Psyllid ID: psy4013


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------7
MKARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMPDRIIDQSSWLQI
cccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEccHHHHHHHHHHHcccHHHHHHHHHcccccc
cccccccHHHHHHHHHHHHHHHHHHHHcEEEEEEEEEEEcHHHHHHHHHHccHHHHHHHHHHHcccccc
MKARVANYGLMDQIAALHWVQQNIalfggdpgnvtmmghgtGAACINFLmisptvmpdriidqsswlqi
MKARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMPDRIIDQSSWLQI
MKARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMPDRIIDQSSWLQI
****VANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMPDRIID*******
**ARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMPDRIIDQSSWLQ*
MKARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMPDRIIDQSSWLQI
*KARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMPDRIIDQS*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMPDRIIDQSSWLQI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query69 2.2.26 [Sep-21-2011]
Q5XG92 561 Carboxylesterase 4A OS=Ho no N/A 0.855 0.105 0.573 1e-12
Q62888 836 Neuroligin-2 OS=Rattus no yes N/A 0.739 0.061 0.549 4e-12
Q69ZK9 836 Neuroligin-2 OS=Mus muscu yes N/A 0.739 0.061 0.549 4e-12
Q8NFZ4 835 Neuroligin-2 OS=Homo sapi no N/A 0.739 0.061 0.549 4e-12
Q9NZ94 848 Neuroligin-3 OS=Homo sapi no N/A 0.739 0.060 0.549 1e-11
Q62889 848 Neuroligin-3 OS=Rattus no no N/A 0.739 0.060 0.549 1e-11
Q8BYM5 825 Neuroligin-3 OS=Mus muscu no N/A 0.739 0.061 0.549 1e-11
Q29550 566 Liver carboxylesterase OS no N/A 0.695 0.084 0.562 3e-11
Q8N0W4 816 Neuroligin-4, X-linked OS no N/A 0.739 0.062 0.509 3e-11
Q8NFZ3 816 Neuroligin-4, Y-linked OS no N/A 0.739 0.062 0.509 4e-11
>sp|Q5XG92|EST4A_HUMAN Carboxylesterase 4A OS=Homo sapiens GN=CES4A PE=2 SV=2 Back     alignment and function desciption
 Score = 71.6 bits (174), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%)

Query: 6   ANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTV--MPDRIIDQ 63
            N+GL+DQ+AAL WVQ+NIA FGGDPGNVT+ G   GA  I+ LM+SP    +  R I Q
Sbjct: 187 GNWGLLDQMAALRWVQENIAAFGGDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQ 246

Query: 64  S 64
           S
Sbjct: 247 S 247




Probable carboxylesterase.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 Back     alignment and function description
>sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 Back     alignment and function description
>sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 Back     alignment and function description
>sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 Back     alignment and function description
>sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 Back     alignment and function description
>sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 Back     alignment and function description
>sp|Q29550|EST1_PIG Liver carboxylesterase OS=Sus scrofa PE=1 SV=1 Back     alignment and function description
>sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 Back     alignment and function description
>sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query69
357603022 985 hypothetical protein KGM_05370 [Danaus p 0.826 0.057 0.947 5e-27
357628577 885 hypothetical protein KGM_05957 [Danaus p 0.826 0.064 0.912 4e-26
270007392 892 hypothetical protein TcasGA2_TC013956 [T 0.826 0.063 0.894 5e-25
91082043 948 PREDICTED: similar to CG34139 CG34139-PA 0.826 0.060 0.894 8e-25
242008356 943 Neuroligin-3 precursor, putative [Pedicu 0.826 0.060 0.877 1e-24
83699893 177 putative carboxylesterase [Plutella xylo 0.811 0.316 0.946 2e-24
345484731 823 PREDICTED: neuroligin-4, Y-linked [Nason 0.811 0.068 0.875 2e-23
328702033 806 PREDICTED: hypothetical protein LOC10016 0.811 0.069 0.875 6e-22
347969281 1001 AGAP003115-PA [Anopheles gambiae str. PE 0.826 0.056 0.789 1e-21
157105752 434 neuroligin, putative [Aedes aegypti] gi| 0.826 0.131 0.789 4e-21
>gi|357603022|gb|EHJ63595.1| hypothetical protein KGM_05370 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 54/57 (94%), Positives = 57/57 (100%)

Query: 1   MKARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMP 57
           +KARVANYGLMDQIAALHWVQQNIALFGGDPGNVTM+GHG+GAACINFLMISPTVMP
Sbjct: 254 LKARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMLGHGSGAACINFLMISPTVMP 310




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357628577|gb|EHJ77860.1| hypothetical protein KGM_05957 [Danaus plexippus] Back     alignment and taxonomy information
>gi|270007392|gb|EFA03840.1| hypothetical protein TcasGA2_TC013956 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91082043|ref|XP_971088.1| PREDICTED: similar to CG34139 CG34139-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242008356|ref|XP_002424972.1| Neuroligin-3 precursor, putative [Pediculus humanus corporis] gi|212508601|gb|EEB12234.1| Neuroligin-3 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|83699893|gb|ABC40816.1| putative carboxylesterase [Plutella xylostella] Back     alignment and taxonomy information
>gi|345484731|ref|XP_003425111.1| PREDICTED: neuroligin-4, Y-linked [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328702033|ref|XP_001947161.2| PREDICTED: hypothetical protein LOC100165743 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|347969281|ref|XP_312799.5| AGAP003115-PA [Anopheles gambiae str. PEST] gi|333468451|gb|EAA44773.5| AGAP003115-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157105752|ref|XP_001649012.1| neuroligin, putative [Aedes aegypti] gi|108880043|gb|EAT44268.1| AAEL004357-PA, partial [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query69
FB|FBgn0083975 1281 CG34139 [Drosophila melanogast 0.782 0.042 0.777 1.6e-18
FB|FBgn0051146 1354 Nlg1 "Neuroligin 1" [Drosophil 0.710 0.036 0.673 1.2e-14
FB|FBgn0083963 1159 CG34127 [Drosophila melanogast 0.797 0.047 0.625 1.6e-14
UNIPROTKB|Q89G82 530 bll6463 "Bll6463 protein" [Bra 0.710 0.092 0.693 4.1e-13
UNIPROTKB|F8WEE9 491 CES4A "Carboxylesterase 4A" [H 0.840 0.118 0.583 3.4e-12
UNIPROTKB|F5H5S4 514 CES4A "Carboxylesterase 4A" [H 0.840 0.112 0.583 3.7e-12
UNIPROTKB|Q5XG92 561 CES4A "Carboxylesterase 4A" [H 0.840 0.103 0.583 4.3e-12
UNIPROTKB|Q0VCI3 558 CES1 "Carboxylesterase 1 (Mono 0.681 0.084 0.595 3.1e-11
UNIPROTKB|F1MTP2 566 CES1 "Uncharacterized protein" 0.681 0.083 0.595 3.2e-11
UNIPROTKB|Q3SZM8 401 BREH1 "BREH1 protein" [Bos tau 0.681 0.117 0.595 3.5e-11
FB|FBgn0083975 CG34139 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 237 (88.5 bits), Expect = 1.6e-18, P = 1.6e-18
 Identities = 42/54 (77%), Positives = 49/54 (90%)

