Psyllid ID: psy4078

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
SSESGSTKGGIVSRTSSSGKVSGGDGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLFLGRVRKVSGGDGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKRALAMKQQLQQEKDGRKMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDFALHTDLDRLDPSAAPFQHLVSQMHGYELGHGPPPPHDMGPTPGDMAHPDSTDSYVTYLESDDSLQDNPSP
cccccccccccccccccccccccccccccccccEEcccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccc
cccccccccccccccccccccccccccccEEEEEEccccccEEEccccccccccccHHHcccccccccccccccccccccccccccEEEcHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHEEEEHcHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ssesgstkggivsrtsssgkvsggdgkptrvRTVLNEKQLHTLRtcynanprpdaLMKEQLVEMTNLFLGRVrkvsggdgkptrvRTVLNEKQLHTLRtcynanprpdaLMKEQLVEMTNLSPRVIRVWFQNKRCKDKKRALAMKQQLQQEkdgrkmgygsmqgipmvasspvrhdspigmnalevtsyqppwkalsdfalhtdldrldpsaapfqHLVSQMhgyelghgpppphdmgptpgdmahpdstdsyvtylesddslqdnpsp
ssesgstkggivsrtsssgkvsggdgkptrvrtvlnekqlhtlrtcynanprPDALMKEQLVEMTNLFLGrvrkvsggdgkptrvrtvlnekqlhtlrtcynanprPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKRALAMKQQlqqekdgrkmgYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDFALHTDLDRLDPSAAPFQHLVSQMHGYELGHGPPPPHDMGPTPGDMAHPDSTDSYVTYLEsddslqdnpsp
SSESGSTKGGIVSRTsssgkvsggdgkPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLFLGRVRKVSGGDGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKRALAMKQQLQQEKDGRKMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDFALHTDLDRLDPSAAPFQHLVSQMHGYELghgpppphdmgptpgdmAHPDSTDSYVTYLESDDSLQDNPSP
*********************************VLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLFLGRVRKVSGG***PTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRC**********************************************NALEVTSYQPPWKALSDFALHTDLDRL*********L***************************************************
***************************************************************************************VLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKR***************************************************************************************************************************************
***************************PTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLFLGRVRKVSGGDGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKRALAMKQQLQQEKDGRKMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDFALHTDLDRLDPSAAPFQHLVSQMHGYELGHGPPPPHDMGPTPGDMAHPDSTDSYVTYLE***********
**************************KPTRVRTVLNEKQLHTLRTCYNANP********************************RVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKRALAMKQQL**********************************ALEVTSYQPPWKALSDFALHTDLDRLDPSAAPFQHLVSQMHGYELGHGP**************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSESGSTKGGIVSRTSSSGKVSGGDGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLFLGRVRKVSGGDGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKRALAMKQQLQQEKDGRKMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDFALHTDLDRLDPSAAPFQHLVSQMHGYELGHGPPPPHDMGPTPGDMAHPDSTDSYVTYLESDDSLQDNPSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query269 2.2.26 [Sep-21-2011]
P53405349 Insulin gene enhancer pro yes N/A 0.605 0.467 0.598 9e-50
P53409363 Insulin gene enhancer pro N/A N/A 0.498 0.369 0.669 1e-49
P53408358 Insulin gene enhancer pro N/A N/A 0.498 0.374 0.692 1e-49
P53410319 Insulin gene enhancer pro yes N/A 0.501 0.423 0.707 2e-49
P53406359 Insulin gene enhancer pro no N/A 0.498 0.373 0.685 3e-49
P61374349 Insulin gene enhancer pro yes N/A 0.605 0.467 0.593 9e-49
P61372349 Insulin gene enhancer pro yes N/A 0.605 0.467 0.593 9e-49
P61373349 Insulin gene enhancer pro N/A N/A 0.605 0.467 0.593 9e-49
P61371349 Insulin gene enhancer pro yes N/A 0.605 0.467 0.593 9e-49
P50211349 Insulin gene enhancer pro yes N/A 0.605 0.467 0.593 9e-49
>sp|P53405|ISL1_DANRE Insulin gene enhancer protein isl-1 OS=Danio rerio GN=isl1 PE=2 SV=1 Back     alignment and function desciption
 Score =  197 bits (500), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 106/177 (59%), Positives = 121/177 (68%), Gaps = 14/177 (7%)

Query: 81  KPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKR 140
           K TRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMT LSPRVIRVWFQNKRCKDKKR
Sbjct: 180 KTTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKR 239

Query: 141 ALAMKQQLQQEKDGRKMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDFA 200
           ++ MK QLQQ++   K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDFA
Sbjct: 240 SILMK-QLQQQQPNDKTNIQGMTGTPMVATSPERHDGGLQANQVEVQSYQPPWKVLSDFA 298

Query: 201 LHTDLDRLDPSAAPFQHLVSQMHGYELGHGPPPPHDMGPTPGDMAH--PDSTDSYVT 255
           L +D+D+       FQ LV+         G P  +  G     M+   PD+ +S V 
Sbjct: 299 LQSDIDQ-----PAFQQLVN------FSEGGPGSNSTGSEVASMSSQLPDTPNSMVA 344
Binds to one of the cis-acting domain of the insulin gene enhancer. May be involved in subtype specialization of primary motoneurons.
Danio rerio (taxid: 7955)
>sp|P53409|ISL3_ONCTS Insulin gene enhancer protein ISL-3 OS=Oncorhynchus tschawytscha GN=isl3 PE=2 SV=1 Back     alignment and function description
>sp|P53408|ISL2A_ONCTS Insulin gene enhancer protein ISL-2A OS=Oncorhynchus tschawytscha GN=isl2a PE=2 SV=1 Back     alignment and function description
>sp|P53410|ISL2_CHICK Insulin gene enhancer protein ISL-2 (Fragment) OS=Gallus gallus GN=ISL2 PE=2 SV=1 Back     alignment and function description
>sp|P53406|ISL2A_DANRE Insulin gene enhancer protein isl-2a OS=Danio rerio GN=isl2a PE=2 SV=1 Back     alignment and function description
>sp|P61374|ISL1_RAT Insulin gene enhancer protein ISL-1 OS=Rattus norvegicus GN=Isl1 PE=2 SV=1 Back     alignment and function description
>sp|P61372|ISL1_MOUSE Insulin gene enhancer protein ISL-1 OS=Mus musculus GN=Isl1 PE=1 SV=1 Back     alignment and function description
>sp|P61373|ISL1_MESAU Insulin gene enhancer protein ISL-1 OS=Mesocricetus auratus GN=ISL1 PE=2 SV=1 Back     alignment and function description
>sp|P61371|ISL1_HUMAN Insulin gene enhancer protein ISL-1 OS=Homo sapiens GN=ISL1 PE=1 SV=1 Back     alignment and function description
>sp|P50211|ISL1_CHICK Insulin gene enhancer protein ISL-1 OS=Gallus gallus GN=ISL1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
242009361 433 LIM/homeobox protein Lhx9, putative [Ped 0.732 0.454 0.726 5e-87
328707561 487 PREDICTED: insulin gene enhancer protein 0.747 0.412 0.776 6e-87
328707559 513 PREDICTED: insulin gene enhancer protein 0.747 0.391 0.776 8e-87
157119485 398 insulinprotein enhancer protein isl [Aed 0.680 0.459 0.714 8e-77
258645165 431 tailup [Tribolium castaneum] 0.665 0.415 0.73 1e-75
380018327 419 PREDICTED: insulin gene enhancer protein 0.698 0.448 0.698 2e-74
328793255 418 PREDICTED: insulin gene enhancer protein 0.698 0.449 0.698 2e-74
383858654 416 PREDICTED: insulin gene enhancer protein 0.698 0.451 0.698 3e-74
195035223283 GH11521 [Drosophila grimshawi] gi|193905 0.732 0.696 0.653 3e-74
270011029 411 tailup [Tribolium castaneum] 0.665 0.435 0.715 4e-74
>gi|242009361|ref|XP_002425456.1| LIM/homeobox protein Lhx9, putative [Pediculus humanus corporis] gi|212509292|gb|EEB12718.1| LIM/homeobox protein Lhx9, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  326 bits (836), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 165/227 (72%), Positives = 177/227 (77%), Gaps = 30/227 (13%)

Query: 70  GRVRKVSGGDGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVW 129
           G   KVS  DGKPTRVRTVLNEKQLHTLRTCY ANPRPDALMKEQLVEMT LSPRVIRVW
Sbjct: 210 GGTNKVSS-DGKPTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVW 268

Query: 130 FQNKRCKDKKRALAMKQQLQQEKDGRKMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSY 189
           FQNKRCKDKKRA+ MKQQLQQEKDGRK+GYG MQGIPMVASSPVRH+SP+G+N +EV SY
Sbjct: 269 FQNKRCKDKKRAILMKQQLQQEKDGRKLGYGGMQGIPMVASSPVRHESPLGLNPIEVHSY 328

Query: 190 QPPWKALSDFALHTDLDRLDPSAAPFQHLVSQ---------------------------M 222
           QPPWKALSDFALHTDLDRLDP+A PFQHLV+Q                           M
Sbjct: 329 QPPWKALSDFALHTDLDRLDPAAPPFQHLVNQVNFFNLNPPPPHQSFPSTLTNPTFISSM 388

Query: 223 HGYELGHGPPPPHDMGPTPGDMAHPDSTDSYVTYLESDDSLQDNPSP 269
           HGY++ HGPP  HD+GP P D+ HPDSTDSYVTYLESDD   D  SP
Sbjct: 389 HGYDI-HGPPSHHDLGPPPNDVGHPDSTDSYVTYLESDDD-HDGSSP 433

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328707561|ref|XP_003243430.1| PREDICTED: insulin gene enhancer protein isl-1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328707559|ref|XP_001944557.2| PREDICTED: insulin gene enhancer protein isl-1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157119485|ref|XP_001653405.1| insulinprotein enhancer protein isl [Aedes aegypti] gi|108883188|gb|EAT47413.1| AAEL001500-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|258645165|ref|NP_001158279.1| tailup [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380018327|ref|XP_003693083.1| PREDICTED: insulin gene enhancer protein ISL-1-like [Apis florea] Back     alignment and taxonomy information
>gi|328793255|ref|XP_003251852.1| PREDICTED: insulin gene enhancer protein ISL-1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383858654|ref|XP_003704814.1| PREDICTED: insulin gene enhancer protein ISL-1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195035223|ref|XP_001989077.1| GH11521 [Drosophila grimshawi] gi|193905077|gb|EDW03944.1| GH11521 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|270011029|gb|EFA07477.1| tailup [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
FB|FBgn0003896 534 tup "tailup" [Drosophila melan 0.583 0.294 0.739 6e-70
ZFIN|ZDB-GENE-980526-112349 isl1 "islet1" [Danio rerio (ta 0.513 0.395 0.694 3.3e-47
ZFIN|ZDB-GENE-980526-562359 isl2a "islet2a" [Danio rerio ( 0.498 0.373 0.692 8.8e-47
UNIPROTKB|P53410319 ISL2 "Insulin gene enhancer pr 0.501 0.423 0.707 1.1e-46
UNIPROTKB|F1PP21360 ISL1 "Uncharacterized protein" 0.498 0.372 0.707 1.8e-46
UNIPROTKB|D6RAK3260 ISL1 "Insulin gene enhancer pr 0.498 0.515 0.707 1.8e-46
UNIPROTKB|P50211349 ISL1 "Insulin gene enhancer pr 0.513 0.395 0.687 2.3e-46
UNIPROTKB|A6H796349 ISL1 "ISL1 protein" [Bos tauru 0.513 0.395 0.687 2.3e-46
UNIPROTKB|P61371349 ISL1 "Insulin gene enhancer pr 0.513 0.395 0.687 2.3e-46
UNIPROTKB|F1SMF7361 ISL1 "Uncharacterized protein" 0.513 0.382 0.687 2.3e-46
FB|FBgn0003896 tup "tailup" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 639 (230.0 bits), Expect = 6.0e-70, Sum P(2) = 6.0e-70
 Identities = 119/161 (73%), Positives = 138/161 (85%)

Query:    71 RVRKVSG-GDGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVW 129
             R ++ SG  DGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMT+LSPRVIRVW
Sbjct:   229 RDKRPSGPSDGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTSLSPRVIRVW 288

Query:   130 FQNKRCKDKKRALAMKQQLQQEKDGRKMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSY 189
             FQNKRCKDKK+ + MK Q+ +EK+GRK+GYG+MQGIPM+ASSPVRHDSP+ +  L+V +Y
Sbjct:   289 FQNKRCKDKKKTIQMKLQMHEEKEGRKLGYGAMQGIPMIASSPVRHDSPLNLQGLDVQTY 348

Query:   190 QPPWKALSDFALHTDLDR---LDPSAAPFQHLVSQMHGYEL 227
             QPPWKALSDFALH DLD    ++     FQ LV+QMHGY+L
Sbjct:   349 QPPWKALSDFALHADLDSNGAINTHTPAFQQLVNQMHGYDL 389
GO:0008293 "torso signaling pathway" evidence=IGI
GO:0007362 "terminal region determination" evidence=IGI
GO:0007390 "germ-band shortening" evidence=IMP
GO:0008258 "head involution" evidence=NAS
GO:0046665 "amnioserosa maintenance" evidence=IMP
GO:0007411 "axon guidance" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0008045 "motor neuron axon guidance" evidence=IMP
GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=IDA
GO:0001102 "RNA polymerase II activating transcription factor binding" evidence=IPI
GO:0007391 "dorsal closure" evidence=IMP
GO:0008407 "chaeta morphogenesis" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0043433 "negative regulation of sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0070983 "dendrite guidance" evidence=IMP
GO:0035310 "notum cell fate specification" evidence=IMP
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0007507 "heart development" evidence=IMP
GO:0000980 "RNA polymerase II distal enhancer sequence-specific DNA binding" evidence=IDA
GO:0048542 "lymph gland development" evidence=IMP
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0022416 "chaeta development" evidence=IMP
GO:0007521 "muscle cell fate determination" evidence=IMP
ZFIN|ZDB-GENE-980526-112 isl1 "islet1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-562 isl2a "islet2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P53410 ISL2 "Insulin gene enhancer protein ISL-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PP21 ISL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D6RAK3 ISL1 "Insulin gene enhancer protein ISL-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P50211 ISL1 "Insulin gene enhancer protein ISL-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6H796 ISL1 "ISL1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P61371 ISL1 "Insulin gene enhancer protein ISL-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMF7 ISL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53405ISL1_DANRENo assigned EC number0.59880.60590.4670yesN/A
P61374ISL1_RATNo assigned EC number0.59320.60590.4670yesN/A
P61371ISL1_HUMANNo assigned EC number0.59320.60590.4670yesN/A
P61372ISL1_MOUSENo assigned EC number0.59320.60590.4670yesN/A
P50211ISL1_CHICKNo assigned EC number0.59320.60590.4670yesN/A
P53410ISL2_CHICKNo assigned EC number0.70710.50180.4231yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
smart0038957 smart00389, HOX, Homeodomain 2e-17
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-17
pfam0004657 pfam00046, Homeobox, Homeobox domain 4e-16
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 8e-10
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information 
 Score = 73.8 bits (182), Expect = 2e-17
 Identities = 22/57 (38%), Positives = 30/57 (52%)

Query: 82  PTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDK 138
             R RT    +QL  L   +  NP P    +E+L +   LS R ++VWFQN+R K K
Sbjct: 1   KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAKWK 57

DNA-binding factors that are involved in the transcriptional regulation of key developmental processes. Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 269
KOG0484|consensus125 99.82
KOG0488|consensus309 99.72
KOG0489|consensus261 99.72
KOG2251|consensus228 99.72
KOG0850|consensus245 99.7
KOG0843|consensus197 99.69
KOG0494|consensus332 99.68
KOG0848|consensus317 99.67
KOG0842|consensus307 99.67
KOG0492|consensus246 99.66
KOG0487|consensus308 99.65
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.64
KOG0485|consensus268 99.61
KOG0486|consensus351 99.61
KOG0493|consensus342 99.59
KOG4577|consensus383 99.55
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.54
KOG0844|consensus408 99.52
COG5576156 Homeodomain-containing transcription factor [Trans 99.51
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.5
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.5
KOG0490|consensus235 99.5
KOG0491|consensus194 99.48
KOG0483|consensus198 99.47
KOG3802|consensus398 99.44
KOG0847|consensus288 99.33
KOG0490|consensus235 99.28
KOG0849|consensus354 99.14
KOG1168|consensus385 99.02
KOG0775|consensus304 98.84
KOG2251|consensus228 98.81
KOG0774|consensus334 98.74
KOG0484|consensus125 98.64
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 98.62
KOG0494|consensus332 98.52
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.46
KOG0486|consensus351 98.44
KOG2252|consensus558 98.36
KOG0843|consensus197 98.35
PF0004657 Homeobox: Homeobox domain not present here.; Inter 98.35
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 98.28
KOG0488|consensus309 98.2
KOG0493|consensus342 98.17
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.11
COG5576156 Homeodomain-containing transcription factor [Trans 98.1
KOG0842|consensus307 97.96
KOG0485|consensus268 97.92
KOG0844|consensus408 97.76
KOG0849|consensus354 97.69
KOG0489|consensus261 97.69
KOG1146|consensus 1406 97.64
KOG0492|consensus246 97.63
KOG0850|consensus245 97.61
KOG4577|consensus383 97.42
KOG0487|consensus308 97.33
KOG3802|consensus398 97.2
KOG0848|consensus317 97.14
KOG2252|consensus558 96.96
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.91
KOG0483|consensus198 96.28
KOG0491|consensus194 96.01
KOG1168|consensus385 95.88
KOG0773|consensus342 95.83
KOG0847|consensus288 95.51
KOG3623|consensus 1007 95.5
KOG3623|consensus 1007 95.28
KOG0774|consensus334 94.9
KOG0775|consensus304 93.89
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 93.82
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 90.17
KOG3755|consensus769 88.03
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 82.94
>KOG0484|consensus Back     alignment and domain information 
Probab=99.82  E-value=1.1e-20  Score=143.27  Aligned_cols=75  Identities=27%  Similarity=0.479  Sum_probs=66.8

Q ss_pred             CCCCccceeecchhhhhhhhhhcccCCCCChHHHHHHHHHhCCCchhhhhhhcchhhhHHHHHHHHHHHhhHhhh
Q psy4078          79 DGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKRALAMKQQLQQEKD  153 (269)
Q Consensus        79 ~~k~rr~Rt~~t~~Ql~~Le~~F~~~~~p~~~~r~~La~~lgL~~~~V~vWFqNRRak~kk~~~~~~~~~q~~~~  153 (269)
                      ++|.||.||+||..||..||+.|.+.+||++-.|++||.++.|++.+|||||||||+|.||+++...-.+....+
T Consensus        14 krKQRRIRTTFTS~QLkELErvF~ETHYPDIYTREEiA~kidLTEARVQVWFQNRRAKfRKQEr~a~~~~~~~~~   88 (125)
T KOG0484|consen   14 KRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREEIALKIDLTEARVQVWFQNRRAKFRKQERAAIAKMAAKSS   88 (125)
T ss_pred             HHHhhhhhhhhhHHHHHHHHHHHHhhcCCcchhHHHHHHhhhhhHHHHHHHHHhhHHHHHHHHHHHHHHhhhhcc
Confidence            456789999999999999999999999999999999999999999999999999999999999865544444433

>KOG0488|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG3755|consensus Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
1bw5_A66 The Nmr Solution Structure Of The Homeodomain Of Th 1e-29
2dmq_A80 Solution Structure Of The Homeobox Domain Of LimHOM 5e-08
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 3e-06
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 1e-05
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 2e-05
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 6e-05
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 8e-05
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 9e-05
2da2_A70 Solution Structure Of The Second Homeobox Domain Of 1e-04
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 4e-04
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 6e-04
2da3_A80 Solution Structure Of The Third Homeobox Domain Of 7e-04
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 7e-04
>pdb|1BW5|A Chain A, The Nmr Solution Structure Of The Homeodomain Of The Rat Insulin Gene Enhancer Protein Isl-1, 50 Structures Length = 66 Back     alignment and structure 
Iteration: 1

 Score =  126 bits (316), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/65 (90%), Positives = 61/65 (93%)
Query: 81  KPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKR 140
           K TRVRTVLNEKQLHTLRTCY ANPRPDALMKEQLVEMT LSPRVIRVWFQNKRCKDKKR
Sbjct: 2   KTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKR 61
Query: 141 ALAMK 145
           ++ MK
Sbjct: 62  SIMMK 66
>pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2DA2|A Chain A, Solution Structure Of The Second Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 70 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2DA3|A Chain A, Solution Structure Of The Third Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 80 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 5e-30
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-14
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 3e-25
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 4e-13
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-24
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 1e-16
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 5e-16
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-05
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-15
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-04
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-15
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-04
2xsd_C164 POU domain, class 3, transcription factor 1; trans 4e-15
2xsd_C164 POU domain, class 3, transcription factor 1; trans 6e-04
1e3o_C160 Octamer-binding transcription factor 1; transcript 9e-15
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-04
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-14
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 6e-05
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-14
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-13
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-12
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 5e-05
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 3e-12
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 3e-12
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 4e-12
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 4e-12
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-11
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-11
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-11
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 8e-11
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-10
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-10
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 3e-10
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 4e-10
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 5e-10
3a02_A60 Homeobox protein aristaless; homeodomain, developm 9e-10
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 9e-10
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 9e-09
2e19_A64 Transcription factor 8; homeobox domain, structura 2e-08
1uhs_A72 HOP, homeodomain only protein; structural genomics 1e-07
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 1e-06
1lfb_A99 Liver transcription factor (LFB1); transcription r 1e-06
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-06
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-06
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 2e-06
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 3e-06
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 9e-06
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-05
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-05
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-05
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-05
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-05
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-05
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-05
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 3e-05
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 3e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 6e-05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 6e-05
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 1e-04
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-04
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 1e-04
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 1e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 2e-04
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 2e-04
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 3e-04
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 3e-04
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 4e-04
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 5e-04
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
 Score =  106 bits (267), Expect = 5e-30
 Identities = 59/65 (90%), Positives = 61/65 (93%)

Query: 81  KPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKR 140
           K TRVRTVLNEKQLHTLRTCY ANPRPDALMKEQLVEMT LSPRVIRVWFQNKRCKDKKR
Sbjct: 2   KTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKR 61

Query: 141 ALAMK 145
           ++ MK
Sbjct: 62  SIMMK 66
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.81
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.79
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.79
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.79
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.79
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.79
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.79
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.78
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.78
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.78
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.78
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.78
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.78
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.78
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.77
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.77
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.77
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.77
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.77
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.77
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.77
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.77
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.76
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.76
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.76
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.76
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.76
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.76
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.75
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.75
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.75
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.75
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.75
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.75
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.75
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.75
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.75
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.74
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.74
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.74
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.74
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.74
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.74
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.74
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.73
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.73
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.72
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.72
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.72
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.71
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.71
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.71
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.7
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.7
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.7
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.69
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.69
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.68
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.67
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.66
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.66
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.66
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.65
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.65
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.65
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.65
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.65
2e19_A64 Transcription factor 8; homeobox domain, structura 99.65
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.65
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.64
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.6
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.56
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.47
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.47
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.42
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.38
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.26
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 98.9
1wh5_A80 ZF-HD homeobox family protein; structural genomics 98.9
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 98.89
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 98.89
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 98.82
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 98.81
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.78
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 98.78
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 98.76
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 98.73
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 98.72
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 98.72
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 98.72
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 98.71
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 98.71
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 98.69
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 98.69
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 98.69
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 98.67
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 98.67
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 98.66
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 98.66
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 98.65
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 98.65
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 98.64
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 98.64
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 98.64
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 98.63
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 98.63
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 98.61
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 98.61
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 98.6
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 98.59
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 98.59
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 98.57
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 98.56
3a01_A93 Homeodomain-containing protein; homeodomain, prote 98.55
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 98.55
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 98.54
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 98.54
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 98.5
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 98.5
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 98.47
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 98.46
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 98.46
3a02_A60 Homeobox protein aristaless; homeodomain, developm 98.45
1lfb_A99 Liver transcription factor (LFB1); transcription r 98.45
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 98.44
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 98.42
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 98.4
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 98.38
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 98.38
1uhs_A72 HOP, homeodomain only protein; structural genomics 98.36
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 98.32
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 98.32
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 98.32
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 98.29
1e3o_C160 Octamer-binding transcription factor 1; transcript 98.29
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 98.28
3d1n_I151 POU domain, class 6, transcription factor 1; prote 98.27
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 98.27
2xsd_C164 POU domain, class 3, transcription factor 1; trans 98.25
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 98.19
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 98.19
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 98.15
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 98.11
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 98.05
2e19_A64 Transcription factor 8; homeobox domain, structura 98.04
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 97.94
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 97.94
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 97.91
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 97.9
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 97.81
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 97.66
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 97.53
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 97.36
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 96.97
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 96.86
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.34
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 84.75
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 81.95
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.81  E-value=2.4e-20  Score=137.43  Aligned_cols=68  Identities=25%  Similarity=0.458  Sum_probs=62.8

Q ss_pred             CCCCCccceeecchhhhhhhhhhcccCCCCChHHHHHHHHHhCCCchhhhhhhcchhhhHHHHHHHHH
Q psy4078          78 GDGKPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKRALAMK  145 (269)
Q Consensus        78 ~~~k~rr~Rt~~t~~Ql~~Le~~F~~~~~p~~~~r~~La~~lgL~~~~V~vWFqNRRak~kk~~~~~~  145 (269)
                      ...+.+|.|+.|+.+|+.+||.+|..++||+..++++||..|||++.+|+|||||||+|+||++....
T Consensus         3 ~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNRR~k~kk~~~~~~   70 (80)
T 2cue_A            3 SGSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRN   70 (80)
T ss_dssp             SCCSSCCCCCCSCHHHHHHHHHHHTTCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCccCHHHHHHHHHHHhccCCCCHHHHHHHHHHhCCCHHHhhHHHHHHHHHHHHHhhhhh
Confidence            34567789999999999999999999999999999999999999999999999999999999876543
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 269
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 3e-21
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 2e-17
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-16
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-16
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 5e-16
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 6e-16
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 6e-16
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-15
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 1e-15
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 2e-15
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-15
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 3e-15
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 4e-15
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-14
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-04
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 3e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 0.002
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 4e-14
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 6e-14
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 9e-14
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-13
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 0.003
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-13
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-04
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 1e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 0.003
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-12
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 5e-12
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 2e-11
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-11
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 3e-11
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-10
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 2e-10
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 1e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 3e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 4e-08
d2fi2a192 a.28.3.2 (A:37-128) Zinc finger protein 42 {Human 3e-04
d1y7qa196 a.28.3.2 (A:37-132) Zinc finger protein 174 {Human 6e-04
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Insulin gene enhancer protein isl-1
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 82.6 bits (204), Expect = 3e-21
 Identities = 59/65 (90%), Positives = 61/65 (93%)

Query: 81  KPTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKKR 140
           K TRVRTVLNEKQLHTLRTCY ANPRPDALMKEQLVEMT LSPRVIRVWFQNKRCKDKKR
Sbjct: 2   KTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKR 61

Query: 141 ALAMK 145
           ++ MK
Sbjct: 62  SIMMK 66
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2fi2a1 a.28.3.2 (A:37-128) Zinc finger protein 42 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1y7qa1 a.28.3.2 (A:37-132) Zinc finger protein 174 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.83
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.82
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.82
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.82
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.82
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.82
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.81
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.81
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.81
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.8
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.8
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.8
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.79
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.79
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.78
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.77
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.76
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.76
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.75
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.75
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.75
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.73
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.7
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.7
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.66
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.66
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.65
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.62
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.62
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.56
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.54
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 98.98
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 98.98
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 98.95
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 98.93
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 98.91
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 98.88
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 98.87
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 98.87
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 98.86
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 98.86
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 98.85
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 98.84
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 98.83
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 98.83
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 98.81
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 98.8
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 98.8
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 98.71
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 98.68
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 98.66
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 98.66
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 98.66
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 98.62
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 98.48
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 98.42
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 98.3
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 98.29
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 98.18
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 98.18
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 97.89
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 97.73
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 97.65
d1hlva166 DNA-binding domain of centromere binding protein B 87.84
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.83  E-value=4.7e-22  Score=135.96  Aligned_cols=57  Identities=35%  Similarity=0.505  Sum_probs=54.8

Q ss_pred             ccceeecchhhhhhhhhhcccCCCCChHHHHHHHHHhCCCchhhhhhhcchhhhHHH
Q psy4078          83 TRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTNLSPRVIRVWFQNKRCKDKK  139 (269)
Q Consensus        83 rr~Rt~~t~~Ql~~Le~~F~~~~~p~~~~r~~La~~lgL~~~~V~vWFqNRRak~kk  139 (269)
                      +|.|+.||.+|+.+||.+|..++||+..++++||..|||++.+|+|||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            467899999999999999999999999999999999999999999999999999985
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure