Psyllid ID: psy4022
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| 334133048 | 224 | Peptidyl-prolyl cis-trans isomerase [Met | 0.747 | 0.741 | 0.443 | 3e-37 | |
| 163846438 | 237 | FKBP-type peptidyl-prolyl cis-trans isom | 0.756 | 0.708 | 0.411 | 8e-35 | |
| 219849518 | 237 | FKBP-type peptidylprolyl isomerase [Chlo | 0.752 | 0.704 | 0.427 | 8e-35 | |
| 403170356 | 340 | hypothetical protein PGTG_21792 [Puccini | 0.792 | 0.517 | 0.425 | 1e-34 | |
| 195113969 | 370 | GI21928 [Drosophila mojavensis] gi|19391 | 0.396 | 0.237 | 0.772 | 4e-33 | |
| 291612530 | 228 | peptidylprolyl isomerase [Sideroxydans l | 0.774 | 0.754 | 0.432 | 1e-32 | |
| 157135619 | 289 | hypothetical protein AaeL_AAEL003303 [Ae | 0.391 | 0.301 | 0.735 | 3e-32 | |
| 170046878 | 379 | 46 kDa FK506-binding nuclear protein [Cu | 0.391 | 0.229 | 0.735 | 3e-32 | |
| 309792462 | 277 | peptidylprolyl isomerase FKBP-type [Osci | 0.752 | 0.602 | 0.384 | 9e-32 | |
| 242011024 | 417 | 46 kDa FK506-binding nuclear protein, pu | 0.387 | 0.206 | 0.755 | 2e-31 |
| >gi|334133048|ref|ZP_08506803.1| Peptidyl-prolyl cis-trans isomerase [Methyloversatilis universalis FAM5] gi|333441958|gb|EGK69930.1| Peptidyl-prolyl cis-trans isomerase [Methyloversatilis universalis FAM5] | Back alignment and taxonomy information |
|---|
Score = 160 bits (405), Expect = 3e-37, Method: Compositional matrix adjust.
Identities = 87/196 (44%), Positives = 124/196 (63%), Gaps = 30/196 (15%)
Query: 51 SNISVYYVGKLKSNNKQFDSS-TQGPGFKFRLGKGEVIKGWDVGLNGMKVGGKRRITIPA 109
+SV+Y G L ++ ++FDSS + F F+LG G+VI+GWD G+ GMK GG R++TIP
Sbjct: 27 QEVSVHYTGWL-TDGRKFDSSKDRNDPFSFQLGAGQVIRGWDEGVAGMKEGGVRKLTIPP 85
Query: 110 HMAYGNKGSPPAIPPNSTLVFDVEL--------------------------KNISVYYVG 143
+ YG +G+ IPPN+TLVF+VEL + ++V+Y G
Sbjct: 86 QLGYGERGAGGVIPPNATLVFEVELLAVVRNEGELVIEELTPGTGKEAQPGQRVTVHYTG 145
Query: 144 KLKSNNQQFDSS-TQGPGFKFRLGKGEVIKGWDVGLNGMKVGGKRRITIPAHMAYGNKGS 202
L ++ ++FDSS + F F LG G+VI+GWD G+ GMK GG R++TIPAH+ YG +G+
Sbjct: 146 WL-TDGRKFDSSKDRKQPFSFHLGAGQVIRGWDEGVAGMKEGGVRKLTIPAHLGYGRRGA 204
Query: 203 PPAIPPNSTLVFDVEL 218
IPPN+TLVF+VEL
Sbjct: 205 GGVIPPNATLVFEVEL 220
|
Source: Methyloversatilis universalis FAM5 Species: Methyloversatilis universalis Genus: Methyloversatilis Family: Rhodocyclaceae Order: Rhodocyclales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|163846438|ref|YP_001634482.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Chloroflexus aurantiacus J-10-fl] gi|222524212|ref|YP_002568683.1| FKBP-type peptidylprolyl isomerase [Chloroflexus sp. Y-400-fl] gi|163667727|gb|ABY34093.1| peptidylprolyl isomerase FKBP-type [Chloroflexus aurantiacus J-10-fl] gi|222448091|gb|ACM52357.1| peptidylprolyl isomerase FKBP-type [Chloroflexus sp. Y-400-fl] | Back alignment and taxonomy information |
|---|
| >gi|219849518|ref|YP_002463951.1| FKBP-type peptidylprolyl isomerase [Chloroflexus aggregans DSM 9485] gi|219543777|gb|ACL25515.1| peptidylprolyl isomerase FKBP-type [Chloroflexus aggregans DSM 9485] | Back alignment and taxonomy information |
|---|
| >gi|403170356|ref|XP_003889538.1| hypothetical protein PGTG_21792 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375168683|gb|EHS63716.1| hypothetical protein PGTG_21792 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] | Back alignment and taxonomy information |
|---|
| >gi|195113969|ref|XP_002001540.1| GI21928 [Drosophila mojavensis] gi|193918134|gb|EDW17001.1| GI21928 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|291612530|ref|YP_003522687.1| peptidylprolyl isomerase [Sideroxydans lithotrophicus ES-1] gi|291582642|gb|ADE10300.1| Peptidylprolyl isomerase [Sideroxydans lithotrophicus ES-1] | Back alignment and taxonomy information |
|---|
| >gi|157135619|ref|XP_001663513.1| hypothetical protein AaeL_AAEL003303 [Aedes aegypti] gi|108881175|gb|EAT45400.1| AAEL003303-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170046878|ref|XP_001850972.1| 46 kDa FK506-binding nuclear protein [Culex quinquefasciatus] gi|167869480|gb|EDS32863.1| 46 kDa FK506-binding nuclear protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|309792462|ref|ZP_07686926.1| peptidylprolyl isomerase FKBP-type [Oscillochloris trichoides DG-6] gi|308225450|gb|EFO79214.1| peptidylprolyl isomerase FKBP-type [Oscillochloris trichoides DG6] | Back alignment and taxonomy information |
|---|
| >gi|242011024|ref|XP_002426257.1| 46 kDa FK506-binding nuclear protein, putative [Pediculus humanus corporis] gi|212510320|gb|EEB13519.1| 46 kDa FK506-binding nuclear protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| UNIPROTKB|A9WGZ8 | 237 | Caur_0860 "Peptidyl-prolyl cis | 0.387 | 0.362 | 0.5 | 1.4e-40 | |
| FB|FBgn0013269 | 357 | FK506-bp1 "FK506-binding prote | 0.572 | 0.355 | 0.546 | 8.8e-31 | |
| ASPGD|ASPL0000009645 | 479 | FKBP5 [Emericella nidulans (ta | 0.382 | 0.177 | 0.597 | 1.5e-25 | |
| UNIPROTKB|P0C1B0 | 479 | fpr4 "FK506-binding protein 4" | 0.382 | 0.177 | 0.597 | 1.5e-25 | |
| TAIR|locus:2152561 | 578 | ROF2 "AT5G48570" [Arabidopsis | 0.364 | 0.140 | 0.566 | 2.2e-27 | |
| UNIPROTKB|Q7SCN0 | 467 | fpr-4 "FK506-binding protein 4 | 0.396 | 0.188 | 0.588 | 5.1e-27 | |
| UNIPROTKB|Q7F1F2 | 580 | OJ1191_A10.119 "cDNA clone:J03 | 0.364 | 0.139 | 0.542 | 1e-26 | |
| UNIPROTKB|Q6K5Q1 | 682 | P0579G08.8 "Putative peptidylp | 0.364 | 0.118 | 0.554 | 3e-26 | |
| UNIPROTKB|Q9XFE4 | 585 | OSJNBa0091C07.4 "OSJNBa0091C07 | 0.364 | 0.138 | 0.578 | 3.1e-26 | |
| TAIR|locus:2090265 | 562 | ROF1 "AT3G25230" [Arabidopsis | 0.364 | 0.144 | 0.554 | 1.2e-25 |
| UNIPROTKB|A9WGZ8 Caur_0860 "Peptidyl-prolyl cis-trans isomerase" [Chloroflexus aurantiacus J-10-fl (taxid:324602)] | Back alignment and assigned GO terms |
|---|
Score = 229 (85.7 bits), Expect = 1.4e-40, Sum P(2) = 1.4e-40
Identities = 44/88 (50%), Positives = 64/88 (72%)
Query: 135 KNISVYYVGKLKSNNQQFDSS-TQGPGFKFRLGKGEVIKGWDVGLNGMKVGGKRRITIPA 193
+ ++V+Y G L ++ FDSS ++G F F LG G VI+GWD G+ GM+VGG+R++ IPA
Sbjct: 150 RTVTVHYTGWL-TDGSMFDSSLSRGEPFVFPLGAGRVIRGWDEGVAGMRVGGRRQLIIPA 208
Query: 194 HMAYGNKGSPPAIPPNSTLVFDVELKNV 221
+AYGN+G+ IPP +TL+F+VEL V
Sbjct: 209 ALAYGNRGAGGVIPPGATLIFEVELLEV 236
|
|
| FB|FBgn0013269 FK506-bp1 "FK506-binding protein 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000009645 FKBP5 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0C1B0 fpr4 "FK506-binding protein 4" [Aspergillus nidulans FGSC A4 (taxid:227321)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7SCN0 fpr-4 "FK506-binding protein 4" [Neurospora crassa OR74A (taxid:367110)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7F1F2 OJ1191_A10.119 "cDNA clone:J033121G16, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6K5Q1 P0579G08.8 "Putative peptidylprolyl isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9XFE4 OSJNBa0091C07.4 "OSJNBa0091C07.4 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090265 ROF1 "AT3G25230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| COG0545 | 205 | COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans | 8e-33 | |
| COG0545 | 205 | COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans | 2e-32 | |
| pfam00254 | 94 | pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t | 1e-31 | |
| pfam00254 | 94 | pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t | 3e-31 | |
| PRK10902 | 269 | PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- | 5e-16 | |
| PRK10902 | 269 | PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- | 3e-15 | |
| PRK11570 | 206 | PRK11570, PRK11570, peptidyl-prolyl cis-trans isom | 4e-15 | |
| PRK11570 | 206 | PRK11570, PRK11570, peptidyl-prolyl cis-trans isom | 1e-14 | |
| COG1047 | 174 | COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans | 1e-06 | |
| COG1047 | 174 | COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans | 6e-06 |
| >gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 117 bits (295), Expect = 8e-33
Identities = 49/88 (55%), Positives = 59/88 (67%), Gaps = 4/88 (4%)
Query: 48 KKESNISVYYVGKLKSNNKQFDSSTQ-GPGFKFRLGKGEVIKGWDVGLNGMKVGGKRRIT 106
KK ++V+Y G L + FDSS G +F LG VI GWD GL GMKVGGKR++T
Sbjct: 117 KKGDTVTVHYTGTLI-DGTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQGMKVGGKRKLT 173
Query: 107 IPAHMAYGNKGSPPAIPPNSTLVFDVEL 134
IP +AYG +G P IPPNSTLVF+VEL
Sbjct: 174 IPPELAYGERGVPGVIPPNSTLVFEVEL 201
|
Length = 205 |
| >gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| KOG0549|consensus | 188 | 100.0 | ||
| KOG0543|consensus | 397 | 99.96 | ||
| KOG0544|consensus | 108 | 99.95 | ||
| COG0545 | 205 | FkpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.95 | |
| KOG0549|consensus | 188 | 99.94 | ||
| KOG0544|consensus | 108 | 99.93 | ||
| KOG0552|consensus | 226 | 99.91 | ||
| COG0545 | 205 | FkpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.91 | |
| TIGR03516 | 177 | ppisom_GldI peptidyl-prolyl isomerase, gliding mot | 99.86 | |
| TIGR03516 | 177 | ppisom_GldI peptidyl-prolyl isomerase, gliding mot | 99.86 | |
| KOG0552|consensus | 226 | 99.86 | ||
| PF00254 | 94 | FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer | 99.84 | |
| PRK11570 | 206 | peptidyl-prolyl cis-trans isomerase; Provisional | 99.84 | |
| PRK11570 | 206 | peptidyl-prolyl cis-trans isomerase; Provisional | 99.83 | |
| PF00254 | 94 | FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer | 99.82 | |
| PRK15095 | 156 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.78 | |
| COG1047 | 174 | SlpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.76 | |
| PRK10737 | 196 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.76 | |
| PRK10902 | 269 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.75 | |
| PRK10902 | 269 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.73 | |
| KOG0543|consensus | 397 | 99.53 | ||
| PRK15095 | 156 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.51 | |
| COG1047 | 174 | SlpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.3 | |
| PRK10737 | 196 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.27 | |
| TIGR00115 | 408 | tig trigger factor. Trigger factor is a ribosome-a | 99.14 | |
| COG0544 | 441 | Tig FKBP-type peptidyl-prolyl cis-trans isomerase | 99.07 | |
| PRK01490 | 435 | tig trigger factor; Provisional | 99.06 | |
| TIGR00115 | 408 | tig trigger factor. Trigger factor is a ribosome-a | 98.81 | |
| PRK01490 | 435 | tig trigger factor; Provisional | 98.71 | |
| COG0544 | 441 | Tig FKBP-type peptidyl-prolyl cis-trans isomerase | 98.48 | |
| KOG0545|consensus | 329 | 95.85 | ||
| KOG0545|consensus | 329 | 81.73 |
| >KOG0549|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.5e-37 Score=235.63 Aligned_cols=143 Identities=46% Similarity=0.886 Sum_probs=122.1
Q ss_pred EEcCCCcccchHHHHhcCCccCcEEEEecCCccccCCCCCCCC----C----------------CCCcceEEeEEe----
Q psy4022 79 FRLGKGEVIKGWDVGLNGMKVGGKRRITIPAHMAYGNKGSPPA----I----------------PPNSTLVFDVEL---- 134 (222)
Q Consensus 79 ~~lg~~~~i~Gle~al~~m~~Ge~~~v~ip~~~ayg~~g~~~~----i----------------~~~~~lv~~vel---- 134 (222)
|.+|.+.+|+|+++++.+|+.|+++++.+||.++||..+.... + -+...+...+..
T Consensus 1 ~~~g~~~vi~gm~~~~~g~c~ge~rkvv~pp~l~fg~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~I~v~~~p~~ 80 (188)
T KOG0549|consen 1 FTLGQGFVIPGMDQALEGMCNGEKRKVVIPPHLGFGEGGRGDLNILVITILLVLLFRASAAEKWNPDEELQIGVLKKPEE 80 (188)
T ss_pred CcccceEEecCHHHHhhhhhccccceeccCCcccccccccccccceEEEeeeeehhhhhhhhhcCCCCceeEEEEECCcc
Confidence 3578889999999999999999999999999999995543321 0 001112111111
Q ss_pred --------eeEEEEEEEEeccCCcccCCCC-CCCcEEEEeCCCeeeechhhhccCceeccEEEEEecCCCCCCCCCCCCC
Q psy4022 135 --------KNISVYYVGKLKSNNQQFDSST-QGPGFKFRLGKGEVIKGWDVGLNGMKVGGKRRITIPAHMAYGNKGSPPA 205 (222)
Q Consensus 135 --------~~V~v~y~g~~~~~g~~fd~~~-~~~p~~~~lg~g~~i~g~~~~l~~m~~Ge~~~~~vp~~~~yg~~~~~~~ 205 (222)
|.+++||+|.+ .||+.||||+ +++|++|+||.|++|+|||+||.+||+||+|+++|||++|||++|.++.
T Consensus 81 C~~kak~GD~l~~HY~g~l-eDGt~fdSS~~rg~P~~f~LG~gqVIkG~Dqgl~gMCvGEkRkl~IPp~LgYG~~G~~~~ 159 (188)
T KOG0549|consen 81 CPEKAKKGDTLHVHYTGSL-EDGTKFDSSYSRGAPFTFTLGTGQVIKGWDQGLLGMCVGEKRKLIIPPHLGYGERGAPPK 159 (188)
T ss_pred ccccccCCCEEEEEEEEEe-cCCCEEeeeccCCCCEEEEeCCCceeccHhHHhhhhCcccceEEecCccccCccCCCCCC
Confidence 78999999988 8999999995 7889999999999999999999999999999999999999999999989
Q ss_pred CCCCCeEEEEEEEEeeC
Q psy4022 206 IPPNSTLVFDVELKNVN 222 (222)
Q Consensus 206 ip~~~~L~f~vel~~i~ 222 (222)
||++++|+|+|||++++
T Consensus 160 IP~~A~LiFdiELv~i~ 176 (188)
T KOG0549|consen 160 IPGDAVLIFDIELVKIE 176 (188)
T ss_pred CCCCeeEEEEEEEEEee
Confidence 99999999999999874
|
|
| >KOG0543|consensus | Back alignment and domain information |
|---|
| >KOG0544|consensus | Back alignment and domain information |
|---|
| >COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0549|consensus | Back alignment and domain information |
|---|
| >KOG0544|consensus | Back alignment and domain information |
|---|
| >KOG0552|consensus | Back alignment and domain information |
|---|
| >COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated | Back alignment and domain information |
|---|
| >TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated | Back alignment and domain information |
|---|
| >KOG0552|consensus | Back alignment and domain information |
|---|
| >PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 | Back alignment and domain information |
|---|
| >PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 | Back alignment and domain information |
|---|
| >PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0543|consensus | Back alignment and domain information |
|---|
| >PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00115 tig trigger factor | Back alignment and domain information |
|---|
| >COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01490 tig trigger factor; Provisional | Back alignment and domain information |
|---|
| >TIGR00115 tig trigger factor | Back alignment and domain information |
|---|
| >PRK01490 tig trigger factor; Provisional | Back alignment and domain information |
|---|
| >COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0545|consensus | Back alignment and domain information |
|---|
| >KOG0545|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 222 | ||||
| 3jxv_A | 356 | Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk | 3e-22 | ||
| 3jym_A | 377 | Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk | 3e-22 | ||
| 3uf8_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 6e-20 | ||
| 3uqa_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 7e-20 | ||
| 4dz3_A | 113 | Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is | 7e-20 | ||
| 3vaw_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-19 | ||
| 4ggq_C | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-19 | ||
| 2y78_A | 133 | Crystal Structure Of Bpss1823, A Mip-Like Chaperone | 1e-19 | ||
| 2ke0_A | 117 | Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso | 1e-19 | ||
| 1yat_A | 113 | Improved Calcineurin Inhibition By Yeast Fkbp12-Dru | 5e-19 | ||
| 2lgo_A | 130 | Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol | 5e-19 | ||
| 3uqb_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-18 | ||
| 1q1c_A | 280 | Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt | 2e-18 | ||
| 2pbc_A | 102 | Fk506-Binding Protein 2 Length = 102 | 9e-18 | ||
| 2pbc_A | 102 | Fk506-Binding Protein 2 Length = 102 | 2e-17 | ||
| 1rot_A | 149 | Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 | 4e-17 | ||
| 1rot_A | 149 | Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 | 7e-17 | ||
| 3uqi_A | 108 | Crystallographic Structure Of Fkbp12 From Aedes Aeg | 4e-17 | ||
| 3uqi_A | 108 | Crystallographic Structure Of Fkbp12 From Aedes Aeg | 2e-16 | ||
| 4dz2_A | 113 | Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is | 8e-17 | ||
| 1n1a_A | 140 | Crystal Structure Of The N-Terminal Domain Of Human | 1e-16 | ||
| 1n1a_A | 140 | Crystal Structure Of The N-Terminal Domain Of Human | 2e-16 | ||
| 4drj_A | 144 | O-crystal Structure Of The Ppiase Domain Of Fkbp52, | 2e-16 | ||
| 4drj_A | 144 | O-crystal Structure Of The Ppiase Domain Of Fkbp52, | 3e-16 | ||
| 1c9h_A | 107 | Crystal Structure Of Fkbp12.6 In Complex With Rapam | 4e-16 | ||
| 1c9h_A | 107 | Crystal Structure Of Fkbp12.6 In Complex With Rapam | 1e-15 | ||
| 1kt0_A | 457 | Structure Of The Large Fkbp-like Protein, Fkbp51, I | 6e-16 | ||
| 2ki3_A | 126 | Structural And Biochemical Characterization Of Fk50 | 7e-16 | ||
| 2ki3_A | 126 | Structural And Biochemical Characterization Of Fk50 | 6e-15 | ||
| 2vn1_A | 129 | Crystal Structure Of The Fk506-Binding Domain Of Pl | 1e-15 | ||
| 2vn1_A | 129 | Crystal Structure Of The Fk506-Binding Domain Of Pl | 7e-15 | ||
| 2ofn_A | 135 | Solution Structure Of Fk506-Binding Domain (Fkbd)of | 1e-15 | ||
| 2ofn_A | 135 | Solution Structure Of Fk506-Binding Domain (Fkbd)of | 7e-15 | ||
| 3o5d_A | 264 | Crystal Structure Of A Fragment Of Fkbp51 Comprisin | 1e-15 | ||
| 1fkk_A | 107 | Atomic Structure Of Fkbp12, An Immunophilin Binding | 1e-15 | ||
| 1fkk_A | 107 | Atomic Structure Of Fkbp12, An Immunophilin Binding | 3e-15 | ||
| 1fkb_A | 107 | Atomic Structure Of The Rapamycin Human Immunophili | 2e-15 | ||
| 1fkb_A | 107 | Atomic Structure Of The Rapamycin Human Immunophili | 4e-15 | ||
| 3h9r_B | 109 | Crystal Structure Of The Kinase Domain Of Type I Ac | 2e-15 | ||
| 3h9r_B | 109 | Crystal Structure Of The Kinase Domain Of Type I Ac | 4e-15 | ||
| 2fap_A | 107 | The Structure Of The Immunophilin-Immunosuppressant | 2e-15 | ||
| 2fap_A | 107 | The Structure Of The Immunophilin-Immunosuppressant | 4e-15 | ||
| 1eym_A | 107 | Fk506 Binding Protein Mutant, Homodimeric Complex L | 2e-15 | ||
| 1eym_A | 107 | Fk506 Binding Protein Mutant, Homodimeric Complex L | 4e-15 | ||
| 1r9h_A | 135 | Structural Genomics Of C.Elegans: Fkbp-Type Peptidy | 3e-15 | ||
| 1r9h_A | 135 | Structural Genomics Of C.Elegans: Fkbp-Type Peptidy | 4e-15 | ||
| 1bkf_A | 107 | Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX | 3e-15 | ||
| 1bkf_A | 107 | Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX | 6e-15 | ||
| 2ppp_A | 107 | Crystal Structure Of E60q Mutant Of Fkbp12 Length = | 4e-15 | ||
| 2ppp_A | 107 | Crystal Structure Of E60q Mutant Of Fkbp12 Length = | 7e-15 | ||
| 1bl4_A | 107 | Fkbp Mutant F36v Complexed With Remodeled Synthetic | 4e-15 | ||
| 1bl4_A | 107 | Fkbp Mutant F36v Complexed With Remodeled Synthetic | 7e-15 | ||
| 1tco_C | 107 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 5e-15 | ||
| 1tco_C | 107 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 5e-15 | ||
| 2ppo_A | 107 | Crystal Structure Of E60a Mutant Of Fkbp12 Length = | 6e-15 | ||
| 2ppo_A | 107 | Crystal Structure Of E60a Mutant Of Fkbp12 Length = | 1e-14 | ||
| 1kt1_A | 457 | Structure Of The Large Fkbp-Like Protein, Fkbp51, I | 7e-15 | ||
| 2dg4_A | 107 | Fk506-Binding Protein Mutant Wf59 Complexed With Ra | 2e-14 | ||
| 2dg4_A | 107 | Fk506-Binding Protein Mutant Wf59 Complexed With Ra | 5e-14 | ||
| 1u79_A | 129 | Crystal Structure Of Atfkbp13 Length = 129 | 3e-14 | ||
| 1u79_A | 129 | Crystal Structure Of Atfkbp13 Length = 129 | 1e-13 | ||
| 2dg9_A | 107 | Fk506-Binding Protein Mutant Wl59 Complexed With Ra | 4e-14 | ||
| 2dg9_A | 107 | Fk506-Binding Protein Mutant Wl59 Complexed With Ra | 9e-14 | ||
| 3o5e_A | 144 | Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 | 6e-14 | ||
| 3o5e_A | 144 | Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 | 1e-13 | ||
| 3o5g_A | 128 | Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 | 7e-14 | ||
| 3o5g_A | 128 | Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 | 2e-13 | ||
| 4drh_A | 144 | Co-crystal Structure Of The Ppiase Domain Of Fkbp51 | 7e-14 | ||
| 4drh_A | 144 | Co-crystal Structure Of The Ppiase Domain Of Fkbp51 | 2e-13 | ||
| 3o5l_A | 128 | Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le | 7e-14 | ||
| 3o5l_A | 128 | Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le | 2e-13 | ||
| 4dip_A | 125 | Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran | 6e-12 | ||
| 4dip_A | 125 | Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran | 2e-11 | ||
| 1pbk_A | 116 | Homologous Domain Of Human Fkbp25 Length = 116 | 3e-11 | ||
| 1pbk_A | 116 | Homologous Domain Of Human Fkbp25 Length = 116 | 4e-11 | ||
| 3kz7_A | 119 | C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple | 4e-11 | ||
| 3kz7_A | 119 | C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple | 5e-11 | ||
| 3oe2_A | 219 | 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Tran | 3e-10 | ||
| 3oe2_A | 219 | 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Tran | 1e-09 | ||
| 1q6u_A | 245 | Crystal Structure Of Fkpa From Escherichia Coli Len | 6e-10 | ||
| 1q6u_A | 245 | Crystal Structure Of Fkpa From Escherichia Coli Len | 2e-09 | ||
| 1q6h_A | 224 | Crystal Structure Of A Truncated Form Of Fkpa From | 8e-10 | ||
| 1q6h_A | 224 | Crystal Structure Of A Truncated Form Of Fkpa From | 3e-09 | ||
| 1jvw_A | 167 | Trypanosoma Cruzi Macrophage Infectivity Potentiato | 3e-09 | ||
| 1jvw_A | 167 | Trypanosoma Cruzi Macrophage Infectivity Potentiato | 6e-09 | ||
| 3b7x_A | 134 | Crystal Structure Of Human Fk506-Binding Protein 6 | 3e-08 | ||
| 3b7x_A | 134 | Crystal Structure Of Human Fk506-Binding Protein 6 | 9e-08 | ||
| 1ix5_A | 151 | Solution Structure Of The Methanococcus Thermolitho | 1e-05 | ||
| 1ix5_A | 151 | Solution Structure Of The Methanococcus Thermolitho | 1e-05 | ||
| 2awg_A | 118 | Structure Of The Ppiase Domain Of The Human Fk506-B | 1e-05 | ||
| 2awg_A | 118 | Structure Of The Ppiase Domain Of The Human Fk506-B | 1e-05 | ||
| 2f2d_A | 121 | Solution Structure Of The Fk506-Binding Domain Of H | 1e-05 | ||
| 2f2d_A | 121 | Solution Structure Of The Fk506-Binding Domain Of H | 1e-05 | ||
| 2uz5_A | 137 | Solution Structure Of The Fkbp-Domain Of Legionella | 4e-05 | ||
| 2uz5_A | 137 | Solution Structure Of The Fkbp-Domain Of Legionella | 8e-05 | ||
| 1fd9_A | 213 | Crystal Structure Of The Macrophage Infectivity Pot | 7e-05 | ||
| 1fd9_A | 213 | Crystal Structure Of The Macrophage Infectivity Pot | 1e-04 | ||
| 2jwx_A | 157 | Solution Structure Of The N-Terminal Domain Of Huma | 7e-05 | ||
| 2jwx_A | 157 | Solution Structure Of The N-Terminal Domain Of Huma | 7e-05 | ||
| 2d9f_A | 135 | Solution Structure Of Ruh-047, An Fkbp Domain From | 1e-04 |
| >pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 | Back alignment and structure |
|
| >pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 | Back alignment and structure |
| >pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 | Back alignment and structure |
| >pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 | Back alignment and structure |
| >pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 | Back alignment and structure |
| >pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 | Back alignment and structure |
| >pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 | Back alignment and structure |
| >pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 | Back alignment and structure |
| >pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 | Back alignment and structure |
| >pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 | Back alignment and structure |
| >pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 | Back alignment and structure |
| >pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 | Back alignment and structure |
| >pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 | Back alignment and structure |
| >pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 | Back alignment and structure |
| >pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 | Back alignment and structure |
| >pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 | Back alignment and structure |
| >pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 | Back alignment and structure |
| >pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 | Back alignment and structure |
| >pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 | Back alignment and structure |
| >pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 | Back alignment and structure |
| >pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 | Back alignment and structure |
| >pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 | Back alignment and structure |
| >pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 | Back alignment and structure |
| >pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 | Back alignment and structure |
| >pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 | Back alignment and structure |
| >pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 | Back alignment and structure |
| >pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 | Back alignment and structure |
| >pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 | Back alignment and structure |
| >pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 | Back alignment and structure |
| >pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 | Back alignment and structure |
| >pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 | Back alignment and structure |
| >pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 | Back alignment and structure |
| >pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 | Back alignment and structure |
| >pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 | Back alignment and structure |
| >pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 | Back alignment and structure |
| >pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 | Back alignment and structure |
| >pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 | Back alignment and structure |
| >pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 | Back alignment and structure |
| >pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 | Back alignment and structure |
| >pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 | Back alignment and structure |
| >pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 | Back alignment and structure |
| >pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 | Back alignment and structure |
| >pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 | Back alignment and structure |
| >pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 | Back alignment and structure |
| >pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 | Back alignment and structure |
| >pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 | Back alignment and structure |
| >pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 | Back alignment and structure |
| >pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 | Back alignment and structure |
| >pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 | Back alignment and structure |
| >pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 | Back alignment and structure |
| >pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 | Back alignment and structure |
| >pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 | Back alignment and structure |
| >pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 | Back alignment and structure |
| >pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 | Back alignment and structure |
| >pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 | Back alignment and structure |
| >pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 | Back alignment and structure |
| >pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 | Back alignment and structure |
| >pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 | Back alignment and structure |
| >pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 | Back alignment and structure |
| >pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 | Back alignment and structure |
| >pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 | Back alignment and structure |
| >pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 | Back alignment and structure |
| >pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 | Back alignment and structure |
| >pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 | Back alignment and structure |
| >pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 | Back alignment and structure |
| >pdb|3OE2|A Chain A, 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Ppiase From Pseudomonas Syringae Pv. Tomato Str. Dc3000 (Pspto Dc3000) Length = 219 | Back alignment and structure |
| >pdb|3OE2|A Chain A, 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Ppiase From Pseudomonas Syringae Pv. Tomato Str. Dc3000 (Pspto Dc3000) Length = 219 | Back alignment and structure |
| >pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 | Back alignment and structure |
| >pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 | Back alignment and structure |
| >pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 | Back alignment and structure |
| >pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 | Back alignment and structure |
| >pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 | Back alignment and structure |
| >pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 | Back alignment and structure |
| >pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 | Back alignment and structure |
| >pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 | Back alignment and structure |
| >pdb|1IX5|A Chain A, Solution Structure Of The Methanococcus Thermolithotrophicus Fkbp Length = 151 | Back alignment and structure |
| >pdb|1IX5|A Chain A, Solution Structure Of The Methanococcus Thermolithotrophicus Fkbp Length = 151 | Back alignment and structure |
| >pdb|2AWG|A Chain A, Structure Of The Ppiase Domain Of The Human Fk506-Binding Protein 8 Length = 118 | Back alignment and structure |
| >pdb|2AWG|A Chain A, Structure Of The Ppiase Domain Of The Human Fk506-Binding Protein 8 Length = 118 | Back alignment and structure |
| >pdb|2F2D|A Chain A, Solution Structure Of The Fk506-Binding Domain Of Human Fkbp38 Length = 121 | Back alignment and structure |
| >pdb|2F2D|A Chain A, Solution Structure Of The Fk506-Binding Domain Of Human Fkbp38 Length = 121 | Back alignment and structure |
| >pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 | Back alignment and structure |
| >pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 | Back alignment and structure |
| >pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 | Back alignment and structure |
| >pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 | Back alignment and structure |
| >pdb|2JWX|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Fkbp38 (Fkbp38ntd) Length = 157 | Back alignment and structure |
| >pdb|2JWX|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Fkbp38 (Fkbp38ntd) Length = 157 | Back alignment and structure |
| >pdb|2D9F|A Chain A, Solution Structure Of Ruh-047, An Fkbp Domain From Human Cdna Length = 135 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 5e-70 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 4e-68 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 5e-63 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 6e-51 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 2e-20 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 4e-46 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 2e-45 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 4e-44 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 1e-43 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 9e-44 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 2e-42 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 3e-43 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 5e-42 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 4e-43 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 1e-42 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 5e-43 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 9e-42 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 8e-43 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 6e-42 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 9e-43 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 1e-41 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 3e-42 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 6e-41 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 6e-42 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 2e-40 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 9e-41 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 8e-40 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 4e-40 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 1e-38 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 5e-40 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 5e-39 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 9e-40 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 3e-38 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 3e-38 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 3e-37 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 4e-37 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 2e-36 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 4e-37 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 7e-36 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 8e-37 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 4e-36 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 4e-31 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 1e-29 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 2e-30 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 2e-29 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 3e-29 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 5e-28 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 3e-27 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 7e-26 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 1e-21 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 5e-19 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 2e-13 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 1e-12 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 4e-12 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 6e-12 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 3e-11 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 3e-11 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 4e-11 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 7e-11 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 4e-11 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 4e-11 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 4e-10 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 1e-09 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 3e-09 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 4e-09 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 1e-08 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 3e-08 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 1e-08 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 4e-08 |
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 | Back alignment and structure |
|---|
Score = 214 bits (547), Expect = 5e-70
Identities = 65/212 (30%), Positives = 93/212 (43%), Gaps = 45/212 (21%)
Query: 48 KKESNISVYYVGKLKSNNKQFDSSTQ-GPGFKFRLGKGEVIKGWDVGLNGMKVGGKRRIT 106
+ V+Y G L + +FDSS F F LGKGEVIK WD+ + MKVG IT
Sbjct: 68 MIGDRVFVHYTGWLL-DGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHIT 126
Query: 107 IPAHMAYGNKGSPPAIPPNSTLVFDVEL-------------------------------- 134
AYG+ GSPP IPPN+TLVF+VEL
Sbjct: 127 CKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNE 186
Query: 135 -KNISVYYVGKLKSNNQQFDSSTQGPGFKFRLGKGEVIK---GWDVGLNGMKVGGKRRIT 190
+ V G ++ FD +F +G+GE + G + + M+ G +
Sbjct: 187 GAIVEVALEGYY--KDKLFDQR----ELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVY 240
Query: 191 IPAHMAYGNKGSPP-AIPPNSTLVFDVELKNV 221
+ A+G+ G IPPN+ L +++ LK+
Sbjct: 241 LKPSYAFGSVGKEKFQIPPNAELKYELHLKSF 272
|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 100.0 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 100.0 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 100.0 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 100.0 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.91 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.9 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 99.9 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 99.89 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 99.89 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 99.89 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 99.89 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 99.89 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 99.89 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 99.88 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 99.88 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 99.88 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.88 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 99.88 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 99.88 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 99.88 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 99.87 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.87 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 99.87 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 99.87 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 99.87 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 99.86 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 99.86 | |
| 2lkn_A | 165 | AH receptor-interacting protein; FKBP-type domain, | 99.86 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 99.86 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 99.86 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 99.85 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 99.85 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 99.85 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 99.85 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 99.85 | |
| 2lkn_A | 165 | AH receptor-interacting protein; FKBP-type domain, | 99.85 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 99.85 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 99.85 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 99.84 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 99.84 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 99.84 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 99.84 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 99.84 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 99.84 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 99.83 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 99.83 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 99.82 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 99.82 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 99.82 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 99.82 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 99.82 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 99.82 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 99.8 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 99.79 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 99.77 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 99.77 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 99.76 | |
| 1hxv_A | 113 | Trigger factor; FKBP fold, ppiase, chaperone; NMR | 99.75 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 99.74 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.74 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.73 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 99.73 | |
| 1hxv_A | 113 | Trigger factor; FKBP fold, ppiase, chaperone; NMR | 99.71 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.69 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 99.56 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 99.56 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 99.54 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 99.52 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 99.52 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 99.51 | |
| 1w26_A | 432 | Trigger factor, TF; chaperone, protein folding, ri | 99.49 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 99.49 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.44 | |
| 1t11_A | 392 | Trigger factor, TF; helix-turn-helix, four-helix-b | 99.41 | |
| 1w26_A | 432 | Trigger factor, TF; chaperone, protein folding, ri | 99.39 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 99.39 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.29 | |
| 1t11_A | 392 | Trigger factor, TF; helix-turn-helix, four-helix-b | 99.25 | |
| 3gty_X | 433 | Trigger factor, TF; chaperone-client complex, cell | 98.27 | |
| 3gty_X | 433 | Trigger factor, TF; chaperone-client complex, cell | 97.58 |
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-40 Score=275.73 Aligned_cols=193 Identities=36% Similarity=0.612 Sum_probs=175.0
Q ss_pred eeeeccCCCCcCcEEEEeeecCCC---CCCCCEEEEEEEEEEcCCCeEEecccC-CCCeEEEcCCCcccchHHHHhcCCc
Q psy4022 23 ISMAALDPKSITGKIHHIFLLSLS---YKKESNISVYYVGKLKSNNKQFDSSTQ-GPGFKFRLGKGEVIKGWDVGLNGMK 98 (222)
Q Consensus 23 ~~~~~~~~~~~~~~~~~~~~~g~~---~~~gd~V~i~y~~~~~~dg~~~~st~~-~~p~~~~lg~~~~i~Gle~al~~m~ 98 (222)
..-.+++++...++.+++...|.. |+.||.|++||++++ .||++|++++. ..|+.|.+|.+++|+||++||.+|+
T Consensus 40 ~~~~di~~~~~~gl~~~vl~~G~G~~~~~~gd~V~v~Y~g~~-~dG~~fdss~~~~~p~~f~lG~g~vi~G~e~aL~gm~ 118 (280)
T 1q1c_A 40 MEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWL-LDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMK 118 (280)
T ss_dssp -CCEECCSSCSSSEEEEEEECCSSSCCCCTTCEEEEEEEEEE-TTSCEEEESTTSSSCEEEETTTTSSCHHHHHHHTTCC
T ss_pred ccccccccCCCCceEEEEEeCCCCCcCCCCCCEEEEEEEEEE-CCCCEEEecccCCCCEEEEECCcChhHHHHHHHhcCC
Confidence 344577777888999988876643 789999999999999 69999999974 4799999999999999999999999
Q ss_pred cCcEEEEecCCccccCCCCCCCCCCCCcceEEeEEe---------------------------------eeEEEEEEEEe
Q psy4022 99 VGGKRRITIPAHMAYGNKGSPPAIPPNSTLVFDVEL---------------------------------KNISVYYVGKL 145 (222)
Q Consensus 99 ~Ge~~~v~ip~~~ayg~~g~~~~i~~~~~lv~~vel---------------------------------~~V~v~y~g~~ 145 (222)
+|+++++.|||++|||+.+.++.||+++.++|+|++ +.|.++|.|++
T Consensus 119 ~Ge~~~v~ipp~~aYG~~g~~~~Ip~~~~lvf~Vel~~i~~~~~~~~~d~gl~~~il~~G~G~~~~~~gd~V~i~y~g~~ 198 (280)
T 1q1c_A 119 VGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYY 198 (280)
T ss_dssp TTCEEEEEECGGGTTTTTCBTTTBCTTCCEEEEEEEEEEECEECCTTCSSSEEEEEEECCSCSCCCCTTCEEEEEEEEEE
T ss_pred CCCEEEEEECcHHhCCCcCccCCCCCCCcEEEEEEeeeecccccccccccceeEEeeecccccccccCCceEEEEEEEEe
Confidence 999999999999999999988899999999999997 66889999998
Q ss_pred ccCCcccCCCCCCCcEEEEeCCCe---eeechhhhccCceeccEEEEEecCCCCCCCCCCCC-CCCCCCeEEEEEEEEee
Q psy4022 146 KSNNQQFDSSTQGPGFKFRLGKGE---VIKGWDVGLNGMKVGGKRRITIPAHMAYGNKGSPP-AIPPNSTLVFDVELKNV 221 (222)
Q Consensus 146 ~~~g~~fd~~~~~~p~~~~lg~g~---~i~g~~~~l~~m~~Ge~~~~~vp~~~~yg~~~~~~-~ip~~~~L~f~vel~~i 221 (222)
+|++|++ .|+.|.+|.++ +|+||++||.+|++||+++|+|||++|||+++.+. .||||++|+|+|+|++|
T Consensus 199 --dG~~fd~----~~~~f~lG~g~~~~~i~G~e~~l~gmk~Ge~~~v~ip~~~~yG~~~~~~~~IP~~~~l~f~V~L~~i 272 (280)
T 1q1c_A 199 --KDKLFDQ----RELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSF 272 (280)
T ss_dssp --TTEEEEE----EEEEEETTCGGGGTCCHHHHHHHTTCCTTCEEEEEECGGGTTTTTCBGGGTBCTTCCEEEEEEEEEE
T ss_pred --CCEEEec----CCeEEEecCCcccccchhHHHHHhCCCCCcEEEEEEChhHcCCcCCCccCccCCCCeEEEEEEEEEE
Confidence 8999997 38999999998 59999999999999999999999999999998765 59999999999999998
Q ss_pred C
Q psy4022 222 N 222 (222)
Q Consensus 222 ~ 222 (222)
+
T Consensus 273 ~ 273 (280)
T 1q1c_A 273 E 273 (280)
T ss_dssp E
T ss_pred e
Confidence 4
|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} | Back alignment and structure |
|---|
| >2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* | Back alignment and structure |
|---|
| >1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A | Back alignment and structure |
|---|
| >1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A | Back alignment and structure |
|---|
| >1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A | Back alignment and structure |
|---|
| >3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A | Back alignment and structure |
|---|
| >3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 222 | ||||
| d1fd9a_ | 204 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 2e-22 | |
| d1fd9a_ | 204 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 1e-21 | |
| d1q6ha_ | 210 | d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 5e-22 | |
| d1q6ha_ | 210 | d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 5e-21 | |
| d1yata_ | 113 | d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas | 6e-21 | |
| d1yata_ | 113 | d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas | 2e-20 | |
| d1r9ha_ | 118 | d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd | 2e-20 | |
| d1r9ha_ | 118 | d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd | 9e-20 | |
| d1q1ca1 | 120 | d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu | 2e-20 | |
| d1q1ca1 | 120 | d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu | 2e-19 | |
| d2ppna1 | 107 | d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) | 3e-20 | |
| d2ppna1 | 107 | d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) | 3e-19 | |
| d1kt1a3 | 115 | d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M | 2e-19 | |
| d1kt1a3 | 115 | d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M | 1e-18 | |
| d1kt1a2 | 111 | d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo | 4e-19 | |
| d1kt1a2 | 111 | d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo | 4e-18 | |
| d1u79a_ | 125 | d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha | 2e-16 | |
| d1u79a_ | 125 | d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha | 1e-15 | |
| d1jvwa_ | 160 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 3e-16 | |
| d1jvwa_ | 160 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 5e-16 | |
| d1q1ca2 | 117 | d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H | 1e-15 | |
| d1q1ca2 | 117 | d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H | 4e-15 | |
| d1pbka_ | 116 | d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: | 3e-15 | |
| d1pbka_ | 116 | d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: | 3e-15 | |
| d1hxva_ | 85 | d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl | 4e-14 | |
| d1hxva_ | 85 | d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl | 8e-14 | |
| d1ix5a_ | 151 | d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu | 1e-08 | |
| d1nlqa_ | 105 | b.121.3.1 (A:) Chromatin decondensation protein 1 | 2e-04 | |
| d1l1pa_ | 106 | d.26.1.1 (A:) Trigger factor PPIase domain {Escher | 5e-04 | |
| d1l1pa_ | 106 | d.26.1.1 (A:) Trigger factor PPIase domain {Escher | 0.001 | |
| d1t11a3 | 113 | d.26.1.1 (A:135-247) Trigger factor PPIase domain | 0.001 | |
| d1t11a3 | 113 | d.26.1.1 (A:135-247) Trigger factor PPIase domain | 0.002 |
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: Macrophage infectivity potentiator protein (MIP) species: Legionella pneumophila [TaxId: 446]
Score = 88.8 bits (219), Expect = 2e-22
Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 2/91 (2%)
Query: 47 YKKESNISVYYVGKLKSNNKQFDSSTQGPGFKFRLGKGEVIKGWDVGLNGMKVGGKRRIT 106
K ++V Y G+L + G F +VI GW L M G I
Sbjct: 113 PGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATF--QVSQVIPGWTEALQLMPAGSTWEIY 170
Query: 107 IPAHMAYGNKGSPPAIPPNSTLVFDVELKNI 137
+P+ +AYG + I PN TL+F + L ++
Sbjct: 171 VPSGLAYGPRSVGGPIGPNETLIFKIHLISV 201
|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 | Back information, alignment and structure |
|---|
| >d1nlqa_ b.121.3.1 (A:) Chromatin decondensation protein 1 (Crp1, Nlp) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Length = 106 | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Length = 106 | Back information, alignment and structure |
|---|
| >d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Length = 113 | Back information, alignment and structure |
|---|
| >d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Length = 113 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| d1q1ca1 | 120 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.93 | |
| d1r9ha_ | 118 | FKB-6, N-terminal domain {Caenorhabditis elegans [ | 99.93 | |
| d2ppna1 | 107 | FK-506 binding protein (FKBP12), an immunophilin { | 99.91 | |
| d1q1ca1 | 120 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.91 | |
| d1kt1a2 | 111 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.91 | |
| d2ppna1 | 107 | FK-506 binding protein (FKBP12), an immunophilin { | 99.91 | |
| d1kt1a2 | 111 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.91 | |
| d1yata_ | 113 | Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc | 99.9 | |
| d1r9ha_ | 118 | FKB-6, N-terminal domain {Caenorhabditis elegans [ | 99.9 | |
| d1yata_ | 113 | Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc | 99.9 | |
| d1pbka_ | 116 | FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1q6ha_ | 210 | Peptidyl-prolyl cis-trans isomerase FkpA {Escheric | 99.89 | |
| d1pbka_ | 116 | FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1fd9a_ | 204 | Macrophage infectivity potentiator protein (MIP) { | 99.89 | |
| d1fd9a_ | 204 | Macrophage infectivity potentiator protein (MIP) { | 99.88 | |
| d1q6ha_ | 210 | Peptidyl-prolyl cis-trans isomerase FkpA {Escheric | 99.87 | |
| d1jvwa_ | 160 | Macrophage infectivity potentiator protein (MIP) { | 99.84 | |
| d1kt1a3 | 115 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.84 | |
| d1u79a_ | 125 | FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: | 99.83 | |
| d1jvwa_ | 160 | Macrophage infectivity potentiator protein (MIP) { | 99.83 | |
| d1u79a_ | 125 | FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: | 99.83 | |
| d1kt1a3 | 115 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.82 | |
| d1q1ca2 | 117 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.81 | |
| d1q1ca2 | 117 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.75 | |
| d1hxva_ | 85 | Trigger factor PPIase domain {Mycoplasma genitaliu | 99.67 | |
| d1ix5a_ | 151 | Archaeal FKBP {Archaeon Methanococcus thermolithot | 99.65 | |
| d1ix5a_ | 151 | Archaeal FKBP {Archaeon Methanococcus thermolithot | 99.58 | |
| d1hxva_ | 85 | Trigger factor PPIase domain {Mycoplasma genitaliu | 99.57 | |
| d1l1pa_ | 106 | Trigger factor PPIase domain {Escherichia coli [Ta | 99.31 | |
| d1t11a3 | 113 | Trigger factor PPIase domain {Vibrio cholerae [Tax | 99.26 | |
| d1l1pa_ | 106 | Trigger factor PPIase domain {Escherichia coli [Ta | 98.99 | |
| d1t11a3 | 113 | Trigger factor PPIase domain {Vibrio cholerae [Tax | 98.94 |
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: FKBP52, N-terminal domains species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=1.4e-25 Score=163.19 Aligned_cols=111 Identities=43% Similarity=0.669 Sum_probs=102.6
Q ss_pred eccCCCCcCcEEEEeeecCCC---CCCCCEEEEEEEEEEcCCCeEEeccc-CCCCeEEEcCCCcccchHHHHhcCCccCc
Q psy4022 26 AALDPKSITGKIHHIFLLSLS---YKKESNISVYYVGKLKSNNKQFDSST-QGPGFKFRLGKGEVIKGWDVGLNGMKVGG 101 (222)
Q Consensus 26 ~~~~~~~~~~~~~~~~~~g~~---~~~gd~V~i~y~~~~~~dg~~~~st~-~~~p~~~~lg~~~~i~Gle~al~~m~~Ge 101 (222)
.+++++.+.++++++..+|.. |..||.|++||++++ .||++|+||+ .++|+.|.+|.+++++||++||.+|++|+
T Consensus 3 ~d~t~~~d~gv~~~i~~~G~G~~~P~~gd~V~v~y~~~l-~dG~~fdss~~~~~p~~f~~g~~~~i~G~~~~l~~M~~Ge 81 (120)
T d1q1ca1 3 VDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWL-LDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGE 81 (120)
T ss_dssp EECCSSCSSSEEEEEEECCSSSCCCCTTCEEEEEEEEEE-TTSCEEEESTTSSSCEEEETTTTSSCHHHHHHHTTCCTTC
T ss_pred eeccCCCCCCEEEEEEEcccCCcCCCCCCEEEEEEEEEE-cCCCEEEeccccccceeeecCCCceeeeeeeeeccccCCc
Confidence 478899999999999887754 789999999999999 6999999996 46799999999999999999999999999
Q ss_pred EEEEecCCccccCCCCCCCCCCCCcceEEeEEeeeE
Q psy4022 102 KRRITIPAHMAYGNKGSPPAIPPNSTLVFDVELKNI 137 (222)
Q Consensus 102 ~~~v~ip~~~ayg~~g~~~~i~~~~~lv~~vel~~V 137 (222)
++++.|||++|||+.+.++.|||++.++|+|+|.+|
T Consensus 82 ~~~~~ip~~laYG~~g~~~~IPp~s~LifeIeLl~v 117 (120)
T d1q1ca1 82 VCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEF 117 (120)
T ss_dssp EEEEEECGGGTTTTTCBTTTBCTTCCEEEEEEEEEE
T ss_pred EEEEEECHHHhCCCcCCCCCCCcCCcEEEEEEEEEE
Confidence 999999999999999998899999999999999665
|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|