Psyllid ID: psy3969
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 86 | ||||||
| 328778804 | 192 | PREDICTED: SH3 domain-binding glutamic a | 0.813 | 0.364 | 0.68 | 5e-20 | |
| 380030088 | 192 | PREDICTED: LOW QUALITY PROTEIN: SH3 doma | 0.813 | 0.364 | 0.68 | 6e-20 | |
| 322785851 | 187 | hypothetical protein SINV_09128 [Solenop | 0.790 | 0.363 | 0.649 | 1e-19 | |
| 307189893 | 194 | SH3 domain-binding glutamic acid-rich pr | 0.790 | 0.350 | 0.636 | 1e-19 | |
| 383865227 | 189 | PREDICTED: SH3 domain-binding glutamic a | 0.813 | 0.370 | 0.666 | 1e-19 | |
| 195125631 | 154 | GI12464 [Drosophila mojavensis] gi|19391 | 0.837 | 0.467 | 0.666 | 2e-19 | |
| 357617197 | 248 | hypothetical protein KGM_15044 [Danaus p | 0.848 | 0.294 | 0.636 | 2e-19 | |
| 307204328 | 183 | SH3 domain-binding glutamic acid-rich pr | 0.720 | 0.338 | 0.690 | 3e-19 | |
| 195441050 | 453 | GK25310 [Drosophila willistoni] gi|19416 | 0.837 | 0.158 | 0.628 | 5e-19 | |
| 195492539 | 473 | GE20417 [Drosophila yakuba] gi|194180136 | 0.837 | 0.152 | 0.615 | 8e-19 |
| >gi|328778804|ref|XP_624305.2| PREDICTED: SH3 domain-binding glutamic acid-rich protein homolog [Apis mellifera] | Back alignment and taxonomy information |
|---|
Score = 101 bits (252), Expect = 5e-20, Method: Compositional matrix adjust.
Identities = 51/75 (68%), Positives = 56/75 (74%), Gaps = 5/75 (6%)
Query: 11 VRGVKGVKKRQQRVLMILDSKNIDYTVIDITEPGKENEKEFMQQNSKATPSDSTVKSNPL 70
+ G K VKKRQQRVLMILDSKN++Y IDITEPGKE EKEFMQ NS A S PL
Sbjct: 10 ISGNKEVKKRQQRVLMILDSKNVEYETIDITEPGKEMEKEFMQANSIARES-----KYPL 64
Query: 71 PPQIFNEEDYCGVFR 85
PPQIFNEE+YCG +
Sbjct: 65 PPQIFNEEEYCGDYE 79
|
Source: Apis mellifera Species: Apis mellifera Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380030088|ref|XP_003698690.1| PREDICTED: LOW QUALITY PROTEIN: SH3 domain-binding glutamic acid-rich protein homolog [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|322785851|gb|EFZ12470.1| hypothetical protein SINV_09128 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307189893|gb|EFN74137.1| SH3 domain-binding glutamic acid-rich protein-like protein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383865227|ref|XP_003708076.1| PREDICTED: SH3 domain-binding glutamic acid-rich protein homolog [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|195125631|ref|XP_002007281.1| GI12464 [Drosophila mojavensis] gi|193918890|gb|EDW17757.1| GI12464 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|357617197|gb|EHJ70645.1| hypothetical protein KGM_15044 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|307204328|gb|EFN83083.1| SH3 domain-binding glutamic acid-rich protein-like protein [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|195441050|ref|XP_002068344.1| GK25310 [Drosophila willistoni] gi|194164429|gb|EDW79330.1| GK25310 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195492539|ref|XP_002094035.1| GE20417 [Drosophila yakuba] gi|194180136|gb|EDW93747.1| GE20417 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 86 | ||||||
| FB|FBgn0035772 | 158 | Sh3beta "Sh3beta" [Drosophila | 0.790 | 0.430 | 0.635 | 3.1e-19 | |
| UNIPROTKB|E1BZG8 | 135 | SH3BGR "Uncharacterized protei | 0.813 | 0.518 | 0.407 | 5.2e-10 | |
| UNIPROTKB|A4IFC4 | 107 | SH3BGRL2 "SH3 domain-binding g | 0.767 | 0.616 | 0.385 | 6.6e-10 | |
| MGI|MGI:1354740 | 214 | Sh3bgr "SH3-binding domain glu | 0.813 | 0.327 | 0.394 | 8.4e-10 | |
| RGD|1563599 | 213 | Sh3bgr "SH3 domain binding glu | 0.813 | 0.328 | 0.394 | 8.4e-10 | |
| UNIPROTKB|E1BVU4 | 78 | SH3BGR "Uncharacterized protei | 0.790 | 0.871 | 0.405 | 1.1e-09 | |
| UNIPROTKB|F1MR08 | 107 | F1MR08 "SH3 domain-binding glu | 0.720 | 0.579 | 0.393 | 1.4e-09 | |
| UNIPROTKB|F1MRQ7 | 208 | SH3BGR "Uncharacterized protei | 0.813 | 0.336 | 0.394 | 1.4e-09 | |
| UNIPROTKB|P55822 | 239 | SH3BGR "SH3 domain-binding glu | 0.813 | 0.292 | 0.394 | 1.6e-09 | |
| UNIPROTKB|I3LEV7 | 205 | SH3BGR "Uncharacterized protei | 0.813 | 0.341 | 0.394 | 1.8e-09 |
| FB|FBgn0035772 Sh3beta "Sh3beta" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 230 (86.0 bits), Expect = 3.1e-19, P = 3.1e-19
Identities = 47/74 (63%), Positives = 57/74 (77%)
Query: 13 GVKGVKKRQQRVLMILDSKNIDYTVIDITEPGKENEKEFMQQNSKATPSDSTVKS----N 68
G K VKKRQQRVLMILDSKNI Y +DITEPGKE+EKE MQ +K+T + TV +
Sbjct: 12 GNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQ--NKSTSNGGTVSDPEPRH 69
Query: 69 PLPPQIFNEEDYCG 82
PLPPQ+FN+++YCG
Sbjct: 70 PLPPQLFNDDEYCG 83
|
|
| UNIPROTKB|E1BZG8 SH3BGR "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4IFC4 SH3BGRL2 "SH3 domain-binding glutamic acid-rich-like protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1354740 Sh3bgr "SH3-binding domain glutamic acid-rich protein" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1563599 Sh3bgr "SH3 domain binding glutamic acid-rich protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVU4 SH3BGR "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MR08 F1MR08 "SH3 domain-binding glutamic acid-rich-like protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MRQ7 SH3BGR "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P55822 SH3BGR "SH3 domain-binding glutamic acid-rich protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LEV7 SH3BGR "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 86 | |||
| cd03030 | 92 | cd03030, GRX_SH3BGR, Glutaredoxin (GRX) family, SH | 3e-21 | |
| pfam04908 | 92 | pfam04908, SH3BGR, SH3-binding, glutamic acid-rich | 6e-20 | |
| cd02066 | 72 | cd02066, GRX_family, Glutaredoxin (GRX) family; co | 1e-10 |
| >gnl|CDD|239328 cd03030, GRX_SH3BGR, Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
Score = 79.2 bits (196), Expect = 3e-21
Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 8/73 (10%)
Query: 10 TVRGVKGVKKRQQRVLMILDSKNIDYTVIDITEPGKENEKEFMQQNSKATPSDSTVKSNP 69
+ G +KKRQQ VL L++K I++ +DI+ E +++M++N P
Sbjct: 8 SSSGSTEIKKRQQEVLGFLEAKKIEFEEVDISM--NEENRQWMRENVPNE------NGKP 59
Query: 70 LPPQIFNEEDYCG 82
LPPQIFN ++YCG
Sbjct: 60 LPPQIFNGDEYCG 72
|
The SH3BGR gene was cloned in an effort to identify genes mapping to chromosome 21, which could be involved in the pathogenesis of congenital heart disease affecting Down syndrome newborns. Several human SH3BGR-like (SH3BGRL) genes have been identified since, mapping to different locations in the chromosome. Of these, SH3BGRL3 was identified as a tumor necrosis factor (TNF) alpha inhibitory protein and was also named TIP-B1. Upregulation of expression of SH3BGRL3 is associated with differentiation. It has been suggested that it functions as a regulator of differentiation-related signal transduction pathways. Length = 92 |
| >gnl|CDD|218321 pfam04908, SH3BGR, SH3-binding, glutamic acid-rich protein | Back alignment and domain information |
|---|
| >gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 86 | |||
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 99.98 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 99.97 | |
| KOG4023|consensus | 108 | 99.9 | ||
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 99.84 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 99.8 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 99.78 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 99.78 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 99.77 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 99.77 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 99.76 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 99.75 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 99.75 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 99.75 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 99.73 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 99.72 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 99.71 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 99.68 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 99.66 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 99.64 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 99.63 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 99.63 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.63 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 99.54 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 99.53 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 99.52 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 99.49 | |
| KOG1752|consensus | 104 | 99.39 | ||
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 99.27 | |
| KOG2824|consensus | 281 | 99.21 | ||
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 99.2 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 99.19 | |
| KOG0911|consensus | 227 | 99.03 | ||
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 99.01 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 98.83 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 98.45 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 98.39 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 98.38 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 98.29 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 98.27 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 98.2 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 98.16 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 98.14 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 98.07 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 98.05 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 97.95 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 97.9 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 97.87 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 97.83 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 97.82 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 97.76 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 97.74 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 97.7 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 97.68 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 97.61 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 97.57 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 97.56 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 97.53 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 97.49 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 97.45 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 97.45 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 97.43 | |
