 16S rRNA processing protein R | 0.003 |
| >d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 238 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATP-grasp superfamily: Glutathione synthetase ATP-binding domain-like family: Succinyl-CoA synthetase, beta-chain, N-terminal domain domain: Succinyl-CoA synthetase, beta-chain, N-terminal domain species: Escherichia coli [TaxId: 562]
Score = 193 bits (491), Expect = 1e-56
Identities = 87/233 (37%), Positives = 137/233 (58%)
Query: 1 MNIYEYQGKEILRKFNVTIPKGILCMNVDEAIKAAKKIGGNSWVIKAQIHAGGRGKCGGI 60
MN++EYQ K++ ++ + P G C EA +AA KIG WV+K Q+HAGGRGK GG+
Sbjct: 1 MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV 60
Query: 61 KLAQSLEQVEKYTKKILGMQLITSQTNQEGENVFCVLIEEYIDIKKELYISFMTDRVQQN 120
K+ S E + + + LG +L+T QT+ G+ V +L+E DI KELY+ + DR +
Sbjct: 61 KVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR 120
Query: 121 IIFMGSNKGGMDIEIISKNSPELLYKTIIDPLIGLTKNNIDNISKKISIPKNSLINFYEE 180
++FM S +GG++IE +++ +P L++K +DPL G ++ K+ + + F +
Sbjct: 121 VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI 180
Query: 181 IQNIYKSYWETDSLLLEINPLVINSKNKIISLDIKFNFDTNALFRHPEIISYQ 233
+ + E D L+EINPLVI + +I LD K D NALFR P++ +
Sbjct: 181 FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMR 233
|
| >d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 | Back information, alignment and structure |
|---|
| >d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 130 | Back information, alignment and structure |
|---|
| >d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Length = 121 | Back information, alignment and structure |
|---|
| >d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d2nu7a2 c.23.4.1 (A:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d1oi7a2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 167 | Back information, alignment and structure |
|---|
| >d1eucb1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 148 | Back information, alignment and structure |
|---|
| >d1euca2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 176 | Back information, alignment and structure |
|---|
| >d2nu7b1 c.23.4.1 (B:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 150 | Back information, alignment and structure |
|---|
| >d2csua2 c.23.4.1 (A:130-290) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Length = 161 | Back information, alignment and structure |
|---|
| >d2gy9p1 d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d2uubp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} Length = 83 | Back information, alignment and structure |
|---|
| >d3bn0a1 d.27.1.1 (A:2-102) Ribosomal protein S16 {Aquifex aeolicus [TaxId: 63363]} Length = 101 | Back information, alignment and structure |
|---|
| >d2f1la2 b.43.3.4 (A:7-95) 16S rRNA processing protein RimM, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 89 | Back information, alignment and structure |
|---|
| >d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Length = 163 | Back information, alignment and structure |
|---|
| >d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 275 | Back information, alignment and structure |
|---|
| >d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d2f1la1 b.41.1.4 (A:101-175) 16S rRNA processing protein RimM, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 75 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 974 | |||
| d2nu7b2 | 238 | Succinyl-CoA synthetase, beta-chain, N-terminal do | 100.0 | |
| d1eucb2 | 246 | Succinyl-CoA synthetase, beta-chain, N-terminal do | 100.0 | |
| d1eucb1 | 148 | Succinyl-CoA synthetase, beta-chain, C-terminal do | 99.97 | |
| d2csua2 | 161 | Acetate-CoA ligase alpha chain, AcdA, domains 2 an | 99.97 | |
| d2nu7b1 | 150 | Succinyl-CoA synthetase, beta-chain, C-terminal do | 99.96 | |
| d1oi7a2 | 167 | Succinyl-CoA synthetase, alpha-chain, C-terminal d | 99.96 | |
| d1euca2 | 176 | Succinyl-CoA synthetase, alpha-chain, C-terminal d | 99.96 | |
| d2nu7a2 | 166 | Succinyl-CoA synthetase, alpha-chain, C-terminal d | 99.96 | |
| d2gy9p1 | 78 | Ribosomal protein S16 {Escherichia coli [TaxId: 56 | 99.89 | |
| d2csua1 | 129 | Acetate-CoA ligase alpha chain, AcdA, N-terminal d | 99.89 | |
| d2uubp1 | 83 | Ribosomal protein S16 {Thermus thermophilus [TaxId | 99.88 | |
| d3bn0a1 | 101 | Ribosomal protein S16 {Aquifex aeolicus [TaxId: 63 | 99.86 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 99.84 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 99.8 | |
| d1iuka_ | 136 | Hypothetical protein TT1466 {Thermus thermophilus | 99.78 | |
| d2f1la2 | 89 | 16S rRNA processing protein RimM, N-terminal domai | 99.73 | |
| d1euca1 | 130 | Succinyl-CoA synthetase, alpha-chain, N-terminal ( | 99.7 | |
| d1oi7a1 | 121 | Succinyl-CoA synthetase, alpha-chain, N-terminal ( | 99.68 | |
| d2nu7a1 | 119 | Succinyl-CoA synthetase, alpha-chain, N-terminal ( | 99.68 | |
| d1gsoa3 | 224 | Glycinamide ribonucleotide synthetase (GAR-syn), d | 99.29 | |
| d1vkza3 | 220 | Glycinamide ribonucleotide synthetase (GAR-syn), d | 99.25 | |
| d1ulza3 | 214 | Biotin carboxylase (BC), domain 2 {Aquifex aeolicu | 99.2 | |
| d2j9ga3 | 216 | Biotin carboxylase (BC), domain 2 {Escherichia col | 99.15 | |
| d1a9xa5 | 275 | Carbamoyl phosphate synthetase (CPS), large subuni | 99.07 | |
| d1a9xa6 | 259 | Carbamoyl phosphate synthetase (CPS), large subuni | 99.03 | |
| d1iowa2 | 210 | D-ala-D-ala ligase, C-domain {Escherichia coli, ge | 98.99 | |
| d1ehia2 | 228 | D-alanine:D-lactate ligase VanA, C-domain {Leucono | 98.97 | |
| d1w96a3 | 267 | Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye | 98.81 | |
| d2r7ka2 | 238 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 98.72 | |
| d1e4ea2 | 211 | D-alanine:D-lactate ligase VanA, C-domain {Enteroc | 98.71 | |
| d1kjqa3 | 206 | Glycinamide ribonucleotide transformylase PurT, do | 98.66 | |
| d2f1la1 | 75 | 16S rRNA processing protein RimM, C-terminal domai | 98.56 | |
| d3etja3 | 198 | N5-carboxyaminoimidazole ribonucleotide synthetase | 98.49 | |
| d2r85a2 | 235 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 98.49 | |
| d1uc8a2 | 192 | Lysine biosynthesis enzyme LysX ATP-binding domain | 98.11 | |
| d2csua3 | 163 | Acetate-CoA ligase alpha chain, AcdA, domains 2 an | 97.97 | |
| d1diha1 | 162 | Dihydrodipicolinate reductase {Escherichia coli [T | 97.55 | |
| d1i7na2 | 206 | Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 | 97.31 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 96.65 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 96.33 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 96.2 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 95.23 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 94.77 | |
| d2csua3 | 163 | Acetate-CoA ligase alpha chain, AcdA, domains 2 an | 94.23 | |
| d1gsaa2 | 192 | Prokaryotic glutathione synthetase, C-domain {Esch | 93.58 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 92.99 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 91.75 | |
| d2nvwa1 | 237 | Galactose/lactose metabolism regulatory protein GA | 91.7 | |
| d1lc0a1 | 172 | Biliverdin reductase {Rat (Rattus norvegicus) [Tax | 91.61 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 91.43 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 90.23 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 90.17 | |
| d1eucb1 | 148 | Succinyl-CoA synthetase, beta-chain, C-terminal do | 89.95 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 89.7 | |
| d2nu7b1 | 150 | Succinyl-CoA synthetase, beta-chain, C-terminal do | 87.21 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 86.69 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 86.58 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 83.19 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 83.15 | |
| d1eysh1 | 201 | Photosynthetic reaction centre {Thermochromatium t | 81.81 |
| >d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATP-grasp superfamily: Glutathione synthetase ATP-binding domain-like family: Succinyl-CoA synthetase, beta-chain, N-terminal domain domain: Succinyl-CoA synthetase, beta-chain, N-terminal domain species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=1.6e-48 Score=415.61 Aligned_cols=238 Identities=37% Similarity=0.656 Sum_probs=230.6
Q ss_pred CCCCHHHHHHHHHHcCCCCCCceeeCCHHHHHHHHHHcCCCcEEEEeeeecCcccccCeEEEeCCHHHHHHHHHHHHhcc
Q psy3769 1 MNIYEYQGKEILRKFNVTIPKGILCMNVDEAIKAAKKIGGNSWVIKAQIHAGGRGKCGGIKLAQSLEQVEKYTKKILGMQ 80 (974)
Q Consensus 1 m~L~E~~ak~lL~~~GIpvp~~~~~~s~eea~~~a~~ig~~PvVvK~qi~~ggrgk~GGV~l~~s~ee~~~a~~~~l~~~ 80 (974)
|||||||||++|++||||||++.+++|++||.++|+++|++|||+|+|+..+||||+|||+++.+++|+.+++.+++++.
T Consensus 1 m~L~E~eaK~lL~~yGIpvp~~~~a~s~~ea~~~a~~iG~~pvVlKaq~~~~hk~~~GGV~~~~~~~e~~~~a~~~~~~~ 80 (238)
T d2nu7b2 1 MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKR 80 (238)
T ss_dssp CBCCHHHHHHHHHHTTCCCCCEEEESSHHHHHHHHHHHCSSCEEEEECCSSSCTTTTTCEEEECSHHHHHHHHHHHTTSE
T ss_pred CchhHHHHHHHHHHcCCCCCCceEECCHHHHHHHHHHhCCCcEEEEEeecccccccceEEEeccccHHHHHHHHHHhCcc
Confidence 99999999999999999999999999999999999999944999999988899999999999999999999999999999
Q ss_pred ccccccCCCCCceeEEEEEEEeccceeEEEEEEEeccCCceeeeccCCCCcceeeccccCCcceEEEEeCCCCCCCHHHH
Q psy3769 81 LITSQTNQEGENVFCVLIEEYIDIKKELYISFMTDRVQQNIIFMGSNKGGMDIEIISKNSPELLYKTIIDPLIGLTKNNI 160 (974)
Q Consensus 81 ~~t~q~~~~g~~~~~vLVee~v~~~~E~ylgi~~Dr~~~~pvii~s~~GGv~iE~~~d~~p~~i~~~~i~p~~gl~~~~a 160 (974)
..|+|+...|..+++++||+|+++++|+|+|+++||.++++++++|..||+++|++.+.+|..+...+++|..++....+
T Consensus 81 ~~~~~~~~~g~~v~~vlve~~~~~~~E~~lg~~~D~~~g~~~l~~s~~GGv~ie~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (238)
T d2nu7b2 81 LVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQG 160 (238)
T ss_dssp ECCTTSCTTCEECCCEEEEECCCEEEEEEEEEEEETTTTEEEEEEESCTTSCHHHHHHHCGGGEEEEECCTTTCCCHHHH
T ss_pred eeeeccccCCcccceeeecceeecccceEEEEEEeccCCceEEEEecccceeeEeeeccccccccccccCcccccchhhH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHCCCChhhHHHHHHHHHHHHhhcccCCeeEEeeceeEEccCCcEEEEEEEEeeeCccccCCccccccccchhh
Q psy3769 161 DNISKKISIPKNSLINFYEEIQNIYKSYWETDSLLLEINPLVINSKNKIISLDIKFNFDTNALFRHPEIISYQYAHKK 238 (974)
Q Consensus 161 ~~~~~~lg~~~~~~~~l~~~l~~L~~l~~~~d~~~lEINPL~v~~~g~~~alDaki~ldd~a~~r~~~~~~~~~~~~~ 238 (974)
.+++..+|.++.+..++.+++.++|++|.+.+++++|||||+++++|+++|+|||+++||||.||||+|..++|++||
T Consensus 161 ~~~~~~~~~~~~~~~~~~~~i~~l~~~~~~~~~~~lEINPLiv~~~G~vvAlDAki~lDdnA~fr~~~~~~~~d~~~e 238 (238)
T d2nu7b2 161 RELAFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQE 238 (238)
T ss_dssp HHHHHHTTCCTHHHHHHHHHHHHHHHHHHHTTEEEEEEEEEEEETTSCEEESCCEEEECGGGGGGCHHHHHTCCGGGS
T ss_pred HHHHHhcCCcchhhHHHHHHHHHhhHhhhcCCceEEeecceEECCCCCEEEEEeEEeecCcchhcChhHHhhcCcCCC
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999988764
|
| >d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1eucb1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2csua2 c.23.4.1 (A:130-290) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2nu7b1 c.23.4.1 (B:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oi7a2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1euca2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2nu7a2 c.23.4.1 (A:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gy9p1 d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2uubp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3bn0a1 d.27.1.1 (A:2-102) Ribosomal protein S16 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f1la2 b.43.3.4 (A:7-95) 16S rRNA processing protein RimM, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} | Back information, alignment and structure |
|---|
| >d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f1la1 b.41.1.4 (A:101-175) 16S rRNA processing protein RimM, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1eucb1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2nu7b1 c.23.4.1 (B:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1eysh1 b.41.1.1 (H:59-259) Photosynthetic reaction centre {Thermochromatium tepidum [TaxId: 1050]} | Back information, alignment and structure |
|---|