Query:     3 ARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVM 56
             ARVANYGLMDQ+AALHW+QQNI  FGGDP +VT+ GHGTGAACIN+LM SPT++
Sbjct:   219 ARVANYGLMDQMAALHWIQQNIQKFGGDPNSVTLAGHGTGAACINYLMTSPTMV 272




GO:0004091 "carboxylesterase activity" evidence=IKR;NAS
GO:0042043 "neurexin family protein binding" evidence=ISS;IBA
GO:0004872 "receptor activity" evidence=IBA
GO:0045202 "synapse" evidence=IBA
GO:0005887 "integral to plasma membrane" evidence=IBA
GO:0007416 "synapse assembly" evidence=IBA
GO:0009986 "cell surface" evidence=IBA
FB|FBgn0051146 Nlg1 "Neuroligin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0083963 CG34127 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q89G82 bll6463 "Bll6463 protein" [Bradyrhizobium japonicum USDA 110 (taxid:224911)] Back     alignment and assigned GO terms
UNIPROTKB|F8WEE9 CES4A "Carboxylesterase 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H5S4 CES4A "Carboxylesterase 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XG92 CES4A "Carboxylesterase 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VCI3 CES1 "Carboxylesterase 1 (Monocyte/macrophage serine esterase 1)" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTP2 CES1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZM8 BREH1 "BREH1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q62888NLGN2_RATNo assigned EC number0.54900.73910.0610yesN/A
P86325EST1_THEFU3, ., 1, ., 1, ., 10.60410.69560.0965yesN/A
Q47M62EST1_THEFY3, ., 1, ., 1, ., 10.60410.69560.0965yesN/A
Q69ZK9NLGN2_MOUSENo assigned EC number0.54900.73910.0610yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 4e-25
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 3e-19
COG2272 491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 5e-19
COG0657 312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 2e-04
pfam07859207 pfam07859, Abhydrolase_3, alpha/beta hydrolase fol 0.001
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information
 Score = 95.5 bits (238), Expect = 4e-25
 Identities = 27/48 (56%), Positives = 35/48 (72%)

Query: 7   NYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPT 54
           N GL+DQ+ AL WV+ NIA FGGDP NVT+ G   GAA ++ L++SP 
Sbjct: 157 NAGLLDQVLALRWVKDNIAAFGGDPDNVTLFGESAGAASVSLLLLSPA 204


Length = 510

>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|219611 pfam07859, Abhydrolase_3, alpha/beta hydrolase fold Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 69
PF00135 535 COesterase: Carboxylesterase family The prints ent 99.82
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 99.71
KOG4389|consensus 601 99.71
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.71
KOG1516|consensus 545 99.7
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.41
COG0657 312 Aes Esterase/lipase [Lipid metabolism] 99.38
PRK10162 318 acetyl esterase; Provisional 99.2
PF00326 213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.02
KOG1515|consensus 336 98.96
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 98.54
PF10340 374 DUF2424: Protein of unknown function (DUF2424); In 98.52
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 98.48
COG0400207 Predicted esterase [General function prediction on 98.4
PRK11460232 putative hydrolase; Provisional 98.27
PF10503220 Esterase_phd: Esterase PHB depolymerase 98.2
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 98.16
PRK10115 686 protease 2; Provisional 98.09
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.07
PRK13604 307 luxD acyl transferase; Provisional 98.01
PLN02442 283 S-formylglutathione hydrolase 97.95
PF08538 303 DUF1749: Protein of unknown function (DUF1749); In 97.92
PLN00021 313 chlorophyllase 97.88
KOG4627|consensus270 97.88
PF12740 259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 97.86
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.84
COG3509 312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 97.83
PRK10566 249 esterase; Provisional 97.83
KOG2100|consensus 755 97.81
PLN02298 330 hydrolase, alpha/beta fold family protein 97.8
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 97.76
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 97.75
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 97.72
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 97.67
PHA02857 276 monoglyceride lipase; Provisional 97.6
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 97.59
PRK10985 324 putative hydrolase; Provisional 97.59
COG0412236 Dienelactone hydrolase and related enzymes [Second 97.54
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 97.52
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 97.51
KOG1552|consensus258 97.49
COG1770 682 PtrB Protease II [Amino acid transport and metabol 97.48
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 97.46
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 97.44
PF00561 230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 97.44
PLN02385 349 hydrolase; alpha/beta fold family protein 97.42
PRK10749 330 lysophospholipase L2; Provisional 97.42
KOG2281|consensus 867 97.36
KOG4388|consensus 880 97.35
PRK05077 414 frsA fermentation/respiration switch protein; Revi 97.33
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 97.32
COG4099387 Predicted peptidase [General function prediction o 97.31
PF10230 266 DUF2305: Uncharacterised conserved protein (DUF230 97.27
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 97.22
PF08840 213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 97.22
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 97.17
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 97.17
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.16
PLN02824 294 hydrolase, alpha/beta fold family protein 97.15
PF11187 224 DUF2974: Protein of unknown function (DUF2974); In 97.14
PRK10673 255 acyl-CoA esterase; Provisional 97.11
PF11144 403 DUF2920: Protein of unknown function (DUF2920); In 97.09
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 97.06
KOG4409|consensus 365 97.05
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 97.04
PLN02652 395 hydrolase; alpha/beta fold family protein 97.0
KOG2112|consensus206 96.98
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 96.96
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 96.95
PLN02511 388 hydrolase 96.95
PRK03204 286 haloalkane dehalogenase; Provisional 96.94
PLN02965 255 Probable pheophorbidase 96.94
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 96.91
PLN02894 402 hydrolase, alpha/beta fold family protein 96.91
PRK03592 295 haloalkane dehalogenase; Provisional 96.88
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 96.88
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 96.82
PF03403 379 PAF-AH_p_II: Platelet-activating factor acetylhydr 96.79
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 96.79
PF00151 331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 96.74
PLN02211 273 methyl indole-3-acetate methyltransferase 96.7
PRK00870 302 haloalkane dehalogenase; Provisional 96.69
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 96.69
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 96.63
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 96.6
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 96.6
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 96.59
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 96.56
KOG2237|consensus 712 96.45
PLN02872 395 triacylglycerol lipase 96.44
PF02129 272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 96.33
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 96.33
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 96.25
PLN02408 365 phospholipase A1 96.24
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 96.2
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 96.15
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 96.15
PRK10349 256 carboxylesterase BioH; Provisional 96.1
PLN02454 414 triacylglycerol lipase 96.05
PF06500 411 DUF1100: Alpha/beta hydrolase of unknown function 95.95
PF06028 255 DUF915: Alpha/beta hydrolase of unknown function ( 95.94
PF07224 307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 95.93
PF12715 390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 95.91
PRK11071190 esterase YqiA; Provisional 95.89
PLN02679 360 hydrolase, alpha/beta fold family protein 95.87
PRK08775 343 homoserine O-acetyltransferase; Provisional 95.83
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 95.81
COG1647 243 Esterase/lipase [General function prediction only] 95.75
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 95.65
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 95.62
PRK06765 389 homoserine O-acetyltransferase; Provisional 95.6
PLN02802 509 triacylglycerol lipase 95.56
PLN02578 354 hydrolase 95.5
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 95.49
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 95.4
PLN02571 413 triacylglycerol lipase 95.39
PLN02324 415 triacylglycerol lipase 95.33
PLN02753 531 triacylglycerol lipase 95.28
COG0627 316 Predicted esterase [General function prediction on 95.22
PLN02761 527 lipase class 3 family protein 95.18
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 95.14
PF09752 348 DUF2048: Uncharacterized conserved protein (DUF204 95.03
KOG1455|consensus 313 95.03
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 94.9
PLN02719 518 triacylglycerol lipase 94.88
PLN02310 405 triacylglycerol lipase 94.77
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 94.75
PRK06489 360 hypothetical protein; Provisional 94.73
KOG4840|consensus 299 94.69
PF00975 229 Thioesterase: Thioesterase domain; InterPro: IPR00 94.57
PF03283 361 PAE: Pectinacetylesterase 94.53
PLN03037 525 lipase class 3 family protein; Provisional 94.51
PRK07581 339 hypothetical protein; Validated 94.46
PRK07868 994 acyl-CoA synthetase; Validated 94.43
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 94.33
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 94.29
PF05057 217 DUF676: Putative serine esterase (DUF676); InterPr 94.22
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 94.18
KOG2564|consensus 343 93.96
COG2945210 Predicted hydrolase of the alpha/beta superfamily 93.87
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 93.81
KOG2183|consensus 492 93.68
PLN02847 633 triacylglycerol lipase 93.58
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 93.53
KOG3975|consensus 301 93.51
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 93.31
PLN00413 479 triacylglycerol lipase 93.26
KOG1838|consensus 409 93.2
PF03583 290 LIP: Secretory lipase ; InterPro: IPR005152 This e 93.05
KOG3724|consensus 973 93.02
COG4814 288 Uncharacterized protein with an alpha/beta hydrola 92.76
KOG3043|consensus242 92.29
PF06342 297 DUF1057: Alpha/beta hydrolase of unknown function 92.18
KOG2551|consensus230 92.16
KOG2382|consensus 315 92.01
KOG3847|consensus 399 91.58
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 91.31
PF05677 365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 91.31
PLN02162 475 triacylglycerol lipase 90.92
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 90.62
COG4947227 Uncharacterized protein conserved in bacteria [Fun 90.54
KOG3101|consensus 283 90.53
KOG4391|consensus 300 90.47
KOG4569|consensus 336 89.76
PRK05855 582 short chain dehydrogenase; Validated 89.75
KOG2984|consensus 277 89.64
PLN02934 515 triacylglycerol lipase 89.49
COG1075 336 LipA Predicted acetyltransferases and hydrolases w 89.38
COG4757 281 Predicted alpha/beta hydrolase [General function p 89.3
COG1505 648 Serine proteases of the peptidase family S9A [Amin 89.24
KOG1454|consensus 326 89.12
KOG4178|consensus 322 88.96
COG2021 368 MET2 Homoserine acetyltransferase [Amino acid tran 88.81
COG3458 321 Acetyl esterase (deacetylase) [Secondary metabolit 88.5
PF08237 225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 88.19
COG3208 244 GrsT Predicted thioesterase involved in non-riboso 87.82
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 87.53
COG2936 563 Predicted acyl esterases [General function predict 87.53
PRK04940180 hypothetical protein; Provisional 87.44
KOG4667|consensus 269 87.05
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 86.75
COG4188 365 Predicted dienelactone hydrolase [General function 86.62
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 86.56
KOG1553|consensus 517 86.51
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 86.5
TIGR01849 406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 85.77
COG4782 377 Uncharacterized protein conserved in bacteria [Fun 84.97
PF09994 277 DUF2235: Uncharacterized alpha/beta hydrolase doma 84.45
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 84.43
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 81.62
TIGR03712 511 acc_sec_asp2 accessory Sec system protein Asp2. Th 81.5
PF02089 279 Palm_thioest: Palmitoyl protein thioesterase; Inte 81.19
cd01826 305 acyloxyacyl_hydrolase_like Acyloxyacyl-hydrolase l 80.5
KOG2624|consensus 403 80.05
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
Probab=99.82  E-value=1.2e-20  Score=129.73  Aligned_cols=62  Identities=53%  Similarity=0.880  Sum_probs=57.7