| PRK10853 | 118 | putative reductase; Provisional | 97.27 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 97.21 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 97.2 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 97.04 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 96.99 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 96.98 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 96.96 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 96.96 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 96.89 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 96.88 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 96.8 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 96.67 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 96.67 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 96.67 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 96.66 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 96.52 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 96.5 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 96.34 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 96.29 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 96.1 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 96.0 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 95.94 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 95.91 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 95.88 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 95.74 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 95.59 | |
| PHA02125 | 75 | thioredoxin-like protein | 95.52 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 95.44 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 95.44 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 95.22 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 94.7 | |
| PLN02395 | 215 | glutathione S-transferase | 94.32 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 94.08 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 93.97 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 93.91 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 93.91 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 92.95 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 92.94 | |
| PLN02473 | 214 | glutathione S-transferase | 92.85 | |
| PRK05568 | 142 | flavodoxin; Provisional | 92.82 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 92.78 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 92.54 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 92.11 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 91.48 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 90.61 | |
| PRK07308 | 146 | flavodoxin; Validated | 90.61 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 90.17 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 89.93 | |
| PF06953 | 123 | ArsD: Arsenical resistance operon trans-acting rep | 89.31 | |
| PRK05569 | 141 | flavodoxin; Provisional | 88.57 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 88.13 | |
| PRK06756 | 148 | flavodoxin; Provisional | 87.65 | |
| PRK09004 | 146 | FMN-binding protein MioC; Provisional | 86.61 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 86.55 | |
| COG0716 | 151 | FldA Flavodoxins [Energy production and conversion | 85.93 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 85.64 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 85.57 | |
| PRK08105 | 149 | flavodoxin; Provisional | 85.29 | |
| TIGR00333 | 125 | nrdI ribonucleoside-diphosphate reductase 2, opero | 84.84 | |
| TIGR00147 | 293 | lipid kinase, YegS/Rv2252/BmrU family. The E. coli | 84.02 | |
| COG4837 | 106 | Uncharacterized protein conserved in bacteria [Fun | 83.7 | |
| KOG0406|consensus | 231 | 82.59 | ||
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 82.22 | |
| PRK06703 | 151 | flavodoxin; Provisional | 82.16 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 82.06 | |
| PF09822 | 271 | ABC_transp_aux: ABC-type uncharacterized transport | 81.95 | |
| PF07315 | 93 | DUF1462: Protein of unknown function (DUF1462); In | 81.55 | |
| PRK11914 | 306 | diacylglycerol kinase; Reviewed | 81.29 | |
| PF00258 | 143 | Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This | 81.15 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 80.99 | |
| PRK10629 | 127 | EnvZ/OmpR regulon moderator; Provisional | 80.43 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 80.33 | |
| PRK03767 | 200 | NAD(P)H:quinone oxidoreductase; Provisional | 80.2 | |
| cd02978 | 72 | KaiB_like KaiB-like family; composed of the circad | 80.18 | |
| KOG4244|consensus | 281 | 80.05 | ||
| PRK13337 | 304 | putative lipid kinase; Reviewed | 80.04 |
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
Probab=99.98 E-value=1.4e-32 Score=179.65 Aligned_cols=75 Identities=36% Similarity=0.679 Sum_probs=69.8
Q ss_pred cEEEEEcccCchhchHHHHHHHHHHHhCCCceEEEEccCCCCHhHHHHHHHhcCCCCCCCCCCCCCCCCeEEeCCeeeec
Q psy3969 4 PYKISNTVRGVKGVKKRQQRVLMILDSKNIDYTVIDITEPGKENEKEFMQQNSKATPSDSTVKSNPLPPQIFNEEDYCGV 83 (86)
Q Consensus 4 ~~~y~ss~sgn~~vK~~q~~a~~lL~~k~I~f~eiDI~~~~d~~~r~~M~~~~g~~~~~~~~~~~~tvPQIFigd~yiGg 83 (86)
+.||+||+||++++|++|+++++||+++||+|++|||+ .|++.|++|++++| ++ ++++|||||||||+||||
T Consensus 2 i~vY~ts~~g~~~~k~~~~~v~~lL~~k~I~f~eiDI~--~d~~~r~em~~~~~--~~----~g~~tvPQIFi~~~~iGg 73 (92)
T cd03030 2 IKVYIASSSGSTEIKKRQQEVLGFLEAKKIEFEEVDIS--MNEENRQWMRENVP--NE----NGKPLPPQIFNGDEYCGD 73 (92)
T ss_pred EEEEEecccccHHHHHHHHHHHHHHHHCCCceEEEecC--CCHHHHHHHHHhcC--CC----CCCCCCCEEEECCEEeeC
Confidence 67999999999999999999999999999999999999 89999999999997 22 256799999999999999
Q ss_pred cCC
Q psy3969 84 FRY 86 (86)
Q Consensus 84 yd~ 86 (86)
|||
T Consensus 74 ~dd 76 (92)
T cd03030 74 YEA 76 (92)
T ss_pred HHH
Confidence 986
|
The SH3BGR gene was cloned in an effort to identify genes mapping to chromosome 21, which could be involved in the pathogenesis of congenital heart disease affecting Down syndrome newborns. Several human SH3BGR-like (SH3BGRL) genes have been identified since, mapping to different locations in the chromosome. Of these, SH3BGRL3 was identified as a tumor necrosis factor (TNF) alpha inhibitory protein and was also named TIP-B1. Upregulation of expression of SH3BGRL3 is associated with differentiation. It has been suggested that it functions as a regulator of differentiation-related signal transduction pathways. |
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG4023|consensus | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >KOG1752|consensus | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >KOG2824|consensus | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0911|consensus | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK05568 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >PRK07308 flavodoxin; Validated | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >PF06953 ArsD: Arsenical resistance operon trans-acting repressor ArsD; InterPro: IPR010712 This family consists of several bacterial arsenical resistance operon trans-acting repressor ArsD proteins | Back alignment and domain information |
|---|
| >PRK05569 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK06756 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >PRK09004 FMN-binding protein MioC; Provisional | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >COG0716 FldA Flavodoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08105 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR00333 nrdI ribonucleoside-diphosphate reductase 2, operon protein nrdI | Back alignment and domain information |
|---|
| >TIGR00147 lipid kinase, YegS/Rv2252/BmrU family | Back alignment and domain information |
|---|
| >COG4837 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >PRK06703 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >PF09822 ABC_transp_aux: ABC-type uncharacterized transport system; InterPro: IPR019196 This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins | Back alignment and domain information |
|---|
| >PF07315 DUF1462: Protein of unknown function (DUF1462); InterPro: IPR009190 There are currently no experimental data for members of this group of bacterial proteins or their homologues | Back alignment and domain information |
|---|
| >PRK11914 diacylglycerol kinase; Reviewed | Back alignment and domain information |
|---|
| >PF00258 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This domain is found in a number of proteins including flavodoxin and nitric-oxide synthase | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10629 EnvZ/OmpR regulon moderator; Provisional | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03767 NAD(P)H:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA | Back alignment and domain information |
|---|
| >KOG4244|consensus | Back alignment and domain information |
|---|
| >PRK13337 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 86 | ||||
| 2ct6_A | 111 | Solution Structure Of The Sh3 Domain-Binding Glutam | 2e-08 | ||
| 1u6t_A | 121 | Crystal Structure Of The Human Sh3 Binding Glutamic | 1e-05 | ||
| 1sj6_A | 101 | Nmr Structure And Regulated Expression In Apl Cell | 1e-05 | ||
| 1wry_A | 121 | Solution Structure Of The Sh3 Domain-Binding Glutam | 1e-05 | ||
| 1j0f_A | 100 | Solution Structure Of The Sh3 Domain Binding Glutam | 2e-05 | ||
| 1t1v_A | 93 | Crystal Structure Of The Glutaredoxin-Like Protein | 2e-05 |
| >pdb|2CT6|A Chain A, Solution Structure Of The Sh3 Domain-Binding Glutamic Acid- Rich-Like Protein 2 Length = 111 | Back alignment and structure |
|
| >pdb|1U6T|A Chain A, Crystal Structure Of The Human Sh3 Binding Glutamic-Rich Protein Like Length = 121 | Back alignment and structure |
| >pdb|1SJ6|A Chain A, Nmr Structure And Regulated Expression In Apl Cell Of Human Sh3bgrl3 Length = 101 | Back alignment and structure |
| >pdb|1WRY|A Chain A, Solution Structure Of The Sh3 Domain-Binding Glutamic Acid- Rich-Like Protein Length = 121 | Back alignment and structure |
| >pdb|1J0F|A Chain A, Solution Structure Of The Sh3 Domain Binding Glutamic Acid- Rich Protein Like 3 Length = 100 | Back alignment and structure |
| >pdb|1T1V|A Chain A, Crystal Structure Of The Glutaredoxin-Like Protein Sh3bgrl3 At 1.6 A Resolution Length = 93 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 86 | |||
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 5e-17 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 8e-17 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 1e-13 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 1e-04 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 4e-04 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 4e-04 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 8e-04 |
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
Score = 68.8 bits (168), Expect = 5e-17
Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 4/73 (5%)
Query: 10 TVRGVKGVKKRQQRVLMILDSKNIDYTVIDITEPGKENEKEFMQQNSKATPSDSTVKSNP 69
+ G +KK+QQ V+ L++ I++ +DIT E ++++M +N + NP
Sbjct: 16 SSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMS--EEQRQWMYKNVPPEKKPTQ--GNP 71
Query: 70 LPPQIFNEEDYCG 82
LPPQIFN + YCG
Sbjct: 72 LPPQIFNGDRYCG 84
|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Length = 121 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Length = 93 | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Length = 89 | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Length = 87 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Length = 92 | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 86 | |||
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 99.96 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 99.92 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 99.87 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 99.82 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 99.77 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 99.77 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 99.76 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 99.76 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 99.75 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 99.75 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 99.73 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 99.73 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 99.72 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 99.71 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 99.69 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 99.68 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 99.66 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 99.64 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 99.62 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.61 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 99.58 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 99.56 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 99.55 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 99.53 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.52 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 99.51 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 99.5 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 99.49 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 99.49 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 99.43 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 99.43 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 99.4 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 99.38 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 99.38 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 99.33 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 99.02 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 98.89 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 98.86 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 98.85 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 98.84 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 98.78 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 98.62 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 98.57 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 98.47 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 98.43 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 98.41 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 98.23 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 98.12 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 98.03 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 98.03 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 98.02 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 97.57 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 97.55 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 97.51 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 97.49 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 97.46 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 97.46 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 97.46 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 97.44 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 97.4 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 97.38 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 97.33 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 97.32 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 97.32 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 97.32 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 97.31 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 97.3 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 97.29 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 97.23 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 97.22 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 97.22 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 97.19 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 97.16 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 97.11 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 97.09 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 97.08 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 97.06 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 97.06 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 97.01 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 97.01 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 97.0 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 96.98 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 96.96 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 96.95 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 96.92 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 96.92 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 96.91 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 96.91 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 96.91 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 96.9 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 96.88 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 96.85 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 96.84 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 96.84 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 96.8 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 96.8 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 96.8 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 96.78 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 96.77 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 96.75 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 96.73 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 96.72 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 96.7 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 96.66 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 96.66 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 96.65 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 96.63 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 96.61 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 96.61 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 96.61 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 96.6 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 96.59 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 96.56 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 96.54 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 96.54 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 96.53 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 96.48 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 96.41 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 96.41 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 96.39 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 96.32 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 96.32 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 96.26 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 96.25 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 96.24 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 96.14 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 96.1 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 96.05 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 96.02 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 95.96 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 95.93 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 95.92 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 95.91 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 95.9 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 95.89 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 95.79 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 95.78 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 95.75 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 95.7 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 95.67 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 95.57 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 95.56 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 95.45 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 95.43 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 95.43 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 95.21 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 95.2 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 94.2 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 94.14 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 94.13 | |
| 3f6r_A | 148 | Flavodoxin; FMN binding, oxidized, electron transp | 94.0 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 93.61 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 93.07 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 92.14 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 91.99 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 91.56 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 91.1 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 90.94 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 90.87 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 90.85 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 90.81 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 90.5 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 90.37 | |
| 3ktb_A | 106 | Arsenical resistance operon trans-acting represso; | 90.2 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 89.86 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 89.8 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 89.49 | |
| 3kgk_A | 110 | Arsenical resistance operon trans-acting represso; | 89.46 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 89.01 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 88.86 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 88.73 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 88.67 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 88.67 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 88.6 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 88.39 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 87.79 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 87.51 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 87.49 | |
| 3hly_A | 161 | Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein | 87.46 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 87.45 | |
| 1ykg_A | 167 | SIR-FP, sulfite reductase [NADPH] flavoprotein alp | 87.02 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 86.91 | |
| 2hna_A | 147 | Protein MIOC, flavodoxin; alpha-beta sandwich, fla | 86.82 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 86.78 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 86.78 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 86.56 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 86.37 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 86.03 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 85.99 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 85.86 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 85.11 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 85.1 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 84.87 | |
| 3fni_A | 159 | Putative diflavin flavoprotein A 3; alpha-beta pro | 84.86 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 84.79 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 84.65 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 84.61 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 83.37 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 83.19 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 83.15 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 82.99 | |
| 2a5l_A | 200 | Trp repressor binding protein WRBA; APC5760, PA094 | 82.97 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 82.87 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 82.86 | |
| 5nul_A | 138 | Flavodoxin; electron transport, flavoprotein, FMN; | 82.72 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 81.97 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 81.96 | |
| 1f4p_A | 147 | Flavodoxin; electron transport, flavoprotein, FMN, | 81.73 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 81.41 | |
| 1bvy_F | 191 | Protein (cytochrome P450 BM-3); fatty acid monooxy | 81.33 | |
| 3s40_A | 304 | Diacylglycerol kinase; structural genomics, the ce | 81.1 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 81.07 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 80.9 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 80.48 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 80.28 |
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
Probab=99.96 E-value=6.9e-30 Score=173.37 Aligned_cols=79 Identities=32% Similarity=0.539 Sum_probs=69.4
Q ss_pred cEEEEEcccCchhchHHHHHHHHHHHhCCCceEEEEccCCCCHhHHHHHHHhcCCCCCCCCCCCCCCCCeEEeCCeeeec
Q psy3969 4 PYKISNTVRGVKGVKKRQQRVLMILDSKNIDYTVIDITEPGKENEKEFMQQNSKATPSDSTVKSNPLPPQIFNEEDYCGV 83 (86)
Q Consensus 4 ~~~y~ss~sgn~~vK~~q~~a~~lL~~k~I~f~eiDI~~~~d~~~r~~M~~~~g~~~~~~~~~~~~tvPQIFigd~yiGg 83 (86)
+.||+||.|++++||++|++|++||+++||+|++|||+ .|+++|++|+++++.++++ .+|.+|||||||||+||||
T Consensus 2 V~vYtt~~c~~c~~kk~c~~aK~lL~~kgV~feEidI~--~d~~~r~eM~~~~~~~~~~--~~G~~tvPQIFi~~~~iGG 77 (121)
T 1u6t_A 2 IRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIA--ANEENRKWMRENVPENSRP--ATGYPLPPQIFNESQYRGD 77 (121)
T ss_dssp EEEEECTTCSCHHHHHHHHHHHHHHHHTTCCEEEEECT--TCHHHHHHHHHHSCGGGSC--SSSSCCSCEEEETTEEEEE
T ss_pred EEEEecCCCCCccchHHHHHHHHHHHHCCCceEEEECC--CCHHHHHHHHHhccccccc--cCCCcCCCEEEECCEEEec
Confidence 68999999999999999999999999999999999999 8999999999999421111 1245699999999999999
Q ss_pred cCC
Q psy3969 84 FRY 86 (86)
Q Consensus 84 yd~ 86 (86)
|||
T Consensus 78 ~Dd 80 (121)
T 1u6t_A 78 YDA 80 (121)
T ss_dssp HHH
T ss_pred hHH
Confidence 984
|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} SCOP: c.23.5.0 PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A* | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kgk_A Arsenical resistance operon trans-acting represso; alpha+beta, chaperone, DNA-binding, RE transcription, transcription regulation; 1.40A {Escherichia coli} PDB: 3mwh_A | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >1ykg_A SIR-FP, sulfite reductase [NADPH] flavoprotein alpha- component; electron transport; HET: FMN; NMR {Escherichia coli} SCOP: c.23.5.2 | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >2hna_A Protein MIOC, flavodoxin; alpha-beta sandwich, flavodoxin fold, electron transport; NMR {Escherichia coli} PDB: 2hnb_A | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1f4p_A Flavodoxin; electron transport, flavoprotein, FMN, 3D-STRCTURE, anisotropic refinement, redox protein; HET: FMN; 1.30A {Desulfovibrio vulgaris} SCOP: c.23.5.1 PDB: 1bu5_A* 1c7f_A* 1c7e_A* 1akr_A* 1fx1_A* 1akt_A* 1akq_A* 1aku_A* 1akv_A* 1azl_A* 1j8q_A* 2fx2_A* 3fx2_A* 4fx2_A* 5fx2_A* 1akw_A* 1i1o_A* 1wsw_A* 1wsb_A* 1xyv_A* ... | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1bvy_F Protein (cytochrome P450 BM-3); fatty acid monooxygenase, hemoprotein, flavoprotein, electron transfer, oxidoreductase; HET: HEM FMN; 2.03A {Bacillus megaterium} SCOP: c.23.5.1 | Back alignment and structure |
|---|
| >3s40_A Diacylglycerol kinase; structural genomics, the center for structural genomics of infectious diseases, csgid, transfer; 2.10A {Bacillus anthracis} PDB: 3t5p_A | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 86 | ||||
| d1t1va_ | 93 | c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [Tax | 6e-11 |
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: SH3BGR (SH3-binding, glutamic acid-rich protein-like) domain: SH3BGRL3 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 51.4 bits (123), Expect = 6e-11
Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 10/73 (13%)
Query: 10 TVRGVKGVKKRQQRVLMILDSKNIDYTVIDITEPGKENEKEFMQQNSKATPSDSTVKSNP 69
+V G + +K +Q V ILD K I Y ++DI++ ++ +
Sbjct: 10 SVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPK----------A 59
Query: 70 LPPQIFNEEDYCG 82
PPQI N YCG
Sbjct: 60 TPPQIVNGNHYCG 72
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 86 | |||
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.96 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.85 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 99.81 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 99.78 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 99.77 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.77 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 99.77 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 99.75 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 99.72 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 98.56 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 98.05 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 97.91 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 97.79 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 97.77 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 97.72 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 97.69 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 97.68 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 97.6 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 97.51 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 97.5 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 97.42 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 97.41 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 97.41 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 97.38 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 97.31 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 97.27 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 97.17 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 97.14 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 97.13 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 97.12 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 97.09 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 97.08 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 97.05 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 96.88 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 96.87 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 96.72 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 96.59 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 96.3 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 96.3 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 96.15 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 96.09 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 95.86 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 95.72 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 95.62 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 95.28 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 94.66 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 93.52 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 92.91 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 91.8 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 90.06 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 89.51 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 89.25 | |
| d1ycga1 | 149 | Nitric oxide reductase C-terminal domain {Moorella | 89.04 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 87.68 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 87.52 | |
| d1e5da1 | 152 | Rubredoxin oxygen:oxidoreductase (ROO), C-terminal | 85.47 | |
| d1vmea1 | 148 | ROO-like flavoprotein TM0755, C-terminal domain {T | 81.46 | |
| d1f4pa_ | 147 | Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} | 80.67 | |
| d1ja1a2 | 177 | NADPH-cytochrome p450 reductase, N-terminal domain | 80.49 | |
| d2fz5a1 | 137 | Flavodoxin {Megasphaera elsdenii [TaxId: 907]} | 80.33 |
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: SH3BGR (SH3-binding, glutamic acid-rich protein-like) domain: SH3BGRL3 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.96 E-value=1.5e-30 Score=165.27 Aligned_cols=76 Identities=32% Similarity=0.545 Sum_probs=71.8
Q ss_pred CCCcEEEEEcccCchhchHHHHHHHHHHHhCCCceEEEEccCCCCHhHHHHHHHhcCCCCCCCCCCCCCCCCeEEeCCee
Q psy3969 1 MKKPYKISNTVRGVKGVKKRQQRVLMILDSKNIDYTVIDITEPGKENEKEFMQQNSKATPSDSTVKSNPLPPQIFNEEDY 80 (86)
Q Consensus 1 ~~~~~~y~ss~sgn~~vK~~q~~a~~lL~~k~I~f~eiDI~~~~d~~~r~~M~~~~g~~~~~~~~~~~~tvPQIFigd~y 80 (86)
|..+.||+||+|||++++++|+||++||+++||+|++|||+ .|++.|++|++++|. +.+||||||+||+|
T Consensus 1 m~~i~vy~ts~~~~~~~~~~~~r~~~lL~~~~I~y~~iDi~--~d~~~~~~~~~~~g~--------~~~t~Pqifv~~~~ 70 (93)
T d1t1va_ 1 MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDIS--QDNALRDEMRTLAGN--------PKATPPQIVNGNHY 70 (93)
T ss_dssp CCCEEEEECSSCSCHHHHHHHHHHHHHHHHTTCCCEEEETT--SCHHHHHHHHHHTTC--------TTCCSCEEEETTEE
T ss_pred CCCEEEEEccCcCChhhHHHHHHHHHHHHHCCCceEEEEec--CchhHHHHHHHhccC--------CCceeEEEEECCEE
Confidence 88999999999999999999999999999999999999999 899999999999972 34699999999999
Q ss_pred eeccCC
Q psy3969 81 CGVFRY 86 (86)
Q Consensus 81 iGgyd~ 86 (86)
||||||
T Consensus 71 iGg~de 76 (93)
T d1t1va_ 71 CGDYEL 76 (93)
T ss_dssp EEEHHH
T ss_pred EecHHH
Confidence 999985
|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} | Back information, alignment and structure |
|---|