Psyllid ID: psy4106

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MSPNLVFRQTVAYVEGPGWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGYPIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRRNLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRVFARKEVVLSAGAINSPQILMVSGIGPREHLREKSKFFR
cccccccccHHHHcccccccccccHHHHHHHccccccccccccccccccccEEEEccccccHHHHHHHHHHHHcccccccccccccEEEEEccccccHHHHHHcccccccccEEEcccEEcccccHHccccccccccEEEcccEEEEEEEEccccEEEEEEEEEccEEEEEEEccEEEEEcccccHHHHHHHcccccHHHHHHcccccc
ccccccHHHHHHHcccccccHHHHHHHHHHHHccccccHccccccccccccEEEcccccccHHHHHHHHHHHHccccccccccccccEEEEEEEEEcccccEEEEEEEEEccHEccccccccHHHHHHcHHHcccccEEEEEEEEEEEEEcccccEEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHccEEcHHHHHHHHHHcc
MSPNLVFRQTVAyvegpgwsydevrpffiksednqiendnidslyhrkggyltiteipyktpiahafvqsgyqsgypivdvngaaqtgfsflpvsfnsarlVMGRAWVQSVEVSMrngtrwstsrAFLHPIRRRRNLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRVFARKEVVlsagainspqilmvsgigprehlrekskffr
mspnlvfrqtvayvegpgwsydEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGYPIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVsmrngtrwstsraflhpirrrrnlhvtkfslvtkliidekskravgvelmkgnskirvfARKEVVlsagainspqilmvsgigprehlrekskffr
MSPNLVFRQTVAYVEGPGWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGYPIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRRNLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRVFARKEVVLSAGAINSPQILMVSGIGPREHLREKSKFFR
****LVFRQTVAYVEGPGWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGYPIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRRNLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRVFARKEVVLSAGAINSPQILMVSGI**************
***NLVFRQTVAYVEGPGWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGYPIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRRNLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRVFARKEVVLSAGAINSPQILMVSGIGPREHLREKSKFFR
MSPNLVFRQTVAYVEGPGWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGYPIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRRNLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRVFARKEVVLSAGAINSPQILMVSGIGPREHL********
*SPNLVFRQTVAYVEGPGWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGYPIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRRNLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRVFARKEVVLSAGAINSPQILMVSGIGPREHLREKSKFFR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPNLVFRQTVAYVEGPGWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGYPIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRRNLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRVFARKEVVLSAGAINSPQILMVSGIGPREHLREKSKFFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
P18172 625 Glucose dehydrogenase [ac no N/A 0.799 0.267 0.409 2e-37
P18173 625 Glucose dehydrogenase [ac no N/A 0.799 0.267 0.393 4e-36
Q8BJ64 596 Choline dehydrogenase, mi yes N/A 0.770 0.270 0.331 7e-25
Q8NE62 594 Choline dehydrogenase, mi yes N/A 0.770 0.271 0.342 1e-24
B0CKN4 549 Choline dehydrogenase OS= yes N/A 0.765 0.291 0.342 4e-24
A5VPA6 549 Choline dehydrogenase OS= yes N/A 0.765 0.291 0.342 4e-24
Q8YFY2 549 Choline dehydrogenase OS= no N/A 0.765 0.291 0.342 4e-24
Q8G1Z8 549 Choline dehydrogenase OS= yes N/A 0.765 0.291 0.342 4e-24
A9M9H8 549 Choline dehydrogenase OS= yes N/A 0.765 0.291 0.342 4e-24
Q985M5 550 Choline dehydrogenase OS= no N/A 0.765 0.290 0.358 4e-24
>sp|P18172|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4 Back     alignment and function desciption
 Score =  155 bits (391), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 117/188 (62%), Gaps = 21/188 (11%)

Query: 17  PGWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGY 76
           PGWSY +V PFF KSEDN +E D + + YH KGG L + + PY  P+++A +++G + G+
Sbjct: 175 PGWSYQDVLPFFKKSEDN-LELDAVGTEYHAKGGLLPVGKFPYNPPLSYALLKAGEEMGF 233

Query: 77  PIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRRN 136
            + D+NG   TGF                      +++ RNG R+S++RAFL P R R N
Sbjct: 234 SVQDLNGQNSTGFMI-------------------AQMTARNGIRYSSARAFLRPARMRNN 274

Query: 137 LHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIR-VFARKEVVLSAGAINSPQILMVSGI 195
           LH+   + VTK++I   +K  VGVE+      +R +  +KEV++S GA+NSPQIL++SG+
Sbjct: 275 LHILLNTTVTKVLIHPGTKNVVGVEVSDQFGSMRKILVKKEVIVSGGAVNSPQILLLSGV 334

Query: 196 GPREHLRE 203
           GP+E L++
Sbjct: 335 GPKEDLQK 342

Drosophila pseudoobscura pseudoobscura (taxid: 46245)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0
>sp|P18173|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 Back     alignment and function description
>sp|Q8BJ64|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus GN=Chdh PE=1 SV=1 Back     alignment and function description
>sp|Q8NE62|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=2 SV=2 Back     alignment and function description
>sp|B0CKN4|BETA_BRUSI Choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|A5VPA6|BETA_BRUO2 Choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q8YFY2|BETA_BRUME Choline dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=betA PE=3 SV=2 Back     alignment and function description
>sp|Q8G1Z8|BETA_BRUSU Choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|A9M9H8|BETA_BRUC2 Choline dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q985M5|BETA_RHILO Choline dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
91085213 648 PREDICTED: similar to AGAP003784-PA [Tri 0.799 0.257 0.518 2e-46
328702053 730 PREDICTED: glucose dehydrogenase [accept 0.789 0.226 0.478 1e-45
357631696 624 hypothetical protein KGM_15606 [Danaus p 0.803 0.269 0.497 1e-45
193715996 619 PREDICTED: glucose dehydrogenase [accept 0.794 0.268 0.497 2e-45
193680015 631 PREDICTED: glucose dehydrogenase [accept 0.789 0.261 0.473 3e-44
193680017 622 PREDICTED: glucose dehydrogenase [accept 0.789 0.265 0.467 5e-44
307188177 637 Glucose dehydrogenase [acceptor] [Campon 0.803 0.263 0.475 5e-44
242018472 580 glucose dehydrogenase precursor, putativ 0.803 0.289 0.510 8e-44
307173612 633 Glucose dehydrogenase [acceptor] [Campon 0.803 0.265 0.465 2e-43
383860466 628 PREDICTED: glucose dehydrogenase [accept 0.799 0.265 0.491 3e-43
>gi|91085213|ref|XP_972338.1| PREDICTED: similar to AGAP003784-PA [Tribolium castaneum] gi|270009080|gb|EFA05528.1| hypothetical protein TcasGA2_TC015715 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/189 (51%), Positives = 129/189 (68%), Gaps = 22/189 (11%)

Query: 17  PGWSYDEVRPFFIKSEDNQIENDNID-SLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSG 75
           PGWSY+E+ P+F+KSED +  N  +  + YH  GGY T+ + PY TP+  AF+Q+G + G
Sbjct: 168 PGWSYEEILPYFLKSEDQR--NPYLARNKYHSTGGYQTVQDSPYSTPLGVAFLQAGQEMG 225

Query: 76  YPIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRR 135
           Y I DVNG  QTGF+F                    + +MR GTR STS+AFL PIR R+
Sbjct: 226 YDIRDVNGEKQTGFAFF-------------------QFTMRRGTRCSTSKAFLRPIRLRK 266

Query: 136 NLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRVFARKEVVLSAGAINSPQILMVSGI 195
           NLH++ +S VTK++ID +S+RA GVE +K   K  V ARKEV+LSAGAINSPQ+LM+SG+
Sbjct: 267 NLHISLWSHVTKVLIDPESRRAYGVEFIKNGKKQIVLARKEVILSAGAINSPQLLMLSGV 326

Query: 196 GPREHLREK 204
           GP EHL+EK
Sbjct: 327 GPAEHLQEK 335

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328702053|ref|XP_001942810.2| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357631696|gb|EHJ79165.1| hypothetical protein KGM_15606 [Danaus plexippus] Back     alignment and taxonomy information
>gi|193715996|ref|XP_001951039.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193680015|ref|XP_001946057.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193680017|ref|XP_001946107.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307188177|gb|EFN73009.1| Glucose dehydrogenase [acceptor] [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242018472|ref|XP_002429699.1| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] gi|212514702|gb|EEB16961.1| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307173612|gb|EFN64469.1| Glucose dehydrogenase [acceptor] [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383860466|ref|XP_003705710.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
FB|FBgn0030592 726 CG9514 [Drosophila melanogaste 0.430 0.123 0.5 1.6e-36
FB|FBgn0030590 703 CG9518 [Drosophila melanogaste 0.430 0.128 0.5 7e-36
FB|FBgn0030598 626 CG9503 [Drosophila melanogaste 0.411 0.137 0.546 3.8e-34
UNIPROTKB|Q8NE62 594 CHDH "Choline dehydrogenase, m 0.454 0.159 0.43 5.5e-24
TIGR_CMR|SPO_1088 552 SPO_1088 "choline dehydrogenas 0.430 0.163 0.397 1.6e-23
FB|FBgn0030589 622 CG9519 [Drosophila melanogaste 0.454 0.152 0.540 6.5e-23
FB|FBgn0039415 616 CG6142 [Drosophila melanogaste 0.727 0.246 0.439 1.7e-22
FB|FBgn0030588 621 CG9521 [Drosophila melanogaste 0.559 0.188 0.451 2.3e-22
UNIPROTKB|Q488U4 534 CPS_0670 "Oxidoreductase, GMC 0.779 0.305 0.359 6.5e-21
TIGR_CMR|CPS_0670 534 CPS_0670 "oxidoreductase, GMC 0.779 0.305 0.359 6.5e-21
FB|FBgn0030592 CG9514 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 222 (83.2 bits), Expect = 1.6e-36, Sum P(2) = 1.6e-36
 Identities = 45/90 (50%), Positives = 63/90 (70%)

Query:   112 EVSMRNGTRWSTSRAFLHPIRRRRNLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRV 171
             + +MR G+R ST+++FL P R R NLHV  FS VTK++ D  +KRA GV+ ++      V
Sbjct:   281 QFNMRRGSRSSTAKSFLRPARLRPNLHVALFSHVTKVLTDPHTKRATGVQFIRDGRLQNV 340

Query:   172 FARKEVVLSAGAINSPQILMVSGIGPREHL 201
             +A +EV+LSAGAI SP ++M+SGIG  E L
Sbjct:   341 YATREVILSAGAIGSPHLMMLSGIGHGEEL 370
GO:0008812 "choline dehydrogenase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
FB|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NE62 CHDH "Choline dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1088 SPO_1088 "choline dehydrogenase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
FB|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q488U4 CPS_0670 "Oxidoreductase, GMC family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0670 CPS_0670 "oxidoreductase, GMC family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
PRK02106 560 PRK02106, PRK02106, choline dehydrogenase; Validat 2e-49
COG2303 542 COG2303, BetA, Choline dehydrogenase and related f 3e-41
TIGR01810 532 TIGR01810, betA, choline dehydrogenase 1e-39
pfam00732218 pfam00732, GMC_oxred_N, GMC oxidoreductase 6e-29
TIGR03970 487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 4e-24
PLN02785 587 PLN02785, PLN02785, Protein HOTHEAD 6e-10
PRK07121 492 PRK07121, PRK07121, hypothetical protein; Validate 0.001
TIGR02462 544 TIGR02462, pyranose_ox, pyranose oxidase 0.004
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information 
 Score =  168 bits (427), Expect = 2e-49
 Identities = 76/188 (40%), Positives = 105/188 (55%), Gaps = 27/188 (14%)

Query: 18  GWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITE-IPYKTPIAHAFVQSGYQSGY 76
           GWSY +  P+F K+E      D+    Y    G L++T   P   P+  AFV++G Q+GY
Sbjct: 118 GWSYADCLPYFKKAETRDGGEDD----YRGGDGPLSVTRGKPGTNPLFQAFVEAGVQAGY 173

Query: 77  PIV-DVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRR 135
           P   D+NG  Q GF             M R        ++ NG RWS +RA+L P  +R 
Sbjct: 174 PRTDDLNGYQQEGFG-----------PMDR--------TVTNGRRWSAARAYLDPALKRP 214

Query: 136 NLHVTKFSLVTKLIIDEKSKRAVGVELMKGNSKIRVFARKEVVLSAGAINSPQILMVSGI 195
           NL +   +L  +++ + K  RAVGVE  +G  +    AR+EV+LSAGAINSPQ+L +SGI
Sbjct: 215 NLTIVTHALTDRILFEGK--RAVGVEYERGGGRETARARREVILSAGAINSPQLLQLSGI 272

Query: 196 GPREHLRE 203
           GP EHL+E
Sbjct: 273 GPAEHLKE 280

Length = 560
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|180854 PRK07121, PRK07121, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|131515 TIGR02462, pyranose_ox, pyranose oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
KOG1238|consensus 623 100.0
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 100.0
PRK02106 560 choline dehydrogenase; Validated 100.0
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 100.0
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 100.0
PLN02785 587 Protein HOTHEAD 99.96
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 99.76
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.76
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.74
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.55
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.44
PRK07121 492 hypothetical protein; Validated 97.32
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 97.22
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.18
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.05
PRK12839 572 hypothetical protein; Provisional 97.04
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 96.89
PRK08274 466 tricarballylate dehydrogenase; Validated 96.87
PRK06175 433 L-aspartate oxidase; Provisional 96.71
PRK12842 574 putative succinate dehydrogenase; Reviewed 96.58
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 96.45
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 96.42
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 96.4
PRK07395 553 L-aspartate oxidase; Provisional 96.39
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 96.31
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 96.24
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 96.23
PRK13977 576 myosin-cross-reactive antigen; Provisional 96.23
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 96.21
PLN02815 594 L-aspartate oxidase 96.2
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 96.17
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 96.09
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 96.08
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 96.01
PRK08275 554 putative oxidoreductase; Provisional 95.99
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 95.96
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 95.95
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 95.86
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 95.75
PRK07512 513 L-aspartate oxidase; Provisional 95.74
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 95.7
PRK09077 536 L-aspartate oxidase; Provisional 95.57
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 95.53
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 95.46
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 95.44
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 95.43
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 95.43
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 95.41
KOG2404|consensus 477 95.41
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 95.38
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 95.36
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 95.16
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 95.09
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 95.07
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 95.07
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 94.94
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 94.92
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 94.88
PRK08071 510 L-aspartate oxidase; Provisional 94.59
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 94.58
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 94.47
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 94.41
PLN02464 627 glycerol-3-phosphate dehydrogenase 94.41
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 94.37
PRK07804 541 L-aspartate oxidase; Provisional 94.26
COG0579 429 Predicted dehydrogenase [General function predicti 93.71
PRK05257 494 malate:quinone oxidoreductase; Validated 92.69
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 92.63
PTZ00383 497 malate:quinone oxidoreductase; Provisional 92.43
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 92.36
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 91.74
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 91.68
PRK13339 497 malate:quinone oxidoreductase; Reviewed 91.37
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 90.94
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 90.75
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 90.56
PLN02661357 Putative thiazole synthesis 89.65
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 89.13
PRK06185 407 hypothetical protein; Provisional 89.06
KOG0042|consensus 680 88.75
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 88.71
TIGR02352 337 thiamin_ThiO glycine oxidase ThiO. This family con 88.42
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 88.09
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 87.88
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 87.16
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 86.62
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 86.19
KOG4254|consensus 561 85.73
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 84.85
TIGR03862 376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 84.54
PRK11728 393 hydroxyglutarate oxidase; Provisional 84.34
PRK10157 428 putative oxidoreductase FixC; Provisional 84.32
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 84.31
PRK08401 466 L-aspartate oxidase; Provisional 83.6
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 83.53
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 82.48
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 81.33
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 80.61
PRK07208 479 hypothetical protein; Provisional 80.32
>KOG1238|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.3e-46  Score=338.28  Aligned_cols=189  Identities=44%  Similarity=0.652  Sum_probs=176.2

Q ss_pred             CCCChHhHHHHHhcCCCCCCccchHHHHHHhhcCcCCCCCCCCCCCCCCCceeeecCCCCCHHHHHHHHHHHHcCCCCCC
Q psy4106           1 MSPNLVFRQTVAYVEGPGWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGYPIVD   80 (209)
Q Consensus         1 ~r~~~~~~d~W~~~g~~gW~~~~l~pyf~k~E~~~~~~~~~~~~~~g~~Gpl~v~~~~~~~~~~~~~~~a~~~lG~~~~d   80 (209)
                      +|+++.|||+|++.|++||+|++++|||+|+|+...+. ....++|+..||+.+....+.+++..+|.++.+++|.+..|
T Consensus       152 ~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~-~~~~~y~~~~g~~~ve~~~~~~~~~~~~~~ag~e~G~~~~D  230 (623)
T KOG1238|consen  152 VRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPD-PELTPYHGAGGPLLVEAGVYPNNLFTAFHRAGTEIGGSIFD  230 (623)
T ss_pred             ecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCC-cccCcccccCCcceeccccccCchhhHhHHhHHhcCCCccC
Confidence            48999999999999999999999999999999986542 23445999999999999888999999999999999977799


Q ss_pred             CCCCCCCCccccccccccchhhcccccceeeeeeccCCccccccccccccccc-CCCeEEEcCeEEEEEEeeCCCCeEEE
Q psy4106          81 VNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRR-RRNLHVTKFSLVTKLIIDEKSKRAVG  159 (209)
Q Consensus        81 ~n~~~~~G~~~~~~~~~~~~~~~g~~~~~~~~~~~~~g~R~sa~~~~L~~~~~-~~nl~i~~~~~V~rI~~~~~~~~a~g  159 (209)
                      +|+...+|+...+.                   ++++|.|+|+..+||.|+.. |+||++..++.|+||++|..+++|.|
T Consensus       231 ~nG~~~tg~~~l~~-------------------t~~~g~R~s~~~a~l~~~~~~R~NL~~~~~~~vtrvl~D~~~~~a~g  291 (623)
T KOG1238|consen  231 RNGERHTGASLLQY-------------------TIRNGIRVSLAKAYLKPIRLTRPNLHISRNAAVTRVLIDPAGKRAKG  291 (623)
T ss_pred             CCCccccchhhhhc-------------------cccCCEEEEehhhhhhhhhccCccccccccceEEEEEEcCCCceEEE
Confidence            99999999998887                   89999999999999999876 99999999999999999987889999


Q ss_pred             EEEEeC-CeEEEEEeCcEEEEcCCCcccHHHHHHcCCCCcchhhcCCCccC
Q psy4106         160 VELMKG-NSKIRVFARKEVVLSAGAINSPQILMVSGIGPREHLREKSKFFR  209 (209)
Q Consensus       160 V~~~~~-g~~~~v~A~keVILsaGai~TP~lLl~SGIG~~~~L~~~gI~~~  209 (209)
                      |++..+ |++++++|+||||||||||+||||||+|||||+++|+++||||+
T Consensus       292 v~~~~~~~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~~~L~~~gIpvv  342 (623)
T KOG1238|consen  292 VEFVRDGGKEHTVKARKEVILSAGAINSPQLLMLSGIGPADHLKKLGIPVV  342 (623)
T ss_pred             EEEEecCceeeeecccceEEEeccccCCHHHHHHcCCCcHHHHHhcCCCee
Confidence            999988 89999999999999999999999999999999999999999984

>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
2jbv_A 546 Crystal Structure Of Choline Oxidase Reveals Insigh 4e-17
3ljp_A 546 Crystal Structure Of Choline Oxidase V464a Mutant L 4e-17
3nne_A 546 Crystal Structure Of Choline Oxidase S101a Mutant L 4e-17
3t37_A 526 Crystal Structure Of Pyridoxine 4-Oxidase From Meso 1e-11
3fim_B 566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 9e-11
1cf3_A 583 Glucose Oxidase From Apergillus Niger Length = 583 2e-07
1gpe_A 587 Glucose Oxidase From Penicillium Amagasakiense Leng 9e-07
3q9t_A 577 Crystal Structure Analysis Of Formate Oxidase Lengt 3e-06
3red_A 521 3.0 A Structure Of The Prunus Mume Hydroxynitrile L 3e-05
3gdn_A 521 Almond Hydroxynitrile Lyase In Complex With Benzald 8e-04
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure 
Iteration: 1

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 98/193 (50%), Gaps = 31/193 (16%)
Query: 18  GWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYKTPIAHAFVQSGYQSGYP 77
           GW+ +   P + + E N  E+   D+ +H   G + +  +P K P   A + +  Q+G P
Sbjct: 123 GWNAEAAWPLYKRLETN--EDAGPDAPHHGDSGPVHLMNVPPKDPTGVALLDACEQAGIP 180
Query: 78  IVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMR-NGTRWSTSRAFLHPIRRRRN 136
                             FN+   V+  A     +++ R +GTR S+S +++HPI  + N
Sbjct: 181 RA---------------KFNTGTTVVNGA--NFFQINRRADGTRSSSSVSYIHPIVEQEN 223
Query: 137 LHVTKFSLVTKL----IIDEKSKRAVGVELMKG--NSKIRVFARKEVVLSAGAINSPQIL 190
                F+L+T L    ++ +  +R  GV+++        R+ AR EVVLS GAI++P++L
Sbjct: 224 -----FTLLTGLRARQLVFDADRRCTGVDIVDSAFGHTHRLTARNEVVLSTGAIDTPKLL 278
Query: 191 MVSGIGPREHLRE 203
           M+SGIGP  HL E
Sbjct: 279 MLSGIGPAAHLAE 291
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure
>pdb|3T37|A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti Length = 526 Back     alignment and structure
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|3RED|A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1 Length = 521 Back     alignment and structure
>pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 5e-74
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 2e-71
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 2e-70
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 3e-66
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 1e-64
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 8e-62
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 3e-59
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 6e-53
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 1e-09
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 2e-07
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
 Score =  232 bits (594), Expect = 5e-74
 Identities = 53/201 (26%), Positives = 82/201 (40%), Gaps = 33/201 (16%)

Query: 17  PGWSYDEVRPFFIKSEDNQIENDN------IDSLYHRKGGYLTITEIPYKTPIAHAFVQS 70
            GW++D ++ F  K+E      DN           H   G ++I+   + TP+    + +
Sbjct: 113 EGWNWDNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSISLPGFPTPLDDRVLAT 172

Query: 71  GYQSGYPIV---DVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAF 127
             +         D+      G S+                      S+ NG R S+S A+
Sbjct: 173 TQEQSEEFFFNPDMGTGHPLGISW-------------------SIASVGNGQRSSSSTAY 213

Query: 128 LHPIRRRRNLHVTKFSLVTKLIIDEKSK-----RAVGVELMKGNSKIRVFARKEVVLSAG 182
           L P + R NL V   + VTKL+    +      R V     +G     V A+KEVVLSAG
Sbjct: 214 LRPAQSRPNLSVLINAQVTKLVNSGTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAG 273

Query: 183 AINSPQILMVSGIGPREHLRE 203
           ++ +P +L +SGIG    L  
Sbjct: 274 SVGTPILLQLSGIGDENDLSS 294
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 100.0
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 100.0
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 100.0
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 100.0
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 100.0
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 100.0
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 99.96
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 99.96
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 99.93
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 99.93
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 99.53
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.88
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 96.66
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 96.45
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.34
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 96.15
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 96.13
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 96.09
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 96.07
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 95.79
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 95.74
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 95.5
3dme_A 369 Conserved exported protein; structural genomics, P 94.93
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.85
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 94.38
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 94.34
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 94.24
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 94.04
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 93.79
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 93.66
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 93.6
3atr_A 453 Conserved archaeal protein; saturating double bond 93.23
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 92.89
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 92.72
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 92.52
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 92.52
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 92.43
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 92.2
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 91.94
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 90.76
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 90.64
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 89.95
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 89.63
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 89.6
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 89.09
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 88.83
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 88.78
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 88.61
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 88.46
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 88.29
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 88.26
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 88.12
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 88.03
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 87.99
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 87.89
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 87.58
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 87.45
3r9u_A315 Thioredoxin reductase; structural genomics, center 87.27
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 87.22
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 86.86
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 86.75
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 86.37
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 85.27
2cul_A232 Glucose-inhibited division protein A-related PROT 84.0
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 83.8
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 83.03
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 82.62
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 82.24
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 82.14
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 82.09
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 82.04
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 80.05
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
Probab=100.00  E-value=5.1e-46  Score=343.91  Aligned_cols=190  Identities=27%  Similarity=0.409  Sum_probs=170.1

Q ss_pred             CCCChHhHHHHHhcCCC-CCCccchHHHHHHhhcCcCCCC-------CCCCCCCCCCCceeeecC---CCCCHHHHHHHH
Q psy4106           1 MSPNLVFRQTVAYVEGP-GWSYDEVRPFFIKSEDNQIEND-------NIDSLYHRKGGYLTITEI---PYKTPIAHAFVQ   69 (209)
Q Consensus         1 ~r~~~~~~d~W~~~g~~-gW~~~~l~pyf~k~E~~~~~~~-------~~~~~~~g~~Gpl~v~~~---~~~~~~~~~~~~   69 (209)
                      +|+++.|||.|+++|++ ||+|++|+|||+|+|++..+..       ..+..+||.+||++++++   ....|+...|.+
T Consensus       112 ~Rg~~~Dyd~W~~~g~~~gW~~~~~lpyf~k~E~~~~~~~~~~~~~~~~~~~~hG~~Gpl~v~~~~~~~~~~~~~~~~~~  191 (583)
T 3qvp_A          112 TRPHKAQVDSWETVFGNEGWNWDNVAAYSLQAERARAPNAKQIAAGHYFNASCHGVNGTVHAGPRDTGDDYSPIVKALMS  191 (583)
T ss_dssp             CCCCHHHHHHHHHTSCCTTCSHHHHHHHHHHHEEECCCCHHHHHHTCCCCGGGSCSSSSEEEBCCCCSSCBCTHHHHHHH
T ss_pred             EeCCHHHHHHHHHhCCCCCCChhHHHHHHHHHHhccCCcchhhcccccCCccccCCCCCEEecCCCCcccCCHHHHHHHH
Confidence            59999999999999988 9999999999999999975421       134678999999999987   345789999999


Q ss_pred             HHHHcCCCC-CCCCCCCCCCccccccccccchhhcccccceeeeeecc-CCcccccccccccccccCCCeEEEcCeEEEE
Q psy4106          70 SGYQSGYPI-VDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMR-NGTRWSTSRAFLHPIRRRRNLHVTKFSLVTK  147 (209)
Q Consensus        70 a~~~lG~~~-~d~n~~~~~G~~~~~~~~~~~~~~~g~~~~~~~~~~~~-~g~R~sa~~~~L~~~~~~~nl~i~~~~~V~r  147 (209)
                      +++++|++. .|+|++...|++.++.                   ++. +|.|+|++.+||.|++.++||+|+++++|+|
T Consensus       192 a~~~~G~~~~~D~n~~~~~G~~~~~~-------------------t~~~~g~R~saa~ayL~p~~~r~NL~V~t~a~V~r  252 (583)
T 3qvp_A          192 AVEDRGVPTKKDFGCGDPHGVSMFPN-------------------TLHEDQVRSDAAREWLLPNYQRPNLQVLTGQYVGK  252 (583)
T ss_dssp             HHHTTTCCBCCCTTSSCCCEEECCCB-------------------SBCTTCBBCCHHHHHTTTTTTCTTEEEECSCEEEE
T ss_pred             HHHHcCCCcCCCCCCCCCceecccce-------------------eEcCCCcEecHHHHHHHHhhcCCCcEEEcCCEEEE
Confidence            999999997 7999998899887776                   554 7999999999999988899999999999999


Q ss_pred             EEeeCC--CCeEEEEEEE-eCCeEEEEEeCcEEEEcCCCcccHHHHHHcCCCCcchhhcCCCccC
Q psy4106         148 LIIDEK--SKRAVGVELM-KGNSKIRVFARKEVVLSAGAINSPQILMVSGIGPREHLREKSKFFR  209 (209)
Q Consensus       148 I~~~~~--~~~a~gV~~~-~~g~~~~v~A~keVILsaGai~TP~lLl~SGIG~~~~L~~~gI~~~  209 (209)
                      |+|++.  +++|+||+|. .+|+.++++|+||||||||||+||||||+|||||+++|+++||||+
T Consensus       253 Il~d~~~~~~ra~GV~~~~~~G~~~~v~A~kEVILsAGa~~SPqLL~lSGIGp~~~L~~~GI~vv  317 (583)
T 3qvp_A          253 VLLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEVLLAAGSAVSPTILEYSGIGMKSILEPLGIDTV  317 (583)
T ss_dssp             EEEECSSSSCEEEEEEEESSTTCEEEEEEEEEEEECSCTTTHHHHHHHTTBSCHHHHGGGTCCCS
T ss_pred             EEeccCCCCCEEEEEEEEecCCcEEEEEECCEEEEeCCccCCHHHHHHcCCCCHHHHHhCCCCce
Confidence            999842  5799999999 5788899999999999999999999999999999999999999985
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 1e-22
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 1e-20
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 8e-20
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 1e-19
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 1e-18
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 4e-18
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 6e-14
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Aspergillus niger [TaxId: 5061]

 Score = 91.9 bits (227), Expect = 1e-22
 Identities = 44/200 (22%), Positives = 71/200 (35%), Gaps = 30/200 (15%)

Query: 17  PGWSYDEVRPFFIKSEDNQIENDNIDSLYHRKGGYLTITEIPYK----------TPIAHA 66
            GW++D V  + +++E  +  N    +  H                        +PI  A
Sbjct: 127 EGWNWDNVAAYSLQAERARAPNAKQIAAGHYFNASCHGVNGTVHAGPRDTGDDYSPIVKA 186

Query: 67  FVQSGYQSGYPIVDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRA 126
            + +    G P                  F          +  ++            +R 
Sbjct: 187 LMSAVEDRGVPTKK--------------DFGCGDPHGVSMFPNTLHEDQVR---SDAARE 229

Query: 127 FLHPIRRRRNLHVTKFSLVTKLIIDEKSK--RAVGVELMKGNSKI-RVFARKEVVLSAGA 183
           +L P  +R NL V     V K+++ +     RAVGVE          V+A+ EV+L+AG+
Sbjct: 230 WLLPNYQRPNLQVLTGQYVGKVLLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEVLLAAGS 289

Query: 184 INSPQILMVSGIGPREHLRE 203
             SP IL  SGIG +  L  
Sbjct: 290 AVSPTILEYSGIGMKSILEP 309
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 100.0
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 99.87
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.87
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 99.48
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 97.61
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 97.36
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.3
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 97.04
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 96.72
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.71
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 96.22
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 95.37
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.01
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 94.87
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.36
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.04
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 93.71
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.6
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 93.5
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 93.25
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.1
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.73
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 92.58
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 92.3
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 90.94
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 90.24
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 89.77
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 88.31
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 87.93
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 85.94
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Aspergillus niger [TaxId: 5061]

Probab=100.00  E-value=6.7e-42  Score=299.17  Aligned_cols=191  Identities=27%  Similarity=0.390  Sum_probs=163.1

Q ss_pred             CCCChHhHHHHHhc-CCCCCCccchHHHHHHhhcCcCCCC-------CCCCCCCCCCCceeeecCC---CCCHHHHHHHH
Q psy4106           1 MSPNLVFRQTVAYV-EGPGWSYDEVRPFFIKSEDNQIEND-------NIDSLYHRKGGYLTITEIP---YKTPIAHAFVQ   69 (209)
Q Consensus         1 ~r~~~~~~d~W~~~-g~~gW~~~~l~pyf~k~E~~~~~~~-------~~~~~~~g~~Gpl~v~~~~---~~~~~~~~~~~   69 (209)
                      +|+++.|||.|++. ++++|+|++|+|||+|+|++..+..       ..+...||..+|+.+.++.   ...|+.+.|.+
T Consensus       110 ~R~~~~d~d~w~~~~~~~gw~~~~l~Pyf~k~E~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~p~~~~~~~  189 (385)
T d1cf3a1         110 TRPHKAQVDSWETVFGNEGWNWDNVAAYSLQAERARAPNAKQIAAGHYFNASCHGVNGTVHAGPRDTGDDYSPIVKALMS  189 (385)
T ss_dssp             CCCCHHHHHHHHHTTCCTTCSHHHHHHHHHHHEEECCCCHHHHHHTCCCCGGGSCSSSSEEEBCCCCSSCBCTHHHHHHH
T ss_pred             eccChhhhcccccccCCCcCchhhhHHHHHHHHhhcCCCcccccccccccccccCCcccccccccccccccCHHHHHHHH
Confidence            59999999999995 8899999999999999999877532       2355679999999987653   35789999999


Q ss_pred             HHHHcCCCC-CCCCCCCCCCccccccccccchhhcccccceeeeeeccCCcccccccccccccccCCCeEEEcCeEEEEE
Q psy4106          70 SGYQSGYPI-VDVNGAAQTGFSFLPVSFNSARLVMGRAWVQSVEVSMRNGTRWSTSRAFLHPIRRRRNLHVTKFSLVTKL  148 (209)
Q Consensus        70 a~~~lG~~~-~d~n~~~~~G~~~~~~~~~~~~~~~g~~~~~~~~~~~~~g~R~sa~~~~L~~~~~~~nl~i~~~~~V~rI  148 (209)
                      +++++|++. .|.|.....|++.++..                  .+..+.|++++.+|+.|+..++|++|+++++|+||
T Consensus       190 a~~~~G~~~~~d~n~~~~~~~~~~~~~------------------~~~~~~~~~s~~~~~~p~~~~~nl~i~t~~~V~rI  251 (385)
T d1cf3a1         190 AVEDRGVPTKKDFGCGDPHGVSMFPNT------------------LHEDQVRSDAAREWLLPNYQRPNLQVLTGQYVGKV  251 (385)
T ss_dssp             HHHTTTCCBCCCTTSSCCCEEECCCBS------------------BCTTCBBCCHHHHHTGGGTTCTTEEEEESCEEEEE
T ss_pred             HHHHcCCCCcCCccccccccccccccc------------------ccccccchhhhhhhcCchhcCCcccccCCceEEEE
Confidence            999999998 78888877776655541                  23345666677789999989999999999999999


Q ss_pred             EeeCC--CCeEEEEEEEe-CCeEEEEEeCcEEEEcCCCcccHHHHHHcCCCCcchhhcCCCccC
Q psy4106         149 IIDEK--SKRAVGVELMK-GNSKIRVFARKEVVLSAGAINSPQILMVSGIGPREHLREKSKFFR  209 (209)
Q Consensus       149 ~~~~~--~~~a~gV~~~~-~g~~~~v~A~keVILsaGai~TP~lLl~SGIG~~~~L~~~gI~~~  209 (209)
                      +|+++  ..||+||+|.. +|+.++++|+||||||||||+||+|||+|||||+++|+++|||++
T Consensus       252 ~~~~~~~~~ra~GV~~~~~~g~~~~v~A~keVILsAGAi~SP~LLl~SGIGp~~~L~~~gI~~~  315 (385)
T d1cf3a1         252 LLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEVLLAAGSAVSPTILEYSGIGMKSILEPLGIDTV  315 (385)
T ss_dssp             EEECSSSSCEEEEEEEEEETTEEEEEEEEEEEEECSCTTTHHHHHHHTTBSCHHHHGGGTCCCS
T ss_pred             EEcCCCceeEEEEEEEEcCCCCEEEEEeCCEEEEcCchhhCHHHHHhcCCCcHHHHHHCCCCeE
Confidence            99864  23899999975 789999999999999999999999999999999999999999985
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure