Psyllid ID: psy3895

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MSRQRERNERSLVNEAVLMAIQRHGLQHQQDEDQDETSSSVQSPPGVIQSKSDSAGVVVLEIERSVDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVHHKDF
ccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccc
MSRQRERNERSLVNEAVLMAIQRHglqhqqdedqdetsssvqsppgviqsksdsagVVVLEIERSVDLKYCWVCFatheddrnalwvqpclcrgtskwVHQACLNRWIdekqkgnaftqvacpqcntkyfivypyRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVHHKDF
msrqrernersLVNEAVLMAIQRHGLQHQQDEDQDETSSSvqsppgviqsksdsagVVVLEIERSVDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVHHKDF
MSRQRERNERSLVNEAVLMAIQRHGLQHQQDEDQDETSSSVQSPPGVIQSKSDSAGVVVLEIERSVDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVHHKDF
*******************************************************GVVVLEIERSVDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVH****
**********************************************************************CWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVHHKDF
**********SLVNEAVLMAIQRH*****************************SAGVVVLEIERSVDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVHHKDF
******************************************************************DLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVHHK**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRQRERNERSLVNEAVLMAIQRHGLQHQQDEDQDETSSSVQSPPGVIQSKSDSAGVVVLEIERSVDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVHHKDF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query185 2.2.26 [Sep-21-2011]
Q6GM44 283 E3 ubiquitin-protein liga N/A N/A 0.627 0.409 0.635 2e-42
Q3KNM2 278 E3 ubiquitin-protein liga yes N/A 0.627 0.417 0.635 3e-42
Q9NX47 278 E3 ubiquitin-protein liga yes N/A 0.627 0.417 0.635 3e-42
Q0X0A5 278 E3 ubiquitin-protein liga N/A N/A 0.627 0.417 0.635 3e-42
Q3ZC24 278 E3 ubiquitin-protein liga yes N/A 0.627 0.417 0.635 3e-42
Q5ZJ41 281 E3 ubiquitin-protein liga yes N/A 0.670 0.441 0.598 6e-42
Q6NYK8 289 E3 ubiquitin-protein liga no N/A 0.621 0.397 0.598 3e-38
>sp|Q6GM44|MARH5_XENLA E3 ubiquitin-protein ligase MARCH5 OS=Xenopus laevis GN=march5 PE=2 SV=1 Back     alignment and function desciption
 Score =  171 bits (433), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 75/118 (63%), Positives = 93/118 (78%), Gaps = 2/118 (1%)

Query: 69  KYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTK 128
           + CWVCFAT EDDR A WV+PC CRG++KWVHQACL RW+DEKQ+GN+  +VACPQCN +
Sbjct: 15  RSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAE 74

Query: 129 YFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVM--VHHKD 184
           Y IV+P  G +V +LD  D  + K CPF AAG+++GS+YW AVTYGAVTVM  V HK+
Sbjct: 75  YLIVFPNLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKE 132
Mitochondrial E3 ubiquitin-protein ligase that plays a crucial role in the control of mitochondrial morphology by acting as a positive regulator of mitochondrial fission. May play a role in the prevention of cell senescence acting as a regulator of mitochondrial quality control.
Xenopus laevis (taxid: 8355)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q3KNM2|MARH5_MOUSE E3 ubiquitin-protein ligase MARCH5 OS=Mus musculus GN=March5 PE=2 SV=1 Back     alignment and function description
>sp|Q9NX47|MARH5_HUMAN E3 ubiquitin-protein ligase MARCH5 OS=Homo sapiens GN=MARCH5 PE=1 SV=1 Back     alignment and function description
>sp|Q0X0A5|MARH5_CHLAE E3 ubiquitin-protein ligase MARCH5 OS=Chlorocebus aethiops GN=MARCH5 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZC24|MARH5_BOVIN E3 ubiquitin-protein ligase MARCH5 OS=Bos taurus GN=MARCH5 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZJ41|MARH5_CHICK E3 ubiquitin-protein ligase MARCH5 OS=Gallus gallus GN=MARCH5 PE=2 SV=1 Back     alignment and function description
>sp|Q6NYK8|MARH5_DANRE E3 ubiquitin-protein ligase MARCH5 OS=Danio rerio GN=march5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
307195732 397 E3 ubiquitin-protein ligase MARCH5 [Harp 0.816 0.380 0.574 1e-46
332018806 425 E3 ubiquitin-protein ligase MARCH5 [Acro 0.637 0.277 0.691 1e-46
307181190 400 E3 ubiquitin-protein ligase MARCH5 [Camp 0.637 0.295 0.683 3e-46
291240453 337 PREDICTED: membrane-associated ring fing 0.745 0.409 0.592 2e-45
350420201 398 PREDICTED: E3 ubiquitin-protein ligase M 0.637 0.296 0.683 2e-45
340728875 398 PREDICTED: e3 ubiquitin-protein ligase M 0.637 0.296 0.683 3e-45
340728879 398 PREDICTED: e3 ubiquitin-protein ligase M 0.637 0.296 0.683 3e-45
156554697 381 PREDICTED: E3 ubiquitin-protein ligase M 0.843 0.409 0.539 3e-45
328792901 397 PREDICTED: e3 ubiquitin-protein ligase M 0.864 0.403 0.508 3e-44
380011359 397 PREDICTED: E3 ubiquitin-protein ligase M 0.637 0.297 0.658 4e-44
>gi|307195732|gb|EFN77572.1| E3 ubiquitin-protein ligase MARCH5 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 112/155 (72%), Gaps = 4/155 (2%)

Query: 32  EDQDETSSSVQSPPGVIQSKSDSAGVVVLEIERSVDLKYCWVCFATHEDDRNALWVQPCL 91
           ED  +   S+    GV      ++ +  L ++   D +YCWVCFAT EDD  A WV+PC 
Sbjct: 81  EDITDRELSIDITDGVSSPNYTTSSMRSLSMDE--DKRYCWVCFATDEDDATAAWVKPCH 138

Query: 92  CRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVY 151
           CRGT+KWVHQ C+ RW+DEKQKG+A   VACPQCNT+Y IVYP  G LV +LDTIDT ++
Sbjct: 139 CRGTTKWVHQGCIQRWVDEKQKGHAEHAVACPQCNTEYIIVYPNMGPLVVILDTIDTVIF 198

Query: 152 KLCPFVAAGVVLGSMYWCAVTYGAVTVM--VHHKD 184
           ++CPF+AAG+V+GS+YW AVTYGAVTVM  V HKD
Sbjct: 199 RVCPFIAAGIVVGSIYWTAVTYGAVTVMQVVGHKD 233

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332018806|gb|EGI59365.1| E3 ubiquitin-protein ligase MARCH5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307181190|gb|EFN68890.1| E3 ubiquitin-protein ligase MARCH5 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|291240453|ref|XP_002740133.1| PREDICTED: membrane-associated ring finger (C3HC4) 5-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|350420201|ref|XP_003492432.1| PREDICTED: E3 ubiquitin-protein ligase MARCH5-like isoform 1 [Bombus impatiens] gi|350420204|ref|XP_003492433.1| PREDICTED: E3 ubiquitin-protein ligase MARCH5-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728875|ref|XP_003402738.1| PREDICTED: e3 ubiquitin-protein ligase MARCH5-like isoform 1 [Bombus terrestris] gi|340728877|ref|XP_003402739.1| PREDICTED: e3 ubiquitin-protein ligase MARCH5-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340728879|ref|XP_003402740.1| PREDICTED: e3 ubiquitin-protein ligase MARCH5-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|156554697|ref|XP_001606276.1| PREDICTED: E3 ubiquitin-protein ligase MARCH5-like isoform 1 [Nasonia vitripennis] gi|345494225|ref|XP_003427252.1| PREDICTED: E3 ubiquitin-protein ligase MARCH5-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328792901|ref|XP_624445.3| PREDICTED: e3 ubiquitin-protein ligase MARCH5-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380011359|ref|XP_003689775.1| PREDICTED: E3 ubiquitin-protein ligase MARCH5-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
UNIPROTKB|Q6GM44 283 march5 "E3 ubiquitin-protein l 0.670 0.438 0.598 8.4e-42
ZFIN|ZDB-GENE-070424-47 281 march5 "membrane-associated ri 0.681 0.448 0.603 8.4e-42
UNIPROTKB|Q3ZC24 278 MARCH5 "E3 ubiquitin-protein l 0.659 0.438 0.608 1.4e-41
UNIPROTKB|E2RIR8 278 MARCH5 "Uncharacterized protei 0.659 0.438 0.608 1.4e-41
UNIPROTKB|Q9NX47 278 MARCH5 "E3 ubiquitin-protein l 0.659 0.438 0.608 1.4e-41
UNIPROTKB|Q0X0A5 278 MARCH5 "E3 ubiquitin-protein l 0.659 0.438 0.608 1.4e-41
MGI|MGI:1915207 278 March5 "membrane-associated ri 0.659 0.438 0.608 1.4e-41
RGD|1305617 278 March5 "membrane-associated ri 0.659 0.438 0.608 1.4e-41
UNIPROTKB|F2Z5H0 278 MARCH5 "Uncharacterized protei 0.637 0.424 0.632 1.7e-41
UNIPROTKB|Q5ZJ41 281 MARCH5 "E3 ubiquitin-protein l 0.670 0.441 0.598 2.2e-41
UNIPROTKB|Q6GM44 march5 "E3 ubiquitin-protein ligase MARCH5" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 443 (161.0 bits), Expect = 8.4e-42, P = 8.4e-42
 Identities = 76/127 (59%), Positives = 99/127 (77%)

Query:    60 LEIERSVDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQ 119
             + +++ +D + CWVCFAT EDDR A WV+PC CRG++KWVHQACL RW+DEKQ+GN+  +
Sbjct:     7 VSVQQMLD-RSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTAR 65

Query:   120 VACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVM 179
             VACPQCN +Y IV+P  G +V +LD  D  + K CPF AAG+++GS+YW AVTYGAVTVM
Sbjct:    66 VACPQCNAEYLIVFPNLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVM 125

Query:   180 --VHHKD 184
               V HK+
Sbjct:   126 QVVGHKE 132
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0005741 "mitochondrial outer membrane" evidence=ISS
GO:0005783 "endoplasmic reticulum" evidence=ISS
GO:0051865 "protein autoubiquitination" evidence=ISS
GO:0090140 "regulation of mitochondrial fission" evidence=ISS
GO:0090344 "negative regulation of cell aging" evidence=ISS
ZFIN|ZDB-GENE-070424-47 march5 "membrane-associated ring finger (C3HC4) 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZC24 MARCH5 "E3 ubiquitin-protein ligase MARCH5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIR8 MARCH5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NX47 MARCH5 "E3 ubiquitin-protein ligase MARCH5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q0X0A5 MARCH5 "E3 ubiquitin-protein ligase MARCH5" [Chlorocebus aethiops (taxid:9534)] Back     alignment and assigned GO terms
MGI|MGI:1915207 March5 "membrane-associated ring finger (C3HC4) 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305617 March5 "membrane-associated ring finger (C3HC4) 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5H0 MARCH5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJ41 MARCH5 "E3 ubiquitin-protein ligase MARCH5" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3ZC24MARH5_BOVIN6, ., 3, ., 2, ., -0.63550.62700.4172yesN/A
Q5ZJ41MARH5_CHICK6, ., 3, ., 2, ., -0.59840.67020.4412yesN/A
Q3KNM2MARH5_MOUSE6, ., 3, ., 2, ., -0.63550.62700.4172yesN/A
Q9NX47MARH5_HUMAN6, ., 3, ., 2, ., -0.63550.62700.4172yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 2e-13
pfam1290647 pfam12906, RINGv, RING-variant domain 4e-11
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 5e-05
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 2e-04
PHA02862156 PHA02862, PHA02862, 5L protein; Provisional 6e-04
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 61.5 bits (150), Expect = 2e-13
 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 8/57 (14%)

Query: 70  YCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCN 126
            C +C    E D     V PC C+G+ K+VHQ CL RWI+E           C  C 
Sbjct: 1   ICRICHD--EGDEGDPLVSPCRCKGSLKYVHQECLERWINESGN------KTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|165197 PHA02862, PHA02862, 5L protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 185
KOG3053|consensus 293 100.0
PHA02862156 5L protein; Provisional 99.79
PHA02825162 LAP/PHD finger-like protein; Provisional 99.77
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.71
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.69
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.66
KOG1609|consensus 323 99.07
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.09
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.03
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.69
PHA02929238 N1R/p28-like protein; Provisional 97.55
KOG4628|consensus348 97.5
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.14
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.13
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.09
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.07
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.94
PHA02926242 zinc finger-like protein; Provisional 96.9
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.89
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.27
KOG1645|consensus 463 96.24
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.23
KOG1493|consensus84 96.11
KOG0823|consensus230 96.08
KOG0802|consensus 543 95.67
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 95.65
KOG0828|consensus636 95.64
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 95.3
smart0050463 Ubox Modified RING finger domain. Modified RING fi 95.14
PF1463444 zf-RING_5: zinc-RING finger domain 94.4
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 94.28
KOG0827|consensus 465 93.29
PLN02189 1040 cellulose synthase 93.16
KOG0804|consensus 493 93.09
KOG0317|consensus293 93.04
COG52191525 Uncharacterized conserved protein, contains RING Z 92.95
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 92.89
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.63
PLN02195 977 cellulose synthase A 92.43
KOG1734|consensus328 92.29
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 92.12
PLN02436 1094 cellulose synthase A 91.98
KOG4445|consensus 368 91.86
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 91.73
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 90.45
KOG2930|consensus114 90.44
PLN02400 1085 cellulose synthase 90.14
KOG0287|consensus 442 88.69
PF10272358 Tmpp129: Putative transmembrane protein precursor; 88.45
PLN02915 1044 cellulose synthase A [UDP-forming], catalytic subu 87.02
KOG0320|consensus187 86.85
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 85.59
KOG0825|consensus 1134 84.63
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 84.35
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 84.0
KOG4265|consensus349 83.71
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 83.61
KOG3970|consensus 299 82.93
KOG1785|consensus563 82.57
>KOG3053|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.8e-34  Score=243.72  Aligned_cols=121  Identities=56%  Similarity=1.220  Sum_probs=114.4

Q ss_pred             cCCCCCCeeeEecccccCCCCCceeeccCCCCCCccccHHHHHHHHHHhccCCCCCCccccCCCcceeeecCccchHHHH
Q psy3895          63 ERSVDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSL  142 (185)
Q Consensus        63 ~~~~~~~~CrIC~~~~~~~~~~~li~PC~C~GS~k~VH~~CL~~Wi~~~~~~~~~~~~~Ce~Ck~~y~i~~p~~~~~~~l  142 (185)
                      +..+.++.|||||.+++|+....|++||+|+||+||||++||.+|+.+|+.+|......|+||+++|.+++|+..++...
T Consensus        15 ~~~e~eR~CWiCF~TdeDn~~a~WV~PCrCRGt~KWVHqsCL~rWiDEK~~~n~~q~V~C~QCqTEYiiv~P~l~~~~~~   94 (293)
T KOG3053|consen   15 DNQELERCCWICFATDEDNRLAAWVHPCRCRGTTKWVHQSCLSRWIDEKQRGNPLQTVSCPQCQTEYIIVFPQLGPFDRV   94 (293)
T ss_pred             CccccceeEEEEeccCcccchhhhcccccccCccHHHHHHHHHHHHhHHhcCCCCceeechhhcchheeeccccChHHHH
Confidence            44677899999999998876667999999999999999999999999999888889999999999999999999999999


Q ss_pred             HHHHHhhhhhhhhHHHHHHHHhHHHHHHHHHhhhhhe--eccc
Q psy3895         143 LDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVM--VHHK  183 (185)
Q Consensus       143 l~~~~~~~~~~~p~i~~~~l~~~~y~~a~~yG~~~i~--~G~~  183 (185)
                      +++++....+++||++.+++++.+||.|++|||.+++  +|++
T Consensus        95 Le~~d~~i~r~cp~l~~g~~v~~iYWsAVtyGA~T~lQv~G~~  137 (293)
T KOG3053|consen   95 LERLDILIFRLCPFLAAGIFVGSIYWSAVTYGAVTVLQVVGQE  137 (293)
T ss_pred             HHHhhhHHhhcChHHHHHHHhheeehhhhhhcceeeeehhhhH
Confidence            9999999999999999999999999999999999999  8886

>PHA02862 5L protein; Provisional Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1609|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 2e-16
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 6e-14
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 3e-04
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
 Score = 69.9 bits (171), Expect = 2e-16
 Identities = 18/69 (26%), Positives = 28/69 (40%), Gaps = 8/69 (11%)

Query: 69  KYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTK 128
             C +C    +D+     + PC C G+  +VHQACL +WI             C  C  +
Sbjct: 16  DICRICHCEGDDESP--LITPCHCTGSLHFVHQACLQQWIKSSDT------RCCELCKYE 67

Query: 129 YFIVYPYRG 137
           + +     G
Sbjct: 68  FIMETKLSG 76
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.78
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.69
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.41
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.3
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.29
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.29
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.27
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.22
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.2
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.17
2ect_A78 Ring finger protein 126; metal binding protein, st 98.13
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.11
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.02
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.96
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.92
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.88
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.83
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.82
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.82
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.81
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.81
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.81
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.8
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.8
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.74
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.67
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.67
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.64
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.63
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.62
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.62
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.61
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.56
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.55
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.53
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.46
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.41
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.37
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.35
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.3
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.18
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.16
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.14
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.09
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.04
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.91
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 96.89
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.85
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 96.62
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 96.58
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.39
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 95.92
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 95.87
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 95.65
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 95.64
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 95.64
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 95.61
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 95.55
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.54
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 95.48
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 95.43
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 95.32
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.2
3nw0_A238 Non-structural maintenance of chromosomes element 95.12
2ea5_A68 Cell growth regulator with ring finger domain prot 94.2
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 93.5
2f42_A179 STIP1 homology and U-box containing protein 1; cha 92.52
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 91.41
1wil_A89 KIAA1045 protein; ring finger domain, structural g 90.13
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 88.33
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 86.84
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 84.94
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 84.78
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 82.39
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 81.61
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 80.56
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.78  E-value=8e-20  Score=124.23  Aligned_cols=57  Identities=28%  Similarity=0.736  Sum_probs=50.0

Q ss_pred             CCCCCeeeEecccccCCCCCceeeccCCCCCCccccHHHHHHHHHHhccCCCCCCccccCCCcceee
Q psy3895          65 SVDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFI  131 (185)
Q Consensus        65 ~~~~~~CrIC~~~~~~~~~~~li~PC~C~GS~k~VH~~CL~~Wi~~~~~~~~~~~~~Ce~Ck~~y~i  131 (185)
                      ++++..||||+++.    +++|+.||+|+||++|||+.||.+|+..+      +...||+|+++|.+
T Consensus         3 ~~~~~~CrIC~~~~----~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~------~~~~C~~C~~~~~~   59 (60)
T 1vyx_A            3 DEDVPVCWICNEEL----GNERFRACGCTGELENVHRSCLSTWLTIS------RNTACQICGVVYNT   59 (60)
T ss_dssp             TCSCCEETTTTEEC----SCCCCCSCCCSSGGGSCCHHHHHHHHHHH------TCSBCTTTCCBCCC
T ss_pred             CCCCCEeEEeecCC----CCceecCcCCCCchhhhHHHHHHHHHHhC------CCCccCCCCCeeec
Confidence            46788999999874    24689999999999999999999999986      35899999999986
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 185
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 2e-05
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 0.003
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 38.7 bits (89), Expect = 2e-05
 Identities = 16/65 (24%), Positives = 26/65 (40%), Gaps = 10/65 (15%)

Query: 67  DLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCN 126
           D+  CW+C     ++      + C C G  + VH++CL+ W+            AC  C 
Sbjct: 5   DVPVCWICN----EELGNERFRACGCTGELENVHRSCLSTWLTI------SRNTACQICG 54

Query: 127 TKYFI 131
             Y  
Sbjct: 55  VVYNT 59
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.6
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.48
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.43
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.3
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.27
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.15
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.1
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.77
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.72
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.3
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.24
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 96.91
d2c2la280 STIP1 homology and U box-containing protein 1, STU 96.49
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 96.23
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 95.54
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 95.53
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 94.68
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 92.99
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 91.88
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 87.44
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.60  E-value=1.9e-16  Score=105.12  Aligned_cols=58  Identities=28%  Similarity=0.715  Sum_probs=50.1

Q ss_pred             CCCCCeeeEecccccCCCCCceeeccCCCCCCccccHHHHHHHHHHhccCCCCCCccccCCCcceeee
Q psy3895          65 SVDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIV  132 (185)
Q Consensus        65 ~~~~~~CrIC~~~~~~~~~~~li~PC~C~GS~k~VH~~CL~~Wi~~~~~~~~~~~~~Ce~Ck~~y~i~  132 (185)
                      +++...|+||+++.+    ++++.||.|.|+.+++|..||.+|+..+.      ..+||+|+++|++.
T Consensus         3 ded~~~C~IC~~~~~----~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~------~~~CP~Cr~~~~~k   60 (60)
T d1vyxa_           3 DEDVPVCWICNEELG----NERFRACGCTGELENVHRSCLSTWLTISR------NTACQICGVVYNTR   60 (60)
T ss_dssp             TCSCCEETTTTEECS----CCCCCSCCCSSGGGSCCHHHHHHHHHHHT------CSBCTTTCCBCCCC
T ss_pred             CCCCCCCccCCccCC----CceeEecccCCCCCEEcHHHHHHHHhhCC------CCCCcccCCeeecC
Confidence            467889999998653    46889999999999999999999998863      47899999999863
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure