Psyllid ID: psy398


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLEHEKNMMDEEDQVSGIWQAKLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIRSR
ccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
ccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLEHeknmmdeedqVSGIWQAKLDYLCSIGDRAEAFkladskfadktnpkshriDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIRSR
mapyykevceefgwkmdEKFYTEMKDANEKRLKELDLEHEKNMMDEEDQVSGIWQAKLDYLCSIGDRAEAFKLAdskfadktnpkshrIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIRSR
MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLEHEKNMMDEEDQVSGIWQAKLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIRSR
***YYKEVCEEFGWKMDEKFYT***************************VSGIWQAKLDYLCSIGDRAEAFKLADSKFA******SHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVI***
MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRL******************SGIWQAKLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIRS*
MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLEHEKNMMDEEDQVSGIWQAKLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIRSR
MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLEHEKNMMDEEDQVSGIWQAKLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIR**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLEHEKNMMDEEDQVSGIWQAKLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIRSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q99JI4 389 26S proteasome non-ATPase yes N/A 0.956 0.398 0.457 5e-30
Q3T0B2 389 26S proteasome non-ATPase yes N/A 0.956 0.398 0.451 3e-29
Q15008 389 26S proteasome non-ATPase yes N/A 0.956 0.398 0.451 4e-29
Q9V3G7 389 26S proteasome non-ATPase yes N/A 0.956 0.398 0.396 8e-25
Q55C75 382 26S proteasome non-ATPase yes N/A 0.969 0.410 0.358 2e-21
Q20585 410 26S proteasome non-ATPase yes N/A 0.956 0.378 0.353 5e-20
Q93Y35 387 Probable 26S proteasome n yes N/A 0.950 0.397 0.345 2e-17
Q10335 409 Probable 26S proteasome r yes N/A 0.969 0.383 0.319 2e-16
Q06103 429 26S proteasome regulatory yes N/A 0.956 0.361 0.320 8e-15
Q8W425 389 26S proteasome non-ATPase yes N/A 0.950 0.395 0.321 2e-13
>sp|Q99JI4|PSMD6_MOUSE 26S proteasome non-ATPase regulatory subunit 6 OS=Mus musculus GN=Psmd6 PE=1 SV=1 Back     alignment and function desciption
 Score =  130 bits (326), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 99/164 (60%), Gaps = 9/164 (5%)

Query: 1   MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLE---HEKNMMDEEDQVSGIWQAK 57
           MAPYY+ +C+   W+MD    ++MK ANE+ LK LD E    EKN+   E ++     AK
Sbjct: 50  MAPYYEALCKSLDWQMDVDLLSKMKKANEEELKRLDEELEDAEKNL--GESEIRDAMMAK 107

Query: 58  LDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKAT 117
            +YLC IGD+  A   A  K  DKT    HR+D VF L RI  F+  D   +T   EKA 
Sbjct: 108 AEYLCQIGDKEGALT-AFRKTYDKTVALGHRLDIVFYLLRIGLFY-MDNDLITRNTEKAK 165

Query: 118 ELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIRS 161
            LIE   GGDW  RN+LK Y+G+YC+AIR + +AAELF+D + +
Sbjct: 166 SLIE--EGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVST 207




Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Mus musculus (taxid: 10090)
>sp|Q3T0B2|PSMD6_BOVIN 26S proteasome non-ATPase regulatory subunit 6 OS=Bos taurus GN=PSMD6 PE=2 SV=1 Back     alignment and function description
>sp|Q15008|PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens GN=PSMD6 PE=1 SV=1 Back     alignment and function description
>sp|Q9V3G7|PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster GN=Rpn7 PE=2 SV=1 Back     alignment and function description
>sp|Q55C75|PSMD6_DICDI 26S proteasome non-ATPase regulatory subunit 6 OS=Dictyostelium discoideum GN=psmD6 PE=1 SV=1 Back     alignment and function description
>sp|Q20585|PSMD6_CAEEL 26S proteasome non-ATPase regulatory subunit 6 OS=Caenorhabditis elegans GN=rpn-7 PE=3 SV=1 Back     alignment and function description
>sp|Q93Y35|PSMD6_ARATH Probable 26S proteasome non-ATPase regulatory subunit 6 OS=Arabidopsis thaliana GN=At4g24820 PE=2 SV=1 Back     alignment and function description
>sp|Q10335|RPN7_SCHPO Probable 26S proteasome regulatory subunit rpn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn7 PE=2 SV=1 Back     alignment and function description
>sp|Q06103|RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN7 PE=1 SV=3 Back     alignment and function description
>sp|Q8W425|PSMD6_ORYSJ 26S proteasome non-ATPase regulatory subunit 6 OS=Oryza sativa subsp. japonica GN=RPN7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
389608903 382 26S proteasome non-ATPase regulatory sub 0.925 0.392 0.521 3e-43
357610675 382 hypothetical protein KGM_03040 [Danaus p 0.925 0.392 0.503 3e-42
242006070 387 26S proteasome non-ATPase regulatory sub 0.987 0.413 0.515 7e-41
389614706 299 26S proteasome non-ATPase regulatory sub 0.691 0.374 0.543 2e-30
410951525 389 PREDICTED: 26S proteasome non-ATPase reg 0.956 0.398 0.457 2e-28
126336111 389 PREDICTED: 26S proteasome non-ATPase reg 0.956 0.398 0.457 2e-28
38454206 389 26S proteasome non-ATPase regulatory sub 0.956 0.398 0.457 2e-28
46049022 389 26S proteasome non-ATPase regulatory sub 0.956 0.398 0.457 2e-28
395516441 441 PREDICTED: 26S proteasome non-ATPase reg 0.956 0.351 0.457 3e-28
301759269 389 PREDICTED: 26S proteasome non-ATPase reg 0.956 0.398 0.457 3e-28
>gi|389608903|dbj|BAM18063.1| 26S proteasome non-ATPase regulatory subunit rpn7 [Papilio xuthus] Back     alignment and taxonomy information
 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 109/161 (67%), Gaps = 11/161 (6%)

Query: 1   MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLEHEKNMMDEEDQVSGIWQAKLDY 60
           MAPYYKEVC + GWK+D+  Y EM   N  RL +           E+D  + +WQ +LDY
Sbjct: 46  MAPYYKEVCTDLGWKLDQNLYDEMAKENLSRLSKFQ---------EDDSETPVWQDRLDY 96

Query: 61  LCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELI 120
           LCSIGD+  A  LA +K+ D T   + R+DA+F LFRIAYFHGC+++ M  AI KA EL+
Sbjct: 97  LCSIGDKEAATALATTKYEDSTLTTNRRLDAIFALFRIAYFHGCNVKDMGKAINKAHELV 156

Query: 121 EGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVIRS 161
           +   GGDW +RNKLKAYE +YCLA+R Y RAAELF+D + +
Sbjct: 157 D--KGGDWRSRNKLKAYEAIYCLAVRDYSRAAELFIDCVST 195




Source: Papilio xuthus

Species: Papilio xuthus

Genus: Papilio

Family: Papilionidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357610675|gb|EHJ67089.1| hypothetical protein KGM_03040 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242006070|ref|XP_002423879.1| 26S proteasome non-ATPase regulatory subunit, putative [Pediculus humanus corporis] gi|212507125|gb|EEB11141.1| 26S proteasome non-ATPase regulatory subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|389614706|dbj|BAM20379.1| 26S proteasome non-ATPase regulatory subunit rpn7, partial [Papilio polytes] Back     alignment and taxonomy information
>gi|410951525|ref|XP_003982446.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Felis catus] Back     alignment and taxonomy information
>gi|126336111|ref|XP_001363402.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Monodelphis domestica] Back     alignment and taxonomy information
>gi|38454206|ref|NP_942025.1| 26S proteasome non-ATPase regulatory subunit 6 [Rattus norvegicus] gi|37748489|gb|AAH59159.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Rattus norvegicus] gi|149040032|gb|EDL94116.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6, isoform CRA_a [Rattus norvegicus] Back     alignment and taxonomy information
>gi|46049022|ref|NP_079826.2| 26S proteasome non-ATPase regulatory subunit 6 [Mus musculus] gi|20978552|sp|Q99JI4.1|PSMD6_MOUSE RecName: Full=26S proteasome non-ATPase regulatory subunit 6; AltName: Full=26S proteasome regulatory subunit RPN7; AltName: Full=26S proteasome regulatory subunit S10; AltName: Full=p42A gi|13397899|emb|CAC34579.1| putative KIAA0107 homologue [Mus musculus] gi|13905154|gb|AAH06869.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Mus musculus] gi|148688680|gb|EDL20627.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Mus musculus] Back     alignment and taxonomy information
>gi|395516441|ref|XP_003762398.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|301759269|ref|XP_002915483.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
MGI|MGI:1913663 389 Psmd6 "proteasome (prosome, ma 0.944 0.393 0.469 5.4e-31
RGD|735127 389 Psmd6 "proteasome (prosome, ma 0.944 0.393 0.469 5.4e-31
UNIPROTKB|F1N903 398 PSMD6 "Uncharacterized protein 0.950 0.386 0.453 8.8e-31
UNIPROTKB|F1MXE4 389 PSMD6 "26S proteasome non-ATPa 0.944 0.393 0.462 3.8e-30
UNIPROTKB|Q3T0B2 389 PSMD6 "26S proteasome non-ATPa 0.944 0.393 0.462 3.8e-30
UNIPROTKB|C9IZE4 442 PSMD6 "Proteasome (Prosome, ma 0.944 0.346 0.462 3.8e-30
UNIPROTKB|Q15008 389 PSMD6 "26S proteasome non-ATPa 0.944 0.393 0.462 3.8e-30
UNIPROTKB|Q6UV22 351 PSMD6 "KIAA0107 isoform" [Homo 0.944 0.435 0.462 3.8e-30
UNIPROTKB|E2RN00 516 PSMD6 "Uncharacterized protein 0.944 0.296 0.450 1.6e-29
ZFIN|ZDB-GENE-040426-1038 386 psmd6 "proteasome (prosome, ma 0.944 0.396 0.462 1.6e-29
MGI|MGI:1913663 Psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 341 (125.1 bits), Expect = 5.4e-31, P = 5.4e-31
 Identities = 76/162 (46%), Positives = 99/162 (61%)

Query:     1 MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELD--LEH-EKNMMDEEDQVSGIWQAK 57
             MAPYY+ +C+   W+MD    ++MK ANE+ LK LD  LE  EKN+   E ++     AK
Sbjct:    50 MAPYYEALCKSLDWQMDVDLLSKMKKANEEELKRLDEELEDAEKNL--GESEIRDAMMAK 107

Query:    58 LDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKAT 117
              +YLC IGD+  A   A  K  DKT    HR+D VF L RI  F+  D   +T   EKA 
Sbjct:   108 AEYLCQIGDKEGALT-AFRKTYDKTVALGHRLDIVFYLLRIGLFY-MDNDLITRNTEKAK 165

Query:   118 ELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDVI 159
              LIE   GGDW  RN+LK Y+G+YC+AIR + +AAELF+D +
Sbjct:   166 SLIE--EGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTV 205




GO:0000502 "proteasome complex" evidence=IEA
GO:0022624 "proteasome accessory complex" evidence=IDA
RGD|735127 Psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N903 PSMD6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXE4 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0B2 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9IZE4 PSMD6 "Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6, isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q15008 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6UV22 PSMD6 "KIAA0107 isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RN00 PSMD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1038 psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
pfam10602174 pfam10602, RPN7, 26S proteasome subunit RPN7 2e-30
COG5187 412 COG5187, RPN7, 26S proteasome regulatory complex c 6e-29
>gnl|CDD|220821 pfam10602, RPN7, 26S proteasome subunit RPN7 Back     alignment and domain information
 Score =  108 bits (271), Expect = 2e-30
 Identities = 54/146 (36%), Positives = 77/146 (52%), Gaps = 9/146 (6%)

Query: 17  DEKFYTEMKDANEKRLKELDLE---HEKNMMDEEDQVSGIWQAKLDYLCSIGDRAEAFKL 73
           DE +  E++  NE+ L+ELD E    ++N+  EE  +        ++   IGD   A K 
Sbjct: 1   DEAWVEELRKKNEEELEELDAELKDAKENLGKEE--IRRALLDLAEHYAKIGDLENALK- 57

Query: 74  ADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNK 133
           A S+  +      H+ID    L R+  F   D   ++  IEKA  LIE   GGDW  RN+
Sbjct: 58  AYSRAREYCTSLGHKIDMCLNLIRVGIFFN-DWDHVSKYIEKAKSLIE--KGGDWERRNR 114

Query: 134 LKAYEGVYCLAIRQYCRAAELFVDVI 159
           LK YEG+  LAIR +  AA+LF+D +
Sbjct: 115 LKVYEGLALLAIRDFKEAAKLFLDSL 140


RPN7 (known as the non ATPase regulatory subunit 6 in higher eukaryotes) is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae to be required for structural integrity. The 26S proteasome is is involved in the ATP-dependent degradation of ubiquitinated proteins. Length = 174

>gnl|CDD|227514 COG5187, RPN7, 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
KOG0687|consensus 393 100.0
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 100.0
COG5187 412 RPN7 26S proteasome regulatory complex component, 100.0
KOG0686|consensus 466 99.95
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.63
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.13
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.53
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.49
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 96.22
PF12688120 TPR_5: Tetratrico peptide repeat 96.16
TIGR02552135 LcrH_SycD type III secretion low calcium response 95.43
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.39
KOG1840|consensus 508 95.27
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 95.26
PRK11788 389 tetratricopeptide repeat protein; Provisional 95.26
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.86
PRK10370198 formate-dependent nitrite reductase complex subuni 94.68
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.54
PRK11788389 tetratricopeptide repeat protein; Provisional 94.5
PRK11189 296 lipoprotein NlpI; Provisional 94.39
PRK02603172 photosystem I assembly protein Ycf3; Provisional 94.27
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 94.12
PF14938 282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 94.05
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 93.98
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 93.69
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 93.55
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 93.52
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 93.46
CHL00033168 ycf3 photosystem I assembly protein Ycf3 93.39
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 93.16
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 93.05
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 92.77
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 92.7
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 92.55
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.4
PRK10803263 tol-pal system protein YbgF; Provisional 92.16
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.94
cd00189100 TPR Tetratricopeptide repeat domain; typically con 91.87
KOG0548|consensus539 91.49
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.19
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 90.59
KOG1497|consensus 399 90.27
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 89.96
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 89.79
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.78
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 89.67
PRK15359144 type III secretion system chaperone protein SscB; 89.64
KOG4234|consensus271 89.51
PF1342844 TPR_14: Tetratricopeptide repeat 89.46
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 88.8
KOG1840|consensus 508 88.76
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 87.33
PRK12370 553 invasion protein regulator; Provisional 87.01
PRK11189296 lipoprotein NlpI; Provisional 86.58
KOG1173|consensus 611 86.26
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 86.0
PRK12370553 invasion protein regulator; Provisional 85.9
KOG1070|consensus 1710 85.9
KOG1155|consensus559 85.27
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 85.21
KOG0547|consensus 606 84.65
PF1286294 Apc5: Anaphase-promoting complex subunit 5 84.0
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 83.91
PRK04841 903 transcriptional regulator MalT; Provisional 83.69
KOG2908|consensus 380 83.25
COG184990 Uncharacterized protein conserved in archaea [Func 83.0
KOG1125|consensus579 82.97
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 82.33
KOG1155|consensus559 82.21
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 81.29
CHL00033168 ycf3 photosystem I assembly protein Ycf3 80.79
>KOG0687|consensus Back     alignment and domain information
Probab=100.00  E-value=5.5e-56  Score=380.00  Aligned_cols=155  Identities=41%  Similarity=0.760  Sum_probs=154.3

Q ss_pred             CchhHHHHHHhcCCCcCHHHHHHHHHHHHHHHHHHHHHHH---hcCCCchHHHHHHHHhhHhHHHhhcCHHHHHHHHHHh
Q psy398            1 MAPYYKEVCEEFGWKMDEKFYTEMKDANEKRLKELDLEHE---KNMMDEEDQVSGIWQAKLDYLCSIGDRAEAFKLADSK   77 (162)
Q Consensus         1 m~p~Y~~l~~~~~~~~D~~~~~~~~~~n~~~l~~Le~~lk---~Nlg~~~~eIr~~~~~~a~~~~~iGD~~~A~~ay~~~   77 (162)
                      |||||+.+|+.+.|++|+.++++|.++|++++++|+++++   +|+|  +.|||+|+..+|+|||+|||+++|+++++++
T Consensus        53 Map~Ye~lce~~~i~~D~~~l~~m~~~neeki~eld~~iedaeenlG--E~ev~ea~~~kaeYycqigDkena~~~~~~t  130 (393)
T KOG0687|consen   53 MAPLYEYLCESLVIKLDQDLLNSMKKANEEKIKELDEKIEDAEENLG--ESEVREAMLRKAEYYCQIGDKENALEALRKT  130 (393)
T ss_pred             cchHHHHHHhhcceeccHHHHHHHHHhhHHHHHHHHHHHHHHHHhcc--hHHHHHHHHHHHHHHHHhccHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999   9999  9999999999999999999999999999999


Q ss_pred             cCCCCCChHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhhhhcCCCchhhhhHHHHHHHHHHhhhhcHHHHHHHhHh
Q psy398           78 FADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVD  157 (162)
Q Consensus        78 ~~~~~~s~g~kiD~~l~~iRv~~f~~~d~~~v~~~i~ka~~l~e~~~ggDW~rrnrLKvy~gl~~l~~R~fk~AA~lfld  157 (162)
                      + ++++++|||||++|++||+|+|+ +|...|+++|+||+.++|+  |||||||||||||+|||+|++||||+||.||+|
T Consensus       131 ~-~ktvs~g~kiDVvf~~iRlglfy-~D~~lV~~~iekak~liE~--GgDWeRrNRlKvY~Gly~msvR~Fk~Aa~Lfld  206 (393)
T KOG0687|consen  131 Y-EKTVSLGHKIDVVFYKIRLGLFY-LDHDLVTESIEKAKSLIEE--GGDWERRNRLKVYQGLYCMSVRNFKEAADLFLD  206 (393)
T ss_pred             H-HHHhhcccchhhHHHHHHHHHhh-ccHHHHHHHHHHHHHHHHh--CCChhhhhhHHHHHHHHHHHHHhHHHHHHHHHH
Confidence            9 99999999999999999999999 9999999999999999999  999999999999999999999999999999999


Q ss_pred             hccC
Q psy398          158 VIRS  161 (162)
Q Consensus       158 ~~~T  161 (162)
                      |+||
T Consensus       207 ~vsT  210 (393)
T KOG0687|consen  207 SVST  210 (393)
T ss_pred             Hccc
Confidence            9998



>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1497|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2908|consensus Back     alignment and domain information
>COG1849 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
4b4t_R 429 Near-Atomic Resolution Structural Model Of The Yeas 7e-16
>pdb|4B4T|R Chain R, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 429 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 58/181 (32%), Positives = 90/181 (49%), Gaps = 26/181 (14%) Query: 1 MAPYYKEVCEEF-------------------GW-KMDEKFYTEMKDANEKRLKELDLEHE 40 MAPYYK +CEE+ W K D++ Y E+ NE ++KEL+ + + Sbjct: 59 MAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQ 118 Query: 41 KNMMDEEDQV--SGIWQAKLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRI 98 K D+E ++ + W +Y IGD+ A K K K +ID + T+ R+ Sbjct: 119 KLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTL-GKSLSKAISTGAKIDVMLTIARL 177 Query: 99 AYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKAYEGVYCLAIRQYCRAAELFVDV 158 +F+ D + +E +IE GGDW RN+ K Y G++CLA+R + AA+L VD Sbjct: 178 GFFYN-DQLYVKEKLEAVNSMIE--KGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDS 234 Query: 159 I 159 + Sbjct: 235 L 235

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 100.0
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 99.3
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 98.41
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.99
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.94
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.86
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.79
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.73
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 97.66
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 97.61
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.6
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.56
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.54
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 97.53
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.53
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.53
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.51
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.44
4b4t_O 393 26S proteasome regulatory subunit RPN9; hydrolase, 97.44
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.43
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.4
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.39
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 97.36
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.36
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.33
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 97.33
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.32
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.32
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 97.29
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.28
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.28
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 97.25
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 97.21
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.18
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.17
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.15
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.15
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.12
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.1
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.09
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.01
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 96.97
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 96.94
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.92
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.85
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.83
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.82
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 96.81
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.77
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.74
3u4t_A 272 TPR repeat-containing protein; structural genomics 96.72
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.67
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.67
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 96.64
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.61
3u3w_A 293 Transcriptional activator PLCR protein; ternary co 96.58
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.58
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.55
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.51
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.5
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.47
3u4t_A 272 TPR repeat-containing protein; structural genomics 96.47
4g1t_A 472 Interferon-induced protein with tetratricopeptide 96.4
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.39
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 96.38
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.37
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.36
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 96.35
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 96.35
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 96.34
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.33
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.32
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.3
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.3
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.24
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.17
2gw1_A 514 Mitochondrial precursor proteins import receptor; 96.16
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 96.14
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.1
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 96.1
3k9i_A117 BH0479 protein; putative protein binding protein, 96.09
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.09
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.07
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 95.98
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.96
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 95.89
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 95.88
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.86
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 95.81
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 95.75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 95.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 95.72
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 95.69
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 95.62
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.59
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 95.53
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 95.5
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 95.48
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.38
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 95.37
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.3
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 95.2
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 95.03
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 95.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 94.99
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 94.93
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 94.92
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 94.91
4g1t_A472 Interferon-induced protein with tetratricopeptide 94.87
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.84
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 94.75
2gw1_A514 Mitochondrial precursor proteins import receptor; 94.57
3k9i_A117 BH0479 protein; putative protein binding protein, 94.52
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 94.47
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 94.37
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.35
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 94.31
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 94.29
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 94.27
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.23
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 94.18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 94.13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 94.11
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 94.07
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 94.06
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.05
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 93.88
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 93.5
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 93.45
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.31
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.29
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 93.16
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 92.99
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 92.88
3mv2_B 310 Coatomer subunit epsilon; vesicular membrane coat 92.87
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 92.82
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 92.68
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 92.67
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 92.66
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 92.63
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 92.23
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 92.05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 91.96
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 91.91
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 91.77
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 91.74
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 91.57
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 91.47
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 91.01
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 91.0
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 90.65
3q49_B137 STIP1 homology and U box-containing protein 1; E3 90.43
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.7
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 89.23
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 89.17
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 88.85
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 88.73
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 88.51
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 88.46
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 88.39
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 88.23
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 87.71
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 87.29
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 87.21
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 86.76
2l6j_A111 TPR repeat-containing protein associated with HSP; 86.7
1pc2_A152 Mitochondria fission protein; unknown function; NM 86.57
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 84.73
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 84.04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 83.59
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 83.42
3qww_A433 SET and MYND domain-containing protein 2; methyltr 82.38
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 82.01
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 81.64
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 81.45
2oo2_A86 Hypothetical protein AF_1782; structural genomics, 81.05
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 80.94
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 80.94
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 80.75
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 80.59
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 80.54
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 80.15
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 80.04
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=2.6e-37  Score=270.20  Aligned_cols=155  Identities=35%  Similarity=0.637  Sum_probs=150.4

Q ss_pred             CchhHHHHHHhcCC--------------------CcCHHHHHHHHHHHHHHHHHHHHHHH----hcCCCchHHHHHHHHh
Q psy398            1 MAPYYKEVCEEFGW--------------------KMDEKFYTEMKDANEKRLKELDLEHE----KNMMDEEDQVSGIWQA   56 (162)
Q Consensus         1 m~p~Y~~l~~~~~~--------------------~~D~~~~~~~~~~n~~~l~~Le~~lk----~Nlg~~~~eIr~~~~~   56 (162)
                      |+|||+++|+++.+                    |+|++|++.|.++|+.++++|++.++    +|.|  +.|||+++.+
T Consensus        59 ma~~y~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~n~~~l~~l~~~~~~~~~~~~~--e~e~~~~~~~  136 (429)
T 4b4t_R           59 MAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEG--ELEQAQAWIN  136 (429)
T ss_dssp             CHHHHHHHHHHSCCCCSCCSSCSHHHHHHHHHTTTTCCSSCTTTTCCSSCCHHHHHHHHHHHHHCCSC--CCCCSSCCHH
T ss_pred             CHHHHHHHHHHHhhcccchhhhhhhhhhhhhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccc--cHHHHHHHHH
Confidence            89999999999864                    78999999999999999999999998    6899  9999999999


Q ss_pred             hHhHHHhhcCHHHHHHHHHHhcCCCCCChHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhhhhcCCCchhhhhHHHH
Q psy398           57 KLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARNKLKA  136 (162)
Q Consensus        57 ~a~~~~~iGD~~~A~~ay~~~~~~~~~s~g~kiD~~l~~iRv~~f~~~d~~~v~~~i~ka~~l~e~~~ggDW~rrnrLKv  136 (162)
                      +|+||+++||+++|+++|.+++ ++|++++|++|++|.+||+++++ +||.++..++.||+.++++  +|||+++||+|+
T Consensus       137 la~~~~~~Gd~~~A~~~~~~~~-~~~~~~~~kid~~l~~irl~l~~-~d~~~~~~~~~ka~~~~~~--~~d~~~~~~lk~  212 (429)
T 4b4t_R          137 LGEYYAQIGDKDNAEKTLGKSL-SKAISTGAKIDVMLTIARLGFFY-NDQLYVKEKLEAVNSMIEK--GGDWERRNRYKT  212 (429)
T ss_dssp             HHHHHHHHCCCTTHHHHHHHHH-HHHTCCCSHHHHHHHHHHHHHHH-TCHHHHHHHHHHHHHHHTT--CCCTHHHHHHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHH-HhcCChHHHHHHHHHHHHHHHHh-ccHHHHHHHHHHHHHhhhc--CCCHHHHHHHHH
Confidence            9999999999999999999999 99999999999999999999999 9999999999999999998  999999999999


Q ss_pred             HHHHHHhhhhcHHHHHHHhHhhccC
Q psy398          137 YEGVYCLAIRQYCRAAELFVDVIRS  161 (162)
Q Consensus       137 y~gl~~l~~R~fk~AA~lfld~~~T  161 (162)
                      |.|+++|..|+|+.||++|+++.+|
T Consensus       213 ~~gl~~l~~r~f~~Aa~~f~e~~~t  237 (429)
T 4b4t_R          213 YYGIHCLAVRNFKEAAKLLVDSLAT  237 (429)
T ss_dssp             HHHHGGGGTSCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhChHHHHHHHHHHHhcc
Confidence            9999999999999999999998776



>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2oo2_A Hypothetical protein AF_1782; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Archaeoglobus fulgidus dsm 4304} SCOP: a.8.11.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.52
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.35
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.81
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 96.8
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.76
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.51
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 96.34
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.33
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 96.3
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.24
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.17
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.12
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 96.03
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.73
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.67
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.6
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 95.46
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.45
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.12
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.02
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.55
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 93.97
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 93.69
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 93.27
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 91.98
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 90.88
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 89.79
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 88.41
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 88.32
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 87.79
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 87.17
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 87.16
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 86.32
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 84.66
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 84.66
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 83.21
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 81.61
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 81.58
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 80.55
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Hop
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.52  E-value=0.00079  Score=46.41  Aligned_cols=101  Identities=15%  Similarity=0.056  Sum_probs=81.3

Q ss_pred             HHHhhHhHHHhhcCHHHHHHHHHHhcCCCCCChHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhhhhcCCCchhhhh
Q psy398           53 IWQAKLDYLCSIGDRAEAFKLADSKFADKTNPKSHRIDAVFTLFRIAYFHGCDIQAMTAAIEKATELIEGISGGDWSARN  132 (162)
Q Consensus        53 ~~~~~a~~~~~iGD~~~A~~ay~~~~~~~~~s~g~kiD~~l~~iRv~~f~~~d~~~v~~~i~ka~~l~e~~~ggDW~rrn  132 (162)
                      .+.++|+.|.+.|+++.|+++|++++ +....   ..+..+++-.+.+-. ++|........+|-.+-.. ....|-...
T Consensus         6 ~~k~~G~~~~~~~~y~~Ai~~y~~al-~~~p~---~~~~~~~~a~~~~~~-~~~~~A~~~~~~al~l~~~-~~~~~~~~a   79 (128)
T d1elra_           6 KEKELGNDAYKKKDFDTALKHYDKAK-ELDPT---NMTYITNQAAVYFEK-GDYNKCRELCEKAIEVGRE-NREDYRQIA   79 (128)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHH-HHCTT---CHHHHHHHHHHHHHH-TCHHHHHHHHHHHHHHHHH-STTCHHHHH
T ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHH-HhCcc---cHHHHHhHHHHHHHc-CchHHHHHHHHHHHHhCcc-cHHHHHHHH
Confidence            46689999999999999999999999 65433   356788888888888 9999999999999887322 245666666


Q ss_pred             HHHHHHHHHHhhhhcHHHHHHHhHhhc
Q psy398          133 KLKAYEGVYCLAIRQYCRAAELFVDVI  159 (162)
Q Consensus       133 rLKvy~gl~~l~~R~fk~AA~lfld~~  159 (162)
                      +.-.-.|..+...++|.+|.+.|=.++
T Consensus        80 ~~~~~lg~~~~~~~~~~~A~~~~~kal  106 (128)
T d1elra_          80 KAYARIGNSYFKEEKYKDAIHFYNKSL  106 (128)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhCCHHHHHHHHHHHH
Confidence            666678888999999999999986554



>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure