Psyllid ID: psy3916

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFDDPEIKKDMKNLSYKIVRASNGDAWVQGKNIRISEVVEVLCPNI
cccccEEEEEccccccccccEEEEcccccEEEccccHHccccccccccEEEEHHcccccccHHHHHHcccccEEEEEcccccEEEEEEccccHHHHHHHHccc
cccccEEEEEccccccccccEEEEcccccEEEcHHHHcccccccccEEccHHHHcccccccHHHHHHHcccccEEEEccccccEEEEEEccHHHHHHHHHHcc
megkqakviensegsrttpsvvaftkdgerlvgtparrqavtnsaNTFYATKRligrrfddpeikkdmKNLSYKIVRAsngdawvqgknirISEVVEVLCPNI
megkqakviensegsrttpsvvaftkdgerlvgtparrqavtnsantfyatkrligrrfddpeikkdmknLSYKIVrasngdawvqgknirisevvevlcpni
MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFDDPEIKKDMKNLSYKIVRASNGDAWVQGKNIRISEVVEVLCPNI
****************************************VTNSANTFYATKRLIGRRFDDPEIKKDMKNLSYKIVRASNGDAWVQGKNIRISEVVEVLC***
**GKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFDDPEIKKDMKNLSYKIVRASNGDAWVQGKNIRISEVVEVLCPNI
*****************TPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFDDPEIKKDMKNLSYKIVRASNGDAWVQGKNIRISEVVEVLCPNI
***KQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFDDPEIKKDMKNLSYKIVRASNGDAWVQGKNIRISEVVEVLCP**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFDDPEIKKDMKNLSYKIVRASNGDAWVQGKNIRISEVVEVLCPNI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query103 2.2.26 [Sep-21-2011]
P29845 686 Heat shock 70 kDa protein yes N/A 0.825 0.123 0.882 1e-40
Q5ZM98 675 Stress-70 protein, mitoch yes N/A 0.834 0.127 0.837 3e-38
Q5R511 679 Stress-70 protein, mitoch yes N/A 0.834 0.126 0.813 5e-38
Q3ZCH0 679 Stress-70 protein, mitoch yes N/A 0.834 0.126 0.813 6e-38
P38646 679 Stress-70 protein, mitoch yes N/A 0.834 0.126 0.813 6e-38
O35501 679 Stress-70 protein, mitoch yes N/A 0.834 0.126 0.813 9e-38
P38647 679 Stress-70 protein, mitoch yes N/A 0.834 0.126 0.813 1e-37
P48721 679 Stress-70 protein, mitoch yes N/A 0.834 0.126 0.813 1e-37
P11141 657 Heat shock 70 kDa protein yes N/A 0.922 0.144 0.731 2e-35
P0CS91 655 Heat shock protein SSC1, yes N/A 0.854 0.134 0.704 7e-33
>sp|P29845|HSP7E_DROME Heat shock 70 kDa protein cognate 5 OS=Drosophila melanogaster GN=Hsc70-5 PE=1 SV=2 Back     alignment and function desciption
 Score =  164 bits (416), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 82/85 (96%)

Query: 1   MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFD 60
           MEGKQAKVIEN+EG+RTTPS VAFTKDGERLVG PA+RQAVTNSANTFYATKRLIGRRFD
Sbjct: 69  MEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVTNSANTFYATKRLIGRRFD 128

Query: 61  DPEIKKDMKNLSYKIVRASNGDAWV 85
           DPE+KKD+ NLSYK+V+ASNGDAWV
Sbjct: 129 DPEVKKDITNLSYKVVKASNGDAWV 153

Drosophila melanogaster (taxid: 7227)
>sp|Q5ZM98|GRP75_CHICK Stress-70 protein, mitochondrial OS=Gallus gallus GN=HSPA9 PE=1 SV=1 Back     alignment and function description
>sp|Q5R511|GRP75_PONAB Stress-70 protein, mitochondrial OS=Pongo abelii GN=HSPA9 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos taurus GN=HSPA9 PE=2 SV=1 Back     alignment and function description
>sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2 Back     alignment and function description
>sp|O35501|GRP75_CRIGR Stress-70 protein, mitochondrial OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1 Back     alignment and function description
>sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=3 Back     alignment and function description
>sp|P48721|GRP75_RAT Stress-70 protein, mitochondrial OS=Rattus norvegicus GN=Hspa9 PE=1 SV=3 Back     alignment and function description
>sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2 Back     alignment and function description
>sp|P0CS91|HSP77_YEASX Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae GN=SSC1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
383854392 689 PREDICTED: heat shock 70 kDa protein cog 0.844 0.126 0.908 3e-41
91077414 690 PREDICTED: similar to conserved hypothet 0.864 0.128 0.898 4e-41
289743261 701 heat shock protein cognate 5 [Glossina m 0.893 0.131 0.826 2e-40
340709511 687 PREDICTED: LOW QUALITY PROTEIN: heat sho 0.844 0.126 0.896 4e-40
350420449 687 PREDICTED: heat shock 70 kDa protein cog 0.844 0.126 0.885 5e-40
307181923 659 Heat shock 70 kDa protein cognate 5 [Cam 0.864 0.135 0.865 6e-40
229892203 687 heat shock protein cognate 5 [Apis melli 0.893 0.133 0.826 2e-39
380023607 687 PREDICTED: heat shock 70 kDa protein cog 0.893 0.133 0.826 2e-39
193620217 680 PREDICTED: stress-70 protein, mitochondr 0.864 0.130 0.831 2e-39
345489283 687 PREDICTED: heat shock 70 kDa protein cog 0.864 0.129 0.853 3e-39
>gi|383854392|ref|XP_003702705.1| PREDICTED: heat shock 70 kDa protein cognate 5-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 79/87 (90%), Positives = 84/87 (96%)

Query: 1   MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFD 60
           MEGKQAKVIENSEGSRTTPS VAFTKDGERL+G PA+RQAVTNSANTFYATKRLIGR+FD
Sbjct: 75  MEGKQAKVIENSEGSRTTPSYVAFTKDGERLIGMPAKRQAVTNSANTFYATKRLIGRKFD 134

Query: 61  DPEIKKDMKNLSYKIVRASNGDAWVQG 87
           DPE+KKDMK +SYKIVRASNGDAWVQG
Sbjct: 135 DPEVKKDMKTVSYKIVRASNGDAWVQG 161

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91077414|ref|XP_975386.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270001633|gb|EEZ98080.1| hypothetical protein TcasGA2_TC000487 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|289743261|gb|ADD20378.1| heat shock protein cognate 5 [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|340709511|ref|XP_003393349.1| PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa protein cognate 5-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350420449|ref|XP_003492512.1| PREDICTED: heat shock 70 kDa protein cognate 5-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307181923|gb|EFN69363.1| Heat shock 70 kDa protein cognate 5 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|229892203|ref|NP_001153520.1| heat shock protein cognate 5 [Apis mellifera] Back     alignment and taxonomy information
>gi|380023607|ref|XP_003695609.1| PREDICTED: heat shock 70 kDa protein cognate 5-like [Apis florea] Back     alignment and taxonomy information
>gi|193620217|ref|XP_001950499.1| PREDICTED: stress-70 protein, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345489283|ref|XP_001599525.2| PREDICTED: heat shock 70 kDa protein cognate 5-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
FB|FBgn0001220 686 Hsc70-5 "Heat shock protein co 0.893 0.134 0.815 3.6e-36
UNIPROTKB|D6RJI295 HSPA9 "Stress-70 protein, mito 0.834 0.905 0.813 1.1e-34
UNIPROTKB|F1NZ86 675 HSPA9 "Stress-70 protein, mito 0.922 0.140 0.773 2.5e-34
UNIPROTKB|Q5ZM98 675 HSPA9 "Stress-70 protein, mito 0.922 0.140 0.773 2.5e-34
UNIPROTKB|E2RAU5 679 HSPA9 "Stress-70 protein, mito 0.922 0.139 0.752 3.2e-34
UNIPROTKB|Q3ZCH0 679 HSPA9 "Stress-70 protein, mito 0.922 0.139 0.752 4.1e-34
UNIPROTKB|P38646 679 HSPA9 "Stress-70 protein, mito 0.922 0.139 0.752 4.1e-34
UNIPROTKB|F1RGJ3 679 HSPA9 "Stress-70 protein, mito 0.922 0.139 0.752 4.1e-34
MGI|MGI:96245 679 Hspa9 "heat shock protein 9" [ 0.922 0.139 0.752 6.9e-34
RGD|1311806 679 Hspa9 "heat shock protein 9" [ 0.922 0.139 0.752 6.9e-34
FB|FBgn0001220 Hsc70-5 "Heat shock protein cognate 5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 396 (144.5 bits), Expect = 3.6e-36, P = 3.6e-36
 Identities = 75/92 (81%), Positives = 85/92 (92%)

Query:     1 MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFD 60
             MEGKQAKVIEN+EG+RTTPS VAFTKDGERLVG PA+RQAVTNSANTFYATKRLIGRRFD
Sbjct:    69 MEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVTNSANTFYATKRLIGRRFD 128

Query:    61 DPEIKKDMKNLSYKIVRASNGDAWVQGKNIRI 92
             DPE+KKD+ NLSYK+V+ASNGDAWV   + ++
Sbjct:   129 DPEVKKDITNLSYKVVKASNGDAWVSSTDGKV 160
GO:0005739 "mitochondrion" evidence=ISS;NAS
GO:0009408 "response to heat" evidence=NAS
GO:0006457 "protein folding" evidence=ISS
GO:0016887 "ATPase activity" evidence=NAS
GO:0051082 "unfolded protein binding" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|D6RJI2 HSPA9 "Stress-70 protein, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZ86 HSPA9 "Stress-70 protein, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM98 HSPA9 "Stress-70 protein, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAU5 HSPA9 "Stress-70 protein, mitochondrial" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCH0 HSPA9 "Stress-70 protein, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P38646 HSPA9 "Stress-70 protein, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RGJ3 HSPA9 "Stress-70 protein, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:96245 Hspa9 "heat shock protein 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311806 Hspa9 "heat shock protein 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8I0H7HSP7M_DICDINo assigned EC number0.64580.91260.1428yesN/A
P29845HSP7E_DROMENo assigned EC number0.88230.82520.1239yesN/A
A8IPT1DNAK_AZOC5No assigned EC number0.64940.92230.1505yesN/A
Q0AKB1DNAK_MARMMNo assigned EC number0.65590.90290.1462yesN/A
Q6G1F9DNAK_BARQUNo assigned EC number0.65970.92230.1507yesN/A
P94317DNAK_BRAJANo assigned EC number0.73250.83490.1358yesN/A
P0CS91HSP77_YEASXNo assigned EC number0.70450.85430.1343yesN/A
P0CS90HSP77_YEASTNo assigned EC number0.70450.85430.1345yesN/A
B8GNX1DNAK_THISHNo assigned EC number0.62360.90290.1450yesN/A
Q21CI2DNAK_RHOPBNo assigned EC number0.69760.83490.1360yesN/A
A9ILH7DNAK_BART1No assigned EC number0.65970.92230.1507yesN/A
B3Q972DNAK_RHOPTNo assigned EC number0.67010.92230.1505yesN/A
B6IVA4DNAK_RHOCSNo assigned EC number0.65970.92230.1484yesN/A
Q2J320DNAK_RHOP2No assigned EC number0.69760.83490.1358yesN/A
Q5NPS6DNAK_ZYMMONo assigned EC number0.72090.83490.1354yesN/A
A6UEY0DNAK_SINMWNo assigned EC number0.67410.86400.1388yesN/A
Q5B0C0HSP7M_EMENINo assigned EC number0.62360.90290.1396yesN/A
A1UUC3DNAK_BARBKNo assigned EC number0.70930.83490.1362yesN/A
P42374DNAK_RHIMENo assigned EC number0.65590.90290.1450yesN/A
Q3ZCH0GRP75_BOVINNo assigned EC number0.81390.83490.1266yesN/A
Q5R511GRP75_PONABNo assigned EC number0.81390.83490.1266yesN/A
B1LZ51DNAK_METRJNo assigned EC number0.65590.90290.1457yesN/A
B4F2V5DNAK_PROMHNo assigned EC number0.61290.90290.1450yesN/A
Q2VYT1DNAK_MAGSANo assigned EC number0.64510.90290.1448yesN/A
Q5FSL5DNAK_GLUOXNo assigned EC number0.67810.84460.1372yesN/A
Q0BWZ9DNAK_HYPNANo assigned EC number0.67410.86400.1410yesN/A
B8EIP9DNAK_METSBNo assigned EC number0.65970.92230.1498yesN/A
Q8GUM2HSP7I_ARATHNo assigned EC number0.66660.90290.1363yesN/A
Q13E60DNAK_RHOPSNo assigned EC number0.68600.83490.1358yesN/A
P38647GRP75_MOUSENo assigned EC number0.81390.83490.1266yesN/A
P38646GRP75_HUMANNo assigned EC number0.81390.83490.1266yesN/A
Q6G554DNAK_BARHENo assigned EC number0.65970.92230.1507yesN/A
B0UR84DNAK_METS4No assigned EC number0.63910.92230.1486yesN/A
Q07US6DNAK_RHOP5No assigned EC number0.70930.83490.1358yesN/A
Q5ZM98GRP75_CHICKNo assigned EC number0.83720.83490.1274yesN/A
P48721GRP75_RATNo assigned EC number0.81390.83490.1266yesN/A
Q11KJ6DNAK_MESSBNo assigned EC number0.66660.90290.1462yesN/A
P22774HSP7M_SCHPONo assigned EC number0.68180.85430.1305yesN/A
P11141HSP7F_CAEELNo assigned EC number0.73190.92230.1445yesN/A
A7IC65DNAK_XANP2No assigned EC number0.64510.90290.1473yesN/A
Q6NCY4DNAK_RHOPANo assigned EC number0.67010.92230.1505yesN/A
A5V5P9DNAK_SPHWWNo assigned EC number0.68600.83490.1365yesN/A
O35501GRP75_CRIGRNo assigned EC number0.81390.83490.1266yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
cd11733 377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 4e-59
PTZ00400 663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 2e-47
PRK00290 627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 7e-45
pfam00012 598 pfam00012, HSP70, Hsp70 protein 6e-41
cd10234 376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 3e-37
PTZ00186 657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 5e-35
TIGR02350 595 TIGR02350, prok_dnaK, chaperone protein DnaK 2e-33
cd11734 373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 8e-33
CHL00094 621 CHL00094, dnaK, heat shock protein 70 9e-29
PRK13410 668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 2e-28
PLN03184 673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 1e-26
PRK13411 653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 2e-26
cd10241 374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 6e-25
cd10233 376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 8e-23
cd10170 369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 3e-22
cd10228 381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 6e-21
PTZ00009 653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 2e-20
COG0443 579 COG0443, DnaK, Molecular chaperone [Posttranslatio 7e-20
cd10238 375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 7e-13
cd11739 383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 2e-12
PRK05183 616 PRK05183, hscA, chaperone protein HscA; Provisiona 2e-11
cd10237 417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 1e-10
cd11737 383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 2e-09
TIGR01991 599 TIGR01991, HscA, Fe-S protein assembly chaperone H 2e-09
cd11738 383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 2e-09
cd10230 388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 6e-09
cd10235 339 cd10235, HscC_like_NBD, Nucleotide-binding domain 2e-08
cd10236 355 cd10236, HscA_like_NBD, Nucleotide-binding domain 6e-08
cd11732 377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 2e-06
cd10232 386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 1e-05
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information 
 Score =  184 bits (470), Expect = 4e-59
 Identities = 73/97 (75%), Positives = 83/97 (85%), Gaps = 2/97 (2%)

Query: 1   MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFD 60
           MEGK  KVIEN+EG+RTTPSVVAFTKDGERLVG PA+RQAVTN  NT YATKRLIGRRFD
Sbjct: 19  MEGKTPKVIENAEGARTTPSVVAFTKDGERLVGMPAKRQAVTNPENTLYATKRLIGRRFD 78

Query: 61  DPEIKKDMKNLSYKIVRASNGDAWV--QGKNIRISEV 95
           DPE++KD+KN+ YKIV+ASNGDAWV   GK    S++
Sbjct: 79  DPEVQKDIKNVPYKIVKASNGDAWVEAHGKKYSPSQI 115

This subgroup includes human mitochondrial HSPA9 (also known as 70-kDa heat shock protein 9, CSA; MOT; MOT2; GRP75; PBP74; GRP-75; HSPA9B; MTHSP75; the gene encoding HSPA9 maps to 5q31.1), Escherichia coli DnaK, and Saccharomyces cerevisiae Stress-Seventy subfamily C/Ssc1p (also called mtHSP70, Endonuclease SceI 75 kDa subunit). It belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly, and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. Hsp70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs); for Escherichia coli DnaK, these are the DnaJ and GrpE, respectively. HSPA9 is involved in multiple processses including mitochondrial import, antigen processing, control of cellular proliferation and differentiation, and regulation of glucose responses. During glucose deprivation-induced cellular stress, HSPA9 plays an important role in the suppression of apoptosis by inhibiting a conformational change in Bax that allow the release of cytochrome c. DnaK modulates the heat shock response in Escherichia coli. It protects E. coli from protein carbonylation, an irreversible oxidative modification that increases during organism aging and bacterial growth arrest. Under severe thermal stress, it functions as part of a bi-chaperone system: the DnaK system and the ring-forming AAA+ chaperone ClpB (Hsp104) system, to promote cell survival. DnaK has also been shown to cooperate with GroEL and the ribosome-associated Escherichia coli Trigger Factor in the proper folding of cytosolic proteins. S. cerevisiae Ssc1p is the major HSP70 chaperone of the mitochondrial matrix, promoting translocation of proteins from the cytosol, across the inner membrane, to the matrix, and their subsequent folding. Ssc1p interacts with Tim44, a peripheral inner membrane protein associated with the TIM23 protein translocase. It is also a subunit of the endoSceI site-specific endoDNase and is required for full endoSceI activity. Ssc1p plays roles in the import of Yfh1p, a nucleus-encoded mitochondrial protein involved in iron homeostasis (and a homolog of human frataxin, implicated in the neurodegenerative disease, Friedreich's ataxia). Ssc1 also participates in translational regulation of cytochrome c oxidase (COX) biogenesis by interacting with Mss51 and Mss51-containing complexes. Length = 377
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 103
KOG0100|consensus 663 99.94
KOG0102|consensus 640 99.88
PTZ00400 663 DnaK-type molecular chaperone; Provisional 99.85
PRK13410 668 molecular chaperone DnaK; Provisional 99.82
PRK00290 627 dnaK molecular chaperone DnaK; Provisional 99.82
PRK13411 653 molecular chaperone DnaK; Provisional 99.79
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 99.79
PTZ00009 653 heat shock 70 kDa protein; Provisional 99.78
PLN03184 673 chloroplast Hsp70; Provisional 99.77
TIGR02350 595 prok_dnaK chaperone protein DnaK. Members of this 99.76
TIGR01991 599 HscA Fe-S protein assembly chaperone HscA. The Hea 99.75
CHL00094 621 dnaK heat shock protein 70 99.75
KOG0101|consensus 620 99.74
PRK05183 616 hscA chaperone protein HscA; Provisional 99.71
KOG0103|consensus 727 99.7
PF00012 602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 99.7
KOG0104|consensus 902 99.41
COG0443 579 DnaK Molecular chaperone [Posttranslational modifi 99.35
PRK01433 595 hscA chaperone protein HscA; Provisional 99.32
PRK11678 450 putative chaperone; Provisional 98.7
PRK13929 335 rod-share determining protein MreBH; Provisional 94.86
PRK13927 334 rod shape-determining protein MreB; Provisional 83.62
TIGR00904 333 mreB cell shape determining protein, MreB/Mrl fami 82.56
PRK13928 336 rod shape-determining protein Mbl; Provisional 80.2
>KOG0100|consensus Back     alignment and domain information 
Probab=99.94  E-value=3.9e-28  Score=180.17  Aligned_cols=93  Identities=40%  Similarity=0.705  Sum_probs=84.3

Q ss_pred             CCCCeeEEEeCCCCCcccceEEEEecCCceeeCHHHHHHHhhCCCcchhhhhhhhcccCCchHHHhhccccceeEEEcCC
Q psy3916           1 MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFDDPEIKKDMKNLSYKIVRASN   80 (103)
Q Consensus         1 ~~~~~~~ii~n~~g~r~~pS~V~f~~~~~~~vG~~A~~~~~~~p~n~i~~~KrliG~~~~d~~v~~~~~~~p~~i~~~~~   80 (103)
                      |+||.++||+|++|+|.|||+|+|+++ ++|+|++|++|+..||+|||++.||||||+|+|+.||.++++|||+++. .+
T Consensus        53 ~kNgrvEIiANdQGNRItPSyVaFt~d-erLiGdAAKNQ~~~NPenTiFD~KRLIGr~~~d~~vq~Dik~~Pfkvv~-k~  130 (663)
T KOG0100|consen   53 YKNGRVEIIANDQGNRITPSYVAFTDD-ERLIGDAAKNQLTSNPENTIFDAKRLIGRKFNDKSVQKDIKFLPFKVVN-KD  130 (663)
T ss_pred             EeCCeEEEEecCCCCccccceeeeccc-hhhhhhHhhcccccCcccceechHHHhCcccCChhhhhhhhcCceEEEc-CC
Confidence            579999999999999999999999965 9999999999999999999999999999999999999999999999994 45


Q ss_pred             CCEEEEe--C-C--eEEcce
Q psy3916          81 GDAWVQG--K-N--IRISEV   95 (103)
Q Consensus        81 g~~~~~~--~-g--~~~sp~   95 (103)
                      +++.+++  . |  +.|+|+
T Consensus       131 ~kp~i~v~v~~g~~K~FtPe  150 (663)
T KOG0100|consen  131 GKPYIQVKVGGGETKVFTPE  150 (663)
T ss_pred             CCccEEEEccCCcccccCHH
Confidence            6666664  3 3  688886

>KOG0102|consensus Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>KOG0101|consensus Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>KOG0103|consensus Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>KOG0104|consensus Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
2kho_A 605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 8e-29
1dkg_D 383 Crystal Structure Of The Nucleotide Exchange Factor 1e-28
4b9q_A 605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 3e-26
3iuc_A 408 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-15
3ldl_A 384 Crystal Structure Of Human Grp78 (70kda Heat Shock 1e-15
3gl1_A 387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 2e-15
1qqm_A 378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 4e-15
2qwn_A 394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 4e-15
2qw9_B 394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 4e-15
2bup_A 381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 4e-15
1atr_A 386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 4e-15
1bup_A 386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 4e-15
1qqo_A 378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 4e-15
3fzf_A 381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 4e-15
1yuw_A 554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 4e-15
1nga_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-15
1ngb_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-15
1ngg_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-15
1ats_A 386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 4e-15
3cqx_A 386 Chaperone Complex Length = 386 4e-15
1hpm_A 386 How Potassium Affects The Activity Of The Molecular 4e-15
1ngc_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-15
1nge_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-15
1ngd_A 386 Structural Basis Of The 70-kilodalton Heat Shock Co 4e-15
1ngf_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-15
3c7n_B 554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 4e-15
1ngh_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-15
1ba0_A 386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 4e-15
1hx1_A 400 Crystal Structure Of A Bag Domain In Complex With T 4e-15
1ba1_A 386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 4e-15
2v7z_A 543 Crystal Structure Of The 70-Kda Heat Shock Cognate 4e-15
1s3x_A 382 The Crystal Structure Of The Human Hsp70 Atpase Dom 6e-15
3a8y_A 392 Crystal Structure Of The Complex Between The Bag5 B 6e-15
3d2f_B 382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 6e-15
2e8a_A 391 Crystal Structure Of The Human Hsp70 Atpase Domain 6e-15
2e88_A 391 Crystal Structure Of The Human Hsp70 Atpase Domain 6e-15
3jxu_A 409 Crystal Structure Of The Human 70kda Heat Shock Pro 6e-15
1hjo_A 380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 7e-15
3i33_A 404 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-14
1kaz_A 381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 1e-14
3gdq_A 408 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-14
1kay_A 381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 2e-14
1kax_A 381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 2e-14
3fe1_A 403 Crystal Structure Of The Human 70kda Heat Shock Pro 2e-14
1qqn_A 378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-14
3kvg_A 400 Crystal Structure Of The N-Terminal Domain Of Hsp70 3e-14
3d2e_B 382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 5e-14
4fsv_A 387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 8e-14
3qfp_A 390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 1e-13
3qfu_A 394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 1e-13
2v7y_A 509 Crystal Structure Of The Molecular Chaperone Dnak F 8e-12
3c7n_A 668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 2e-04
2qxl_A 658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 2e-04
3d2f_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 2e-04
3d2e_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 2e-04
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (304), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 73/93 (78%)
Query: 1   MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFD 60
           M+G   +V+EN+EG RTTPS++A+T+DGE LVG PA+RQAVTN  NT +A KRLIGRRF 
Sbjct: 19  MDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQ 78
Query: 61  DPEIKKDMKNLSYKIVRASNGDAWVQGKNIRIS 93
           D E+++D+  + +KI+ A NGDAWV+ K  +++
Sbjct: 79  DEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMA 111
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
1dkg_D 383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 1e-54
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 1e-50
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 1e-39
3qfu_A 394 78 kDa glucose-regulated protein homolog; HSP70, K 3e-39
3i33_A 404 Heat shock-related 70 kDa protein 2; protein-ADP c 2e-38
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 3e-36
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 9e-30
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
 Score =  173 bits (440), Expect = 1e-54
 Identities = 52/97 (53%), Positives = 74/97 (76%), Gaps = 2/97 (2%)

Query: 1   MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFD 60
           M+G   +V+EN+EG RTTPS++A+T+DGE LVG PA+RQAVTN  NT +A KRLIGRRF 
Sbjct: 19  MDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQ 78

Query: 61  DPEIKKDMKNLSYKIVRASNGDAWVQ--GKNIRISEV 95
           D E+++D+  + +KI+ A NGDAWV+  G+ +   ++
Sbjct: 79  DEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQI 115
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 99.81
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 99.79
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 99.77
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 99.75
1dkg_D 383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 99.71
3i33_A 404 Heat shock-related 70 kDa protein 2; protein-ADP c 99.67
3qfu_A 394 78 kDa glucose-regulated protein homolog; HSP70, K 99.66
4gni_A 409 Putative heat shock protein; HSP70-type ATPase, AT 99.37
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 99.19
1jce_A 344 ROD shape-determining protein MREB; MBL, actin, HS 92.48
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
Probab=99.81  E-value=3.3e-20  Score=143.33  Aligned_cols=95  Identities=54%  Similarity=0.938  Sum_probs=89.0

Q ss_pred             CCCCeeEEEeCCCCCcccceEEEEecCCceeeCHHHHHHHhhCCCcchhhhhhhhcccCCchHHHhhccccceeEEEcCC
Q psy3916           1 MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFDDPEIKKDMKNLSYKIVRASN   80 (103)
Q Consensus         1 ~~~~~~~ii~n~~g~r~~pS~V~f~~~~~~~vG~~A~~~~~~~p~n~i~~~KrliG~~~~d~~v~~~~~~~p~~i~~~~~   80 (103)
                      |++|++++++|..|++++||+|+|++++++++|..|++++..+|.|+++++|||||++|+|+.++...+.+||+++...+
T Consensus        19 ~~~g~~~ii~n~~g~~~~PS~V~~~~~~~~~vG~~A~~~~~~~p~~ti~~~KrllG~~~~d~~v~~~~~~~p~~~~~~~~   98 (605)
T 4b9q_A           19 MDGTTPRVLENAEGDRTTPSIIAYTQDGCTLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADN   98 (605)
T ss_dssp             EETTEEEECCCTTSCSSEECCEEECTTSCEEESHHHHHTTTTCGGGEECCGGGTTTCBTTSHHHHHHHTTCSSEEEECTT
T ss_pred             EECCEEEEEECCCCCcccceEEEEeCCCcEEecHHHHHHHHhCCCcEehhhHHhhCCCCCCHHHHHHhhcCCeEEEEcCC
Confidence            36789999999999999999999987779999999999999999999999999999999999999999999999999889


Q ss_pred             CCEEEEeCCeEEcce
Q psy3916          81 GDAWVQGKNIRISEV   95 (103)
Q Consensus        81 g~~~~~~~g~~~sp~   95 (103)
                      |.+.+.++|+.|+|+
T Consensus        99 g~~~~~~~~~~~~p~  113 (605)
T 4b9q_A           99 GDAWVEVKGQKMAPP  113 (605)
T ss_dssp             SBEEEEETTEEECHH
T ss_pred             CceEEEECCEEECHH
Confidence            999999988888875
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 103
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 3e-30
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 9e-23
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Escherichia coli, gene dnaK [TaxId: 562]

 Score =  103 bits (259), Expect = 3e-30
 Identities = 52/93 (55%), Positives = 73/93 (78%)

Query: 1   MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFD 60
           M+G   +V+EN+EG RTTPS++A+T+DGE LVG PA+RQAVTN  NT +A KRLIGRRF 
Sbjct: 17  MDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQ 76

Query: 61  DPEIKKDMKNLSYKIVRASNGDAWVQGKNIRIS 93
           D E+++D+  + +KI+ A NGDAWV+ K  +++
Sbjct: 77  DEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMA 109
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 99.84
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.72
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 90.65
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 88.84
d2nn6g380 Ribosomal RNA-processing protein 40, RRP40 {Human 87.99
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Escherichia coli, gene dnaK [TaxId: 562]

Probab=99.84  E-value=1.8e-21  Score=129.01  Aligned_cols=95  Identities=55%  Similarity=0.961  Sum_probs=88.8

Q ss_pred             CCCCeeEEEeCCCCCcccceEEEEecCCceeeCHHHHHHHhhCCCcchhhhhhhhcccCCchHHHhhccccceeEEEcCC
Q psy3916           1 MEGKQAKVIENSEGSRTTPSVVAFTKDGERLVGTPARRQAVTNSANTFYATKRLIGRRFDDPEIKKDMKNLSYKIVRASN   80 (103)
Q Consensus         1 ~~~~~~~ii~n~~g~r~~pS~V~f~~~~~~~vG~~A~~~~~~~p~n~i~~~KrliG~~~~d~~v~~~~~~~p~~i~~~~~   80 (103)
                      |+++++++++|++|++.+||+|+|..++++++|..|+++..++|.++++++|||||+++.|+.++...+.+||+++..++
T Consensus        17 ~~~~~~~ii~n~~~~~~~ps~v~~~~~~~~~~G~~A~~~~~~~p~~~i~~~KrllG~~~~~~~~~~~~~~~~~~~~~~~~   96 (183)
T d1dkgd1          17 MDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADN   96 (183)
T ss_dssp             EETTEEEECCCTTSCSEEECEEEECTTSCEEESHHHHTTSTTCGGGEEECGGGTTTCBSCSHHHHHHTTTCSSEEEECSS
T ss_pred             EECCEEEEEEcCCCcccccceeeecCCCCEEccHHHHHhhhcCCccEEeeeHHHcCCCCCcHHHHhhhhcCCEEEEEcCC
Confidence            46789999999999999999999987779999999999999999999999999999999999999888899999999899


Q ss_pred             CCEEEEeCCeEEcce
Q psy3916          81 GDAWVQGKNIRISEV   95 (103)
Q Consensus        81 g~~~~~~~g~~~sp~   95 (103)
                      |.+.+++.|+.|+|+
T Consensus        97 ~~~~~~~~~~~~s~~  111 (183)
T d1dkgd1          97 GDAWVEVKGQKMAPP  111 (183)
T ss_dssp             SBEEEEETTEEECHH
T ss_pred             CcEEEEECCEEECHH
Confidence            999999999988875
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nn6g3 d.51.1.1 (G:195-274) Ribosomal RNA-processing protein 40, RRP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure