Psyllid ID: psy398
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 162 | ||||||
| 389608903 | 382 | 26S proteasome non-ATPase regulatory sub | 0.925 | 0.392 | 0.521 | 3e-43 | |
| 357610675 | 382 | hypothetical protein KGM_03040 [Danaus p | 0.925 | 0.392 | 0.503 | 3e-42 | |
| 242006070 | 387 | 26S proteasome non-ATPase regulatory sub | 0.987 | 0.413 | 0.515 | 7e-41 | |
| 389614706 | 299 | 26S proteasome non-ATPase regulatory sub | 0.691 | 0.374 | 0.543 | 2e-30 | |
| 410951525 | 389 | PREDICTED: 26S proteasome non-ATPase reg | 0.956 | 0.398 | 0.457 | 2e-28 | |
| 126336111 | 389 | PREDICTED: 26S proteasome non-ATPase reg | 0.956 | 0.398 | 0.457 | 2e-28 | |
| 38454206 | 389 | 26S proteasome non-ATPase regulatory sub | 0.956 | 0.398 | 0.457 | 2e-28 | |
| 46049022 | 389 | 26S proteasome non-ATPase regulatory sub | 0.956 | 0.398 | 0.457 | 2e-28 | |
| 395516441 | 441 | PREDICTED: 26S proteasome non-ATPase reg | 0.956 | 0.351 | 0.457 | 3e-28 | |
| 301759269 | 389 | PREDICTED: 26S proteasome non-ATPase reg | 0.956 | 0.398 | 0.457 | 3e-28 |
| >gi|389608903|dbj|BAM18063.1| 26S proteasome non-ATPase regulatory subunit rpn7 [Papilio xuthus] | Back alignment and taxonomy information |
|---|
Score = 179 bits (455), Expect = 3e-43, Method: Compositional matrix adjust.
Identities = 84/161 (52%), Positives = 109/161 (67%), Gaps = 11/161 (6%)
Query: 1 MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLEHEKNMMDEEDQVSGIWQAKLDY 60
MAPYYKEVC + GWK+D+ Y EM N RL + E+D + +WQ +LDY
Sbjct: 46 MAPYYKEVCTDLGWKLDQNLYDEMAKENLSRLSKFQ---------EDDSETPVWQDRLDY 96
Query: 61 LCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELI 120
LCSIGD+ A LA +K+ D T + R+DA+F LFRIAYFHGC+++ M AI KA EL+
Sbjct: 97 LCSIGDKEAATALATTKYEDSTLTTNRRLDAIFALFRIAYFHGCNVKDMGKAINKAHELV 156
Query: 121 EGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIRS 161
+ GGDW +RNKLKAYE +YCLA+R Y RAAELF+D + +
Sbjct: 157 D--KGGDWRSRNKLKAYEAIYCLAVRDYSRAAELFIDCVST 195
|
Source: Papilio xuthus Species: Papilio xuthus Genus: Papilio Family: Papilionidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357610675|gb|EHJ67089.1| hypothetical protein KGM_03040 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|242006070|ref|XP_002423879.1| 26S proteasome non-ATPase regulatory subunit, putative [Pediculus humanus corporis] gi|212507125|gb|EEB11141.1| 26S proteasome non-ATPase regulatory subunit, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|389614706|dbj|BAM20379.1| 26S proteasome non-ATPase regulatory subunit rpn7, partial [Papilio polytes] | Back alignment and taxonomy information |
|---|
| >gi|410951525|ref|XP_003982446.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Felis catus] | Back alignment and taxonomy information |
|---|
| >gi|126336111|ref|XP_001363402.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Monodelphis domestica] | Back alignment and taxonomy information |
|---|
| >gi|38454206|ref|NP_942025.1| 26S proteasome non-ATPase regulatory subunit 6 [Rattus norvegicus] gi|37748489|gb|AAH59159.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Rattus norvegicus] gi|149040032|gb|EDL94116.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6, isoform CRA_a [Rattus norvegicus] | Back alignment and taxonomy information |
|---|
| >gi|46049022|ref|NP_079826.2| 26S proteasome non-ATPase regulatory subunit 6 [Mus musculus] gi|20978552|sp|Q99JI4.1|PSMD6_MOUSE RecName: Full=26S proteasome non-ATPase regulatory subunit 6; AltName: Full=26S proteasome regulatory subunit RPN7; AltName: Full=26S proteasome regulatory subunit S10; AltName: Full=p42A gi|13397899|emb|CAC34579.1| putative KIAA0107 homologue [Mus musculus] gi|13905154|gb|AAH06869.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Mus musculus] gi|148688680|gb|EDL20627.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Mus musculus] | Back alignment and taxonomy information |
|---|
| >gi|395516441|ref|XP_003762398.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Sarcophilus harrisii] | Back alignment and taxonomy information |
|---|
| >gi|301759269|ref|XP_002915483.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like [Ailuropoda melanoleuca] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 162 | ||||||
| MGI|MGI:1913663 | 389 | Psmd6 "proteasome (prosome, ma | 0.944 | 0.393 | 0.469 | 5.4e-31 | |
| RGD|735127 | 389 | Psmd6 "proteasome (prosome, ma | 0.944 | 0.393 | 0.469 | 5.4e-31 | |
| UNIPROTKB|F1N903 | 398 | PSMD6 "Uncharacterized protein | 0.950 | 0.386 | 0.453 | 8.8e-31 | |
| UNIPROTKB|F1MXE4 | 389 | PSMD6 "26S proteasome non-ATPa | 0.944 | 0.393 | 0.462 | 3.8e-30 | |
| UNIPROTKB|Q3T0B2 | 389 | PSMD6 "26S proteasome non-ATPa | 0.944 | 0.393 | 0.462 | 3.8e-30 | |
| UNIPROTKB|C9IZE4 | 442 | PSMD6 "Proteasome (Prosome, ma | 0.944 | 0.346 | 0.462 | 3.8e-30 | |
| UNIPROTKB|Q15008 | 389 | PSMD6 "26S proteasome non-ATPa | 0.944 | 0.393 | 0.462 | 3.8e-30 | |
| UNIPROTKB|Q6UV22 | 351 | PSMD6 "KIAA0107 isoform" [Homo | 0.944 | 0.435 | 0.462 | 3.8e-30 | |
| UNIPROTKB|E2RN00 | 516 | PSMD6 "Uncharacterized protein | 0.944 | 0.296 | 0.450 | 1.6e-29 | |
| ZFIN|ZDB-GENE-040426-1038 | 386 | psmd6 "proteasome (prosome, ma | 0.944 | 0.396 | 0.462 | 1.6e-29 |
| MGI|MGI:1913663 Psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 341 (125.1 bits), Expect = 5.4e-31, P = 5.4e-31
Identities = 76/162 (46%), Positives = 99/162 (61%)
Query: 1 MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELD--LEH-EKNMMDEEDQVSGIWQAK 57
MAPYY+ +C+ W+MD ++MK ANE+ LK LD LE EKN+ E ++ AK
Sbjct: 50 MAPYYEALCKSLDWQMDVDLLSKMKKANEEELKRLDEELEDAEKNL--GESEIRDAMMAK 107
Query: 58 LDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKAT 117
+YLC IGD+ A A K DKT HR+D VF L RI F+ D +T EKA
Sbjct: 108 AEYLCQIGDKEGALT-AFRKTYDKTVALGHRLDIVFYLLRIGLFY-MDNDLITRNTEKAK 165
Query: 118 ELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVI 159
LIE GGDW RN+LK Y+G+YC+AIR + +AAELF+D +
Sbjct: 166 SLIE--EGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTV 205
|
|
| RGD|735127 Psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N903 PSMD6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MXE4 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0B2 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9IZE4 PSMD6 "Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6, isoform CRA_b" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15008 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6UV22 PSMD6 "KIAA0107 isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RN00 PSMD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1038 psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 162 | |||
| pfam10602 | 174 | pfam10602, RPN7, 26S proteasome subunit RPN7 | 2e-30 | |
| COG5187 | 412 | COG5187, RPN7, 26S proteasome regulatory complex c | 6e-29 |
| >gnl|CDD|220821 pfam10602, RPN7, 26S proteasome subunit RPN7 | Back alignment and domain information |
|---|
Score = 108 bits (271), Expect = 2e-30
Identities = 54/146 (36%), Positives = 77/146 (52%), Gaps = 9/146 (6%)
Query: 17 DEKFYTEMKDANEKRLKELDLE---HEKNMMDEEDQVSGIWQAKLDYLCSIGDRAEAFKL 73
DE + E++ NE+ L+ELD E ++N+ EE + ++ IGD A K
Sbjct: 1 DEAWVEELRKKNEEELEELDAELKDAKENLGKEE--IRRALLDLAEHYAKIGDLENALK- 57
Query: 74 ADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNK 133
A S+ + H+ID L R+ F D ++ IEKA LIE GGDW RN+
Sbjct: 58 AYSRAREYCTSLGHKIDMCLNLIRVGIFFN-DWDHVSKYIEKAKSLIE--KGGDWERRNR 114
Query: 134 LKAYEGVYCLAIRQYCRAAELFVDVI 159
LK YEG+ LAIR + AA+LF+D +
Sbjct: 115 LKVYEGLALLAIRDFKEAAKLFLDSL 140
|
RPN7 (known as the non ATPase regulatory subunit 6 in higher eukaryotes) is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae to be required for structural integrity. The 26S proteasome is is involved in the ATP-dependent degradation of ubiquitinated proteins. Length = 174 |
| >gnl|CDD|227514 COG5187, RPN7, 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| KOG0687|consensus | 393 | 100.0 | ||
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 100.0 | |
| COG5187 | 412 | RPN7 26S proteasome regulatory complex component, | 100.0 | |
| KOG0686|consensus | 466 | 99.95 | ||
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.63 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 97.13 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 96.53 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 96.49 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.22 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 96.16 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 95.43 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 95.39 | |
| KOG1840|consensus | 508 | 95.27 | ||
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 95.26 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 95.26 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 94.86 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 94.68 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 94.54 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 94.5 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 94.39 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 94.27 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 94.12 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 94.05 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 93.98 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 93.69 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 93.55 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 93.52 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 93.46 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 93.39 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 93.16 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 93.05 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 92.77 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 92.7 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 92.55 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 92.4 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 92.16 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 91.94 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 91.87 | |
| KOG0548|consensus | 539 | 91.49 | ||
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 91.19 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 90.59 | |
| KOG1497|consensus | 399 | 90.27 | ||
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 89.96 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 89.79 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 89.78 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 89.67 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 89.64 | |
| KOG4234|consensus | 271 | 89.51 | ||
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 89.46 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 88.8 | |
| KOG1840|consensus | 508 | 88.76 | ||
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 87.33 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 87.01 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 86.58 | |
| KOG1173|consensus | 611 | 86.26 | ||
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 86.0 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 85.9 | |
| KOG1070|consensus | 1710 | 85.9 | ||
| KOG1155|consensus | 559 | 85.27 | ||
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 85.21 | |
| KOG0547|consensus | 606 | 84.65 | ||
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 84.0 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 83.91 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 83.69 | |
| KOG2908|consensus | 380 | 83.25 | ||
| COG1849 | 90 | Uncharacterized protein conserved in archaea [Func | 83.0 | |
| KOG1125|consensus | 579 | 82.97 | ||
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 82.33 | |
| KOG1155|consensus | 559 | 82.21 | ||
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 81.29 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 80.79 |
| >KOG0687|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.5e-56 Score=380.00 Aligned_cols=155 Identities=41% Similarity=0.760 Sum_probs=154.3
Q ss_pred CchhHHHHHHhcCCCcCHHHHHHHHHHHHHHHHHHHHHHH---hcCCCchHHHHHHHHhhHhHHHhhcCHHHHHHHHHHh
Q psy398 1 MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLEHE---KNMMDEEDQVSGIWQAKLDYLCSIGDRAEAFKLADSK 77 (162)
Q Consensus 1 m~p~Y~~l~~~~~~~~D~~~~~~~~~~n~~~l~~Le~~lk---~Nlg~~~~eIr~~~~~~a~~~~~iGD~~~A~~ay~~~ 77 (162)
|||||+.+|+.+.|++|+.++++|.++|++++++|+++++ +|+| +.|||+|+..+|+|||+|||+++|+++++++
T Consensus 53 Map~Ye~lce~~~i~~D~~~l~~m~~~neeki~eld~~iedaeenlG--E~ev~ea~~~kaeYycqigDkena~~~~~~t 130 (393)
T KOG0687|consen 53 MAPLYEYLCESLVIKLDQDLLNSMKKANEEKIKELDEKIEDAEENLG--ESEVREAMLRKAEYYCQIGDKENALEALRKT 130 (393)
T ss_pred cchHHHHHHhhcceeccHHHHHHHHHhhHHHHHHHHHHHHHHHHhcc--hHHHHHHHHHHHHHHHHhccHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999999 9999 9999999999999999999999999999999
Q ss_pred cCCCCCChHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhhhhcCCCchhhhhHHHHHHHHHHhhhhcHHHHHHHhHh
Q psy398 78 FADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVD 157 (162)
Q Consensus 78 ~~~~~~s~g~kiD~~l~~iRv~~f~~~d~~~v~~~i~ka~~l~e~~~ggDW~rrnrLKvy~gl~~l~~R~fk~AA~lfld 157 (162)
+ ++++++|||||++|++||+|+|+ +|...|+++|+||+.++|+ |||||||||||||+|||+|++||||+||.||+|
T Consensus 131 ~-~ktvs~g~kiDVvf~~iRlglfy-~D~~lV~~~iekak~liE~--GgDWeRrNRlKvY~Gly~msvR~Fk~Aa~Lfld 206 (393)
T KOG0687|consen 131 Y-EKTVSLGHKIDVVFYKIRLGLFY-LDHDLVTESIEKAKSLIEE--GGDWERRNRLKVYQGLYCMSVRNFKEAADLFLD 206 (393)
T ss_pred H-HHHhhcccchhhHHHHHHHHHhh-ccHHHHHHHHHHHHHHHHh--CCChhhhhhHHHHHHHHHHHHHhHHHHHHHHHH
Confidence 9 99999999999999999999999 9999999999999999999 999999999999999999999999999999999
Q ss_pred hccC
Q psy398 158 VIRS 161 (162)
Q Consensus 158 ~~~T 161 (162)
|+||
T Consensus 207 ~vsT 210 (393)
T KOG0687|consen 207 SVST 210 (393)
T ss_pred Hccc
Confidence 9998
|
|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0686|consensus | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG1840|consensus | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG0548|consensus | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >KOG1497|consensus | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG4234|consensus | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG1840|consensus | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG1173|consensus | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1070|consensus | Back alignment and domain information |
|---|
| >KOG1155|consensus | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG0547|consensus | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG2908|consensus | Back alignment and domain information |
|---|
| >COG1849 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >KOG1125|consensus | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >KOG1155|consensus | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 162 | ||||
| 4b4t_R | 429 | Near-Atomic Resolution Structural Model Of The Yeas | 7e-16 |
| >pdb|4B4T|R Chain R, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 429 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 100.0 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 99.3 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 98.41 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.09 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 97.99 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.94 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.86 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.79 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.73 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.66 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.61 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.6 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.56 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.54 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.53 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.53 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.53 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.51 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.44 | |
| 4b4t_O | 393 | 26S proteasome regulatory subunit RPN9; hydrolase, | 97.44 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.43 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.4 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 97.39 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.36 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.36 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.33 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.33 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.32 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.32 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.29 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.28 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.28 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.25 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.21 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.18 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.17 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.15 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.15 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.14 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.12 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.12 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.11 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.1 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.09 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.01 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 96.97 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 96.94 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 96.92 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.85 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 96.83 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 96.82 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 96.81 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.77 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.74 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.72 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.67 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.67 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 96.64 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 96.61 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 96.58 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.58 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.55 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 96.51 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 96.5 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 96.47 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.47 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 96.4 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.39 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 96.38 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.37 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 96.36 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 96.35 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 96.35 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.34 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.33 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 96.32 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 96.3 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 96.3 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 96.24 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 96.17 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 96.16 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 96.14 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 96.1 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 96.1 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.09 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.09 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 96.07 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 95.98 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 95.96 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 95.89 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 95.88 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 95.86 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 95.81 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 95.75 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 95.75 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 95.72 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 95.69 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 95.62 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 95.59 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 95.53 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.5 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 95.48 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.38 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 95.37 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 95.3 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 95.2 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 95.15 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 95.03 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 95.0 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 94.99 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 94.93 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 94.92 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 94.91 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 94.87 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.84 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 94.75 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 94.57 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 94.52 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 94.47 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 94.37 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 94.35 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 94.31 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 94.29 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.27 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 94.23 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 94.18 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 94.13 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 94.11 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 94.07 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 94.06 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 94.05 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 93.88 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 93.5 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 93.45 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 93.31 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 93.29 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 93.16 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 92.99 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 92.88 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 92.87 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 92.82 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 92.68 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 92.67 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 92.66 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 92.63 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 92.23 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 92.05 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 91.96 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 91.91 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 91.77 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 91.74 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 91.57 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 91.47 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 91.01 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 91.0 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 90.65 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 90.43 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 89.7 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 89.23 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 89.17 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 88.85 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 88.73 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 88.51 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 88.46 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 88.39 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 88.23 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 87.71 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 87.29 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 87.21 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 86.76 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 86.7 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 86.57 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 84.73 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 84.04 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 83.59 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 83.42 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 82.38 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 82.01 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 81.64 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 81.45 | |
| 2oo2_A | 86 | Hypothetical protein AF_1782; structural genomics, | 81.05 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 80.94 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 80.94 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 80.75 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 80.59 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 80.54 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 80.15 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 80.04 |
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-37 Score=270.20 Aligned_cols=155 Identities=35% Similarity=0.637 Sum_probs=150.4
Q ss_pred CchhHHHHHHhcCC--------------------CcCHHHHHHHHHHHHHHHHHHHHHHH----hcCCCchHHHHHHHHh
Q psy398 1 MAPYYKEVCEEFGW--------------------KMDEKFYTEMKDANEKRLKELDLEHE----KNMMDEEDQVSGIWQA 56 (162)
Q Consensus 1 m~p~Y~~l~~~~~~--------------------~~D~~~~~~~~~~n~~~l~~Le~~lk----~Nlg~~~~eIr~~~~~ 56 (162)
|+|||+++|+++.+ |+|++|++.|.++|+.++++|++.++ +|.| +.|||+++.+
T Consensus 59 ma~~y~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~n~~~l~~l~~~~~~~~~~~~~--e~e~~~~~~~ 136 (429)
T 4b4t_R 59 MAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEG--ELEQAQAWIN 136 (429)
T ss_dssp CHHHHHHHHHHSCCCCSCCSSCSHHHHHHHHHTTTTCCSSCTTTTCCSSCCHHHHHHHHHHHHHCCSC--CCCCSSCCHH
T ss_pred CHHHHHHHHHHHhhcccchhhhhhhhhhhhhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccc--cHHHHHHHHH
Confidence 89999999999864 78999999999999999999999998 6899 9999999999
Q ss_pred hHhHHHhhcCHHHHHHHHHHhcCCCCCChHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhhhhcCCCchhhhhHHHH
Q psy398 57 KLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKA 136 (162)
Q Consensus 57 ~a~~~~~iGD~~~A~~ay~~~~~~~~~s~g~kiD~~l~~iRv~~f~~~d~~~v~~~i~ka~~l~e~~~ggDW~rrnrLKv 136 (162)
+|+||+++||+++|+++|.+++ ++|++++|++|++|.+||+++++ +||.++..++.||+.++++ +|||+++||+|+
T Consensus 137 la~~~~~~Gd~~~A~~~~~~~~-~~~~~~~~kid~~l~~irl~l~~-~d~~~~~~~~~ka~~~~~~--~~d~~~~~~lk~ 212 (429)
T 4b4t_R 137 LGEYYAQIGDKDNAEKTLGKSL-SKAISTGAKIDVMLTIARLGFFY-NDQLYVKEKLEAVNSMIEK--GGDWERRNRYKT 212 (429)
T ss_dssp HHHHHHHHCCCTTHHHHHHHHH-HHHTCCCSHHHHHHHHHHHHHHH-TCHHHHHHHHHHHHHHHTT--CCCTHHHHHHHH
T ss_pred HHHHHHHcCCHHHHHHHHHHHH-HhcCChHHHHHHHHHHHHHHHHh-ccHHHHHHHHHHHHHhhhc--CCCHHHHHHHHH
Confidence 9999999999999999999999 99999999999999999999999 9999999999999999998 999999999999
Q ss_pred HHHHHHhhhhcHHHHHHHhHhhccC
Q psy398 137 YEGVYCLAIRQYCRAAELFVDVIRS 161 (162)
Q Consensus 137 y~gl~~l~~R~fk~AA~lfld~~~T 161 (162)
|.|+++|..|+|+.||++|+++.+|
T Consensus 213 ~~gl~~l~~r~f~~Aa~~f~e~~~t 237 (429)
T 4b4t_R 213 YYGIHCLAVRNFKEAAKLLVDSLAT 237 (429)
T ss_dssp HHHHGGGGTSCHHHHHHHHHHHHHH
T ss_pred HHHHHHHHhChHHHHHHHHHHHhcc
Confidence 9999999999999999999998776
|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2oo2_A Hypothetical protein AF_1782; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Archaeoglobus fulgidus dsm 4304} SCOP: a.8.11.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 162 | |||
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.52 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.35 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.81 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 96.8 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.76 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.51 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 96.34 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 96.33 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.3 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 96.24 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.17 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.12 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 96.03 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.73 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.67 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 95.6 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 95.46 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.45 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.12 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 95.02 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 94.55 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 93.97 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 93.69 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 93.27 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 91.98 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 90.88 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 89.79 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 88.41 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 88.32 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 87.79 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 87.17 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 87.16 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 86.32 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 84.66 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 84.66 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 83.21 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 81.61 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 81.58 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 80.55 |
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Hop species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.52 E-value=0.00079 Score=46.41 Aligned_cols=101 Identities=15% Similarity=0.056 Sum_probs=81.3
Q ss_pred HHHhhHhHHHhhcCHHHHHHHHHHhcCCCCCChHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhhhhcCCCchhhhh
Q psy398 53 IWQAKLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARN 132 (162)
Q Consensus 53 ~~~~~a~~~~~iGD~~~A~~ay~~~~~~~~~s~g~kiD~~l~~iRv~~f~~~d~~~v~~~i~ka~~l~e~~~ggDW~rrn 132 (162)
.+.++|+.|.+.|+++.|+++|++++ +.... ..+..+++-.+.+-. ++|........+|-.+-.. ....|-...
T Consensus 6 ~~k~~G~~~~~~~~y~~Ai~~y~~al-~~~p~---~~~~~~~~a~~~~~~-~~~~~A~~~~~~al~l~~~-~~~~~~~~a 79 (128)
T d1elra_ 6 KEKELGNDAYKKKDFDTALKHYDKAK-ELDPT---NMTYITNQAAVYFEK-GDYNKCRELCEKAIEVGRE-NREDYRQIA 79 (128)
T ss_dssp HHHHHHHHHHHTTCHHHHHHHHHHHH-HHCTT---CHHHHHHHHHHHHHH-TCHHHHHHHHHHHHHHHHH-STTCHHHHH
T ss_pred HHHHHHHHHHHcCCHHHHHHHHHHHH-HhCcc---cHHHHHhHHHHHHHc-CchHHHHHHHHHHHHhCcc-cHHHHHHHH
Confidence 46689999999999999999999999 65433 356788888888888 9999999999999887322 245666666
Q ss_pred HHHHHHHHHHhhhhcHHHHHHHhHhhc
Q psy398 133 KLKAYEGVYCLAIRQYCRAAELFVDVI 159 (162)
Q Consensus 133 rLKvy~gl~~l~~R~fk~AA~lfld~~ 159 (162)
+.-.-.|..+...++|.+|.+.|=.++
T Consensus 80 ~~~~~lg~~~~~~~~~~~A~~~~~kal 106 (128)
T d1elra_ 80 KAYARIGNSYFKEEKYKDAIHFYNKSL 106 (128)
T ss_dssp HHHHHHHHHHHHTTCHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHhCCHHHHHHHHHHHH
Confidence 666678888999999999999986554
|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|