Q ss_pred             cCChhHHHHHHHHHHHHHhhHHhCCCCCcEEEEecChHHHHHHHHHhCCCc--cccceeecccc
Q psy4013           5 VANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTV--MPDRIIDQSSW   66 (69)
Q Consensus         5 ~~n~~~~D~~~al~wi~~~~~~~~~d~~~i~l~G~SaGa~l~~~~~~~~~~--~~~~~i~~sg~   66 (69)
                      ++|+|+.|++.||+||++||+.|||||+||+|+|+||||..+..+++++..  +++++|.+||.
T Consensus       181 ~gN~Gl~Dq~~AL~WV~~nI~~FGGDp~~VTl~G~SAGa~sv~~~l~sp~~~~LF~raI~~SGs  244 (535)
T PF00135_consen  181 SGNYGLLDQRLALKWVQDNIAAFGGDPDNVTLFGQSAGAASVSLLLLSPSSKGLFHRAILQSGS  244 (535)
T ss_dssp             BSTHHHHHHHHHHHHHHHHGGGGTEEEEEEEEEEETHHHHHHHHHHHGGGGTTSBSEEEEES--
T ss_pred             chhhhhhhhHHHHHHHHhhhhhcccCCcceeeeeecccccccceeeeccccccccccccccccc
Confidence            399999999999999999999999999999999999999999999999864  89999999994



Among the different types are those which act on carboxylic esters (3.1.1 from EC). Carboxyl-esterases have been classified into three categories (A, B and C) on the basis of differential patterns of inhibition by organophosphates. The sequence of a number of type-B carboxylesterases indicates [, , ] that the majority are evolutionary related. As is the case for lipases and serine proteases, the catalytic apparatus of esterases involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.; PDB: 3B3Q_A 1CLE_B 1GQS_A 2VJD_A 1HBJ_A 2C5G_A 1U65_A 2WG1_A 1FSS_A 3M3D_A ....

>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>KOG4389|consensus Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>KOG4388|consensus Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>KOG2237|consensus Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>KOG4840|consensus Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>KOG2183|consensus Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG3975|consensus Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>KOG3724|consensus Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG3043|consensus Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>KOG2551|consensus Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>KOG4569|consensus Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG2984|consensus Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG4667|consensus Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1553|consensus Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09994 DUF2235: Uncharacterized alpha/beta hydrolase domain (DUF2235); InterPro: IPR018712 This domain has no known function Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>cd01826 acyloxyacyl_hydrolase_like Acyloxyacyl-hydrolase like subfamily of the SGNH-hydrolase family Back     alignment and domain information
>KOG2624|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
3bl8_A 580 Crystal Structure Of The Extracellular Domain Of Ne 5e-13
3be8_A 588 Crystal Structure Of The Synaptic Protein Neuroligi 3e-12
1k4y_A 534 Crystal Structure Of Rabbit Liver Carboxylesterase 2e-11
2ogt_A 498 Crystal Structure Of The Geobacillus Stearothermoph 2e-11
2ogs_A 498 Crystal Structure Of The Geobacillus Stearothermoph 3e-11
3vkf_A 585 Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COM 6e-11
3b3q_A 577 Crystal Structure Of A Synaptic Adhesion Complex Le 8e-11
3biw_A 574 Crystal Structure Of The Neuroligin-1NEUREXIN-1beta 8e-11
1mx1_A 548 Crystal Structure Of Human Liver Carboxylesterase I 1e-10
2dqy_A 542 Crystal Structure Of Human Carboxylesterase In Comp 1e-10
1ya4_A 532 Crystal Structure Of Human Liver Carboxylesterase 1 1e-10
3k9b_A 529 Crystal Structure Of Human Liver Carboxylesterase 1 1e-10
1f8u_A 583 Crystal Structure Of Mutant E202q Of Human Acetylch 2e-10
4ey4_A 542 Crystal Structure Of Recombinant Human Acetylcholin 3e-10
3lii_A 540 Recombinant Human Acetylcholinesterase Length = 540 3e-10
1b41_A 539 Human Acetylcholinesterase Complexed With Fasciculi 3e-10
2x8b_A 583 Crystal Structure Of Human Acetylcholinesterase Inh 3e-10
4aqd_A 531 Crystal Structure Of Fully Glycosylated Human Butyr 5e-10
2xmb_A 529 G117h Mutant Of Human Butyrylcholinesterase In Comp 5e-10
2wil_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 5e-10
1p0i_A 529 Crystal Structure Of Human Butyryl Cholinesterase L 6e-10
2wif_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 6e-10
2wid_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 6e-10
2wsl_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 6e-10
2j4c_A 529 Structure Of Human Butyrylcholinesterase In Complex 6e-10
2xqf_A 527 X-Ray Structure Of Human Butyrylcholinesterase Inhi 6e-10
3o9m_A 574 Co-Crystallization Studies Of Full Length Recombina 6e-10
2pm8_A 574 Crystal Structure Of Recombinant Full Length Human 7e-10
1jmy_A 522 Truncated Recombinant Human Bile Salt Stimulated Li 8e-10
4b0o_A 529 Crystal Structure Of Soman-Aged Human Butyrylcholin 8e-10
2y1k_A 529 Structure Of Human Butyrylcholinesterase Inhibited 8e-10
3djy_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 8e-10
4axb_A 527 Crystal Structure Of Soman-aged Human Butyrylcholin 8e-10
1f6w_A 533 Structure Of The Catalytic Domain Of Human Bile Sal 1e-09
2ha4_A 543 Crystal Structure Of Mutant S203a Of Mouse Acetylch 1e-09
1ku6_A 549 Fasciculin 2-Mouse Acetylcholinesterase Complex Len 1e-09
1maa_A 547 Mouse Acetylcholinesterase Catalytic Domain, Glycos 1e-09
2c0p_A 548 Aged Form Of Mouse Acetylcholinesterase Inhibited B 1e-09
1q83_A 580 Crystal Structure Of The Mouse Acetylcholinesterase 1e-09
1mah_A 543 Fasciculin2-Mouse Acetylcholinesterase Complex Leng 1e-09
1n5m_A 541 Crystal Structure Of The Mouse Acetylcholinesterase 1e-09
4a16_A 545 Structure Of Mouse Acetylcholinesterase Complex Wit 1e-09
2xuf_A 544 Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Comple 1e-09
2xud_A 543 Crystal Structure Of The Y337a Mutant Of Mouse Acet 1e-09
1c2b_A 540 Electrophorus Electricus Acetylcholinesterase Lengt 1e-09
1c2o_A 539 Electrophorus Electricus Acetylcholinesterase Lengt 1e-09
2whp_B 548 Crystal Structure Of Acetylcholinesterase, Phosphon 2e-09
1c7i_A 489 Thermophylic Pnb Esterase Length = 489 2e-09
2jgf_A 548 Crystal Structure Of Mouse Acetylcholinesterase Inh 2e-09
1c7j_A 489 Pnb Esterase 56c8 Length = 489 2e-09
1qe3_A 489 Pnb Esterase Length = 489 2e-09
1aql_A 532 Crystal Structure Of Bovine Bile-Salt Activated Lip 4e-09
1akn_A 579 Structure Of Bile-salt Activated Lipase Length = 57 5e-09
1som_A 543 Torpedo Californica Acetylcholinesterase Inhibited 1e-08
1ut6_A 537 Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Co 1e-08
2w6c_X 586 Ache In Complex With A Bis-(-)-Nor-Meptazinol Deriv 1e-08
1fss_A 537 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 1e-08
1gqr_A 532 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 1e-08
3i6m_A 534 3d Structure Of Torpedo Californica Acetylcholinest 1e-08
2cek_A 535 Conformational Flexibility In The Peripheral Site O 1e-08
1eea_A 534 Acetylcholinesterase Length = 534 1e-08
2dfp_A 534 X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluo 2e-08
3gel_A 532 O-Methylphosphorylated Torpedo Acetylcholinesterase 2e-08
2c58_A 537 Torpedo Californica Acetylcholinesterase In Complex 2e-08
2bce_A 579 Cholesterol Esterase From Bos Taurus Length = 579 2e-08
3dl7_A 538 Aged Form Of Mouse Acetylcholinesterase Inhibited B 4e-08
2jgj_A 536 Crystal Structure Of Mouse Acetylcholinesterase Inh 4e-08
2jge_B 533 Crystal Structure Of Mouse Acetylcholinesterase Inh 4e-08
2jgj_B 535 Crystal Structure Of Mouse Acetylcholinesterase Inh 4e-08
3dl7_B 534 Aged Form Of Mouse Acetylcholinesterase Inhibited B 4e-08
2fj0_A 551 Crystal Structure Of Juvenile Hormone Esterase From 2e-07
1crl_A 534 Insights Into Interfacial Activation From An 'open' 7e-06
1thg_A 544 1.8 Angstroms Refined Structure Of The Lipase From 1e-05
1lpm_A 549 A Structural Basis For The Chiral Preferences Of Li 1e-05
1ukc_A 522 Crystal Structure Of Aspergillus Niger Esta Length 2e-05
1dx4_A 585 Ache From Drosophila Melanogaster Complex With Tacr 4e-05
1gz7_A 534 Crystal Structure Of The Closed State Of Lipase 2 F 4e-05
1cle_A 534 Structure Of Uncomplexed And Linoleate-Bound Candid 5e-05
1llf_A 534 Cholesterol Esterase (Candida Cylindracea) Crystal 5e-05
>pdb|3BL8|A Chain A, Crystal Structure Of The Extracellular Domain Of Neuroligin 2a From Mouse Length = 580 Back     alignment and structure

Iteration: 1

Score = 69.3 bits (168), Expect = 5e-13, Method: Composition-based stats. Identities = 28/51 (54%), Positives = 38/51 (74%) Query: 2 KARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMIS 52 +A NYGL+DQI AL W+ +NIA FGGDP +T+ G G GA+C+N L++S Sbjct: 188 QAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILS 238
>pdb|3BE8|A Chain A, Crystal Structure Of The Synaptic Protein Neuroligin 4 Length = 588 Back     alignment and structure
>pdb|1K4Y|A Chain A, Crystal Structure Of Rabbit Liver Carboxylesterase In Complex With 4- Piperidino-Piperidine Length = 534 Back     alignment and structure
>pdb|2OGT|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.8 Length = 498 Back     alignment and structure
>pdb|2OGS|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.2 Length = 498 Back     alignment and structure
>pdb|3VKF|A Chain A, Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COMPLEX Length = 585 Back     alignment and structure
>pdb|3B3Q|A Chain A, Crystal Structure Of A Synaptic Adhesion Complex Length = 577 Back     alignment and structure
>pdb|3BIW|A Chain A, Crystal Structure Of The Neuroligin-1NEUREXIN-1beta Synaptic Adhesion Complex Length = 574 Back     alignment and structure
>pdb|1MX1|A Chain A, Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine Length = 548 Back     alignment and structure
>pdb|2DQY|A Chain A, Crystal Structure Of Human Carboxylesterase In Complex With Cholate And Palmitate Length = 542 Back     alignment and structure
>pdb|1YA4|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 In Complex With Tamoxifen Length = 532 Back     alignment and structure
>pdb|3K9B|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 (Hce1) In Covalent Complex With The Nerve Agent Cyclosarin (Gf) Length = 529 Back     alignment and structure
>pdb|1F8U|A Chain A, Crystal Structure Of Mutant E202q Of Human Acetylcholinesterase Complexed With Green Mamba Venom Peptide Fasciculin-ii Length = 583 Back     alignment and structure
>pdb|4EY4|A Chain A, Crystal Structure Of Recombinant Human Acetylcholinesterase In The Apo State Length = 542 Back     alignment and structure
>pdb|3LII|A Chain A, Recombinant Human Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1B41|A Chain A, Human Acetylcholinesterase Complexed With Fasciculin-Ii, Glycosylated Protein Length = 539 Back     alignment and structure
>pdb|2X8B|A Chain A, Crystal Structure Of Human Acetylcholinesterase Inhibited By Aged Tabun And Complexed With Fasciculin-Ii Length = 583 Back     alignment and structure
>pdb|4AQD|A Chain A, Crystal Structure Of Fully Glycosylated Human Butyrylcholinesterase Length = 531 Back     alignment and structure
>pdb|2XMB|A Chain A, G117h Mutant Of Human Butyrylcholinesterase In Complex With Sulfate Length = 529 Back     alignment and structure
>pdb|2WIL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta5 Length = 529 Back     alignment and structure
>pdb|1P0I|A Chain A, Crystal Structure Of Human Butyryl Cholinesterase Length = 529 Back     alignment and structure
>pdb|2WIF|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|2WID|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|2WSL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta4 Length = 529 Back     alignment and structure
>pdb|2J4C|A Chain A, Structure Of Human Butyrylcholinesterase In Complex With 10mm Hgcl2 Length = 529 Back     alignment and structure
>pdb|2XQF|A Chain A, X-Ray Structure Of Human Butyrylcholinesterase Inhibited By Racemic Vx Length = 527 Back     alignment and structure
>pdb|3O9M|A Chain A, Co-Crystallization Studies Of Full Length Recombinant Bche With Cocaine Offers Insights Into Cocaine Detoxification Length = 574 Back     alignment and structure
>pdb|2PM8|A Chain A, Crystal Structure Of Recombinant Full Length Human Butyrylcholinesterase Length = 574 Back     alignment and structure
>pdb|1JMY|A Chain A, Truncated Recombinant Human Bile Salt Stimulated Lipase Length = 522 Back     alignment and structure
>pdb|4B0O|A Chain A, Crystal Structure Of Soman-Aged Human Butyrylcholinesterase In Complex With Benzyl Pyridinium-4-Methyltrichloroacetimidate Length = 529 Back     alignment and structure
>pdb|2Y1K|A Chain A, Structure Of Human Butyrylcholinesterase Inhibited By Cbdp ( 12h Soak): Phosphoserine Adduct Length = 529 Back     alignment and structure
>pdb|3DJY|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Length = 529 Back     alignment and structure
>pdb|4AXB|A Chain A, Crystal Structure Of Soman-aged Human Butyrylcholinesterase In Complex With 2-pam Length = 527 Back     alignment and structure
>pdb|1F6W|A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase Length = 533 Back     alignment and structure
>pdb|2HA4|A Chain A, Crystal Structure Of Mutant S203a Of Mouse Acetylcholinesterase Complexed With Acetylcholine Length = 543 Back     alignment and structure
>pdb|1KU6|A Chain A, Fasciculin 2-Mouse Acetylcholinesterase Complex Length = 549 Back     alignment and structure
>pdb|1MAA|A Chain A, Mouse Acetylcholinesterase Catalytic Domain, Glycosylated Protein Length = 547 Back     alignment and structure
>pdb|2C0P|A Chain A, Aged Form Of Mouse Acetylcholinesterase Inhibited By Tabun Length = 548 Back     alignment and structure
>pdb|1Q83|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Tz2pa6 Syn Complex Length = 580 Back     alignment and structure
>pdb|1MAH|A Chain A, Fasciculin2-Mouse Acetylcholinesterase Complex Length = 543 Back     alignment and structure
>pdb|1N5M|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Gallamine Complex Length = 541 Back     alignment and structure
>pdb|4A16|A Chain A, Structure Of Mouse Acetylcholinesterase Complex With Huprine Derivative Length = 545 Back     alignment and structure
>pdb|2XUF|A Chain A, Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Complex (1 Mth) Length = 544 Back     alignment and structure
>pdb|2XUD|A Chain A, Crystal Structure Of The Y337a Mutant Of Mouse Acetylcholinesterase Length = 543 Back     alignment and structure
>pdb|1C2B|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1C2O|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 539 Back     alignment and structure
>pdb|2WHP|B Chain B, Crystal Structure Of Acetylcholinesterase, Phosphonylated By Sarin And In Complex With Hi-6 Length = 548 Back     alignment and structure
>pdb|1C7I|A Chain A, Thermophylic Pnb Esterase Length = 489 Back     alignment and structure
>pdb|2JGF|A Chain A, Crystal Structure Of Mouse Acetylcholinesterase Inhibited By Non-Aged Fenamiphos Length = 548 Back     alignment and structure
>pdb|1C7J|A Chain A, Pnb Esterase 56c8 Length = 489 Back     alignment and structure
>pdb|1QE3|A Chain A, Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1AQL|A Chain A, Crystal Structure Of Bovine Bile-Salt Activated Lipase Complexed With Taurocholate Length = 532 Back     alignment and structure
>pdb|1AKN|A Chain A, Structure Of Bile-salt Activated Lipase Length = 579 Back     alignment and structure
>pdb|1SOM|A Chain A, Torpedo Californica Acetylcholinesterase Inhibited By Nerve Agent Gd (Soman). Length = 543 Back     alignment and structure
>pdb|1UT6|A Chain A, Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Complexed With N-9-(1',2',3',4'-Tetrahydroacridinyl)-1,8- Diaminooctane At 2.4 Angstroms Resolution. Length = 537 Back     alignment and structure
>pdb|2W6C|X Chain X, Ache In Complex With A Bis-(-)-Nor-Meptazinol Derivative Length = 586 Back     alignment and structure
>pdb|1FSS|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Fasciculin-Ii Length = 537 Back     alignment and structure
>pdb|1GQR|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Rivastigmine Length = 532 Back     alignment and structure
>pdb|3I6M|A Chain A, 3d Structure Of Torpedo Californica Acetylcholinesterase Complexed With N-Piperidinopropyl-Galanthamine Length = 534 Back     alignment and structure
>pdb|2CEK|A Chain A, Conformational Flexibility In The Peripheral Site Of Torpedo Californica Acetylcholinesterase Revealed By The Complex Structure With A Bifunctional Inhibitor Length = 535 Back     alignment and structure
>pdb|1EEA|A Chain A, Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|2DFP|A Chain A, X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluoridate (Dfp) Bound To Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|3GEL|A Chain A, O-Methylphosphorylated Torpedo Acetylcholinesterase Obtained By Reaction With Methyl Paraoxon (Aged) Length = 532 Back     alignment and structure
>pdb|2C58|A Chain A, Torpedo Californica Acetylcholinesterase In Complex With 20mm Acetylthiocholine Length = 537 Back     alignment and structure
>pdb|2BCE|A Chain A, Cholesterol Esterase From Bos Taurus Length = 579 Back     alignment and structure
>pdb|2FJ0|A Chain A, Crystal Structure Of Juvenile Hormone Esterase From Manduca Sexta, With Otfp Covalently Attached Length = 551 Back     alignment and structure
>pdb|1CRL|A Chain A, Insights Into Interfacial Activation From An 'open' Structure Of Candida Rugosa Lipase Length = 534 Back     alignment and structure
>pdb|1THG|A Chain A, 1.8 Angstroms Refined Structure Of The Lipase From Geotrichum Candidum Length = 544 Back     alignment and structure
>pdb|1LPM|A Chain A, A Structural Basis For The Chiral Preferences Of Lipases Length = 549 Back     alignment and structure
>pdb|1UKC|A Chain A, Crystal Structure Of Aspergillus Niger Esta Length = 522 Back     alignment and structure
>pdb|1DX4|A Chain A, Ache From Drosophila Melanogaster Complex With Tacrine Derivative 9-(3-Phenylmethylamino)-1,2,3,4-Tetrahydroacridine Length = 585 Back     alignment and structure
>pdb|1GZ7|A Chain A, Crystal Structure Of The Closed State Of Lipase 2 From Candida Rugosa Length = 534 Back     alignment and structure
>pdb|1CLE|A Chain A, Structure Of Uncomplexed And Linoleate-Bound Candida Cylindracea Cholesterol Esterase Length = 534 Back     alignment and structure
>pdb|1LLF|A Chain A, Cholesterol Esterase (Candida Cylindracea) Crystal Structure At 1.4a Resolution Length = 534 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 1e-27
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 3e-27
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 8e-27
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 9e-27
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 2e-26
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 2e-26
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 2e-26
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 2e-24
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 3e-24
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 5e-24
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 9e-23
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 4e-22
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 8e-21
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 2e-04
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
 Score =  102 bits (255), Expect = 1e-27
 Identities = 28/61 (45%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 7   NYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMPD---RIIDQ 63
           NYGL+D I AL W  +NI  FGGDP  +T+ G G G +C+N L +S         R I Q
Sbjct: 186 NYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEKGLFQRAIAQ 245

Query: 64  S 64
           S
Sbjct: 246 S 246


>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query69
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 99.67
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 99.66
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 99.65
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.64
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 99.64
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.64
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 99.64
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.63
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.62
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.62
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.61
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 99.58
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.56
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 99.16
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.07
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 99.05
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.04
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.98
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.96
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 98.94
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.93
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 98.93
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 98.92
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 98.92
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.91
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.9
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.89
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.87
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.86
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.84
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 98.83
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 98.8
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.74
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 98.72
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.67
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.65
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 98.65
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.65
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.63
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.61
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 98.59
4f21_A246 Carboxylesterase/phospholipase family protein; str 98.56
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.56
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.54
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.53
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.52
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 98.49
3h04_A 275 Uncharacterized protein; protein with unknown func 98.48
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 98.46
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 98.45
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.44
2uz0_A 263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.4
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.39
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.35
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.35
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 98.33
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.33
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.32
2gzs_A 278 IROE protein; enterobactin, salmochelin, DFP, hydr 98.32
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 98.32
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.32
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.31
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.29
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.29
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 98.28
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.27
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.27
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.25
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 98.24
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 98.23
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.22
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.21
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.21
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.18
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.18
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.17
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 98.17
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.16
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.15
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 98.14
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.14
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 98.13
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.13
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.12
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.12
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.08
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 98.05
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.05
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.03
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 98.0
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 98.0
4b6g_A 283 Putative esterase; hydrolase, formaldehyde detoxif 98.0
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 98.0
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 97.99
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 97.98
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 97.97
1gkl_A 297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 97.96
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 97.93
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 97.92
3llc_A 270 Putative hydrolase; structural genomics, joint cen 97.9
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 97.85
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 97.82
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 97.81
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 97.8
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 97.78
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 97.76
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 97.76
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 97.71
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 97.7
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 97.69
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 97.69
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 97.67
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 97.65
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 97.64
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 97.64
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 97.63
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 97.63
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 97.63
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 97.6
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 97.6
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 97.58
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 97.58
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 97.57
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 97.57
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 97.57
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 97.56
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 97.56
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 97.56
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 97.55
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 97.54
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 97.54
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 97.54
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 97.54
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 97.52
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 97.52
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 97.52
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 97.51
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 97.51
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 97.51
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 97.5
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.48
3pic_A 375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 97.47
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 97.47
1r3d_A 264 Conserved hypothetical protein VC1974; structural 97.47
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 97.46
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 97.46
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 97.46
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 97.44
3gff_A 331 IROE-like serine hydrolase; NP_718593.1, structura 97.43
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 97.42
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 97.42
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 97.42
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 97.42
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 97.39
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 97.39
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 97.36
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.36
3ds8_A 254 LIN2722 protein; unkonwn function, structural geno 97.35
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 97.35
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 97.34
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 97.34
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 97.33
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 97.32
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 97.29
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 97.29
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 97.29
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 97.29
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 97.28
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 97.28
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.28
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 97.27
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 97.27
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 97.25
4fle_A 202 Esterase; structural genomics, PSI-biology, northe 97.23
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 97.2
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 97.19
1iup_A 282 META-cleavage product hydrolase; aromatic compound 97.18
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 97.18
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 97.17
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.14
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 97.14
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 97.12
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 97.1
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 97.08
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 97.06
4g4g_A 433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 97.06
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 97.05
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 97.05
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 97.05
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 97.05
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 97.04
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 97.04
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 97.02
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 97.01
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 97.0
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 96.99
3fle_A 249 SE_1780 protein; structural genomics, APC61035.1, 96.98
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.97
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 96.95
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 96.95
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 96.94
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 96.94
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 96.93
3lp5_A 250 Putative cell surface hydrolase; structural genom 96.93
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 96.92
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 96.89
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 96.89
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 96.87
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 96.85
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 96.85
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 96.84
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 96.84
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 96.73
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 95.74
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 96.7
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 96.69
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 96.65
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 96.6
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 96.58
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 96.57
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 96.57
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 96.49
1ei9_A 279 Palmitoyl protein thioesterase 1; alpha/beta hydro 96.49
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 96.43
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 96.39
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 96.34
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 96.32
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 96.23
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 96.23
1kez_A 300 Erythronolide synthase; polyketide synthase, modul 95.96
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 95.84
4fol_A 299 FGH, S-formylglutathione hydrolase; D-type esteras 95.71
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 95.69
1tia_A 279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 95.62
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 95.59
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 95.58
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 95.44
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 95.35
3lcr_A 319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 95.26
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 95.08
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 95.07
3uue_A 279 LIP1, secretory lipase (family 3); LID-domain, hyd 94.99
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 94.96
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 94.83
3ngm_A 319 Extracellular lipase; secret lipase, hydrolase; 2. 94.74
3o0d_A 301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 94.7
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 94.59
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 94.25
2k2q_B 242 Surfactin synthetase thioesterase subunit; A/B-hyd 94.22
1ivy_A 452 Human protective protein; carboxypeptidase, serine 94.02
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 93.67
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 93.43
2yij_A 419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 92.31
2ory_A 346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 92.91
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 92.51
2cb9_A 244 Fengycin synthetase; thioesterase, non-ribosomal p 92.18
1jmk_C 230 SRFTE, surfactin synthetase; thioesterase, non-rib 91.6
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 89.6
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 89.43
2hfk_A 319 Pikromycin, type I polyketide synthase pikaiv; alp 89.32
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 86.34
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 83.95
3hc7_A 254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 83.05
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 82.53
3aja_A 302 Putative uncharacterized protein; alpha-beta hydro 80.79
2qub_A 615 Extracellular lipase; beta roll, alpha/beta hydrol 80.74
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
Probab=99.67  E-value=5.5e-17  Score=114.29  Aligned_cols=63  Identities=41%  Similarity=0.729  Sum_probs=58.8

Q ss_pred             ccCChhHHHHHHHHHHHHHhhHHhCCCCCcEEEEecChHHHHHHHHHhCCC--ccccceeecccc
Q psy4013           4 RVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPT--VMPDRIIDQSSW   66 (69)
Q Consensus         4 ~~~n~~~~D~~~al~wi~~~~~~~~~d~~~i~l~G~SaGa~l~~~~~~~~~--~~~~~~i~~sg~   66 (69)
                      .++|+++.|+..|++|+++|++.|||||+||+|+|+||||+++..+++++.  .+++++|.+||.
T Consensus       158 ~pgn~gl~D~~~Al~wv~~ni~~fGgDp~~Vti~G~SAGg~~~~~~~~~~~~~~lf~~ai~~Sg~  222 (579)
T 2bce_A          158 LPGNYGLWDQHMAIAWVKRNIEAFGGDPDQITLFGESAGGASVSLQTLSPYNKGLIKRAISQSGV  222 (579)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHGGGGTEEEEEEEEEEETHHHHHHHHHHHCGGGTTTCSEEEEESCC
T ss_pred             CCCccchHHHHHHHHHHHHHHHHhCCCcccEEEecccccchheeccccCcchhhHHHHHHHhcCC
Confidence            578999999999999999999999999999999999999999999999864  488999999984



>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 69
d1qe3a_ 483 c.69.1.1 (A:) Thermophilic para-nitrobenzyl estera 2e-07
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 3e-07
d2h7ca1 532 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase 6e-07
d1ukca_ 517 c.69.1.17 (A:) Esterase EstA {Aspergillus niger [T 8e-07
d2ha2a1 542 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mu 3e-06
d1ea5a_ 532 c.69.1.1 (A:) Acetylcholinesterase {Pacific electr 7e-06
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Length = 483 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Thermophilic para-nitrobenzyl esterase (PNB esterase)
species: Bacillus subtilis [TaxId: 1423]
 Score = 43.5 bits (101), Expect = 2e-07
 Identities = 26/57 (45%), Positives = 33/57 (57%)

Query: 1   MKARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTVMP 57
            +A   N GL+DQ AAL WV++NI+ FGGDP NVT+ G   G   I  L+  P    
Sbjct: 149 DEAYSDNLGLLDQAAALKWVRENISAFGGDPDNVTVFGESAGGMSIAALLAMPAAKG 205


>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Length = 532 Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Length = 517 Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Length = 542 Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Length = 532 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query69
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 99.84
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 99.83
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 99.82
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 99.82
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 99.81
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 99.81
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 99.81
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 99.8
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 99.79
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 99.79
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.14
d1lzla_ 317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.01
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 98.94
d1u4na_ 308 Carboxylesterase {Alicyclobacillus acidocaldarius 98.91
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 98.85
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.79
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 98.72
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 98.55
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 98.38
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.34
d1xfda2 258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.32
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 98.31
d1dqza_ 280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 98.3
d1r88a_ 267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 98.27
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 98.26
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 98.15
d2bgra2 258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.03
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.91
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 97.81
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 97.8
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 97.78
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 97.78
d1jfra_ 260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 97.64
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 97.6
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.56
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 97.38
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 97.33
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.33
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 97.31
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 97.22
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 97.14
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 97.13
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 97.13
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 97.11
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 97.11
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 97.1
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 97.05
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 97.04
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.0
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 96.94
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 96.92
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 96.91
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 96.9
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 96.89
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 96.79
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 96.79
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 96.77
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 96.7
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 96.63
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 96.6
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 96.6
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 96.58
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 96.57
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 96.54
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 96.5
d1lnsa3 405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 96.22
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 95.97
d1pv1a_ 299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 95.97
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 95.96
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 95.84
d2vata1 376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 95.79
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 95.73
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 95.67
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 95.62
d2b61a1 357 Homoserine O-acetyltransferase {Haemophilus influe 95.6
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 95.53
d1ei9a_ 279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 95.22
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 95.08
d2pl5a1 362 Homoserine O-acetyltransferase {Leptospira interro 95.08
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 95.07
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 94.95
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 94.74
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 94.63
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 94.55
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 94.47
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 93.98
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 93.62
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 93.51
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 93.13
d1qfma2 280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 93.06
d1mo2a_ 255 Erythromycin polyketide synthase {Saccharopolyspor 92.22
d2h7xa1 283 Picromycin polyketide synthase {Streptomyces venez 91.96
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 91.77
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 91.19
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 86.12
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 86.05
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 85.56
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 84.56
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 84.35
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 84.27
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 84.21
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 81.61
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 80.51
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Thermophilic para-nitrobenzyl esterase (PNB esterase)
species: Bacillus subtilis [TaxId: 1423]
Probab=99.84  E-value=7.5e-22  Score=132.46  Aligned_cols=65  Identities=43%  Similarity=0.701  Sum_probs=61.3

Q ss_pred             cccCChhHHHHHHHHHHHHHhhHHhCCCCCcEEEEecChHHHHHHHHHhCCCc--cccceeeccccc
Q psy4013           3 ARVANYGLMDQIAALHWVQQNIALFGGDPGNVTMMGHGTGAACINFLMISPTV--MPDRIIDQSSWL   67 (69)
Q Consensus         3 ~~~~n~~~~D~~~al~wi~~~~~~~~~d~~~i~l~G~SaGa~l~~~~~~~~~~--~~~~~i~~sg~~   67 (69)
                      ..++|+|+.|+..||+||++||+.|||||+||+|+|+||||..+.+++++|..  +++++|.+||..
T Consensus       151 ~~~gN~Gl~Dq~~AL~WV~~nI~~FGGDp~~VTl~G~SAGa~sv~~~l~sp~~~gLF~raI~~SGs~  217 (483)
T d1qe3a_         151 AYSDNLGLLDQAAALKWVRENISAFGGDPDNVTVFGESAGGMSIAALLAMPAAKGLFQKAIMESGAS  217 (483)
T ss_dssp             TSCSCHHHHHHHHHHHHHHHHGGGGTEEEEEEEEEEETHHHHHHHHHTTCGGGTTSCSEEEEESCCC
T ss_pred             ccccccccHHHHHHHHHHHHHHHHcCCCcccceeeccccccchhhhhhcccccCCcceeeccccCCc
Confidence            45899999999999999999999999999999999999999999999999875  899999999964



>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure