Psyllid ID: psy4157
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 441 | ||||||
| 156548948 | 394 | PREDICTED: acetyl-CoA acetyltransferase, | 0.480 | 0.538 | 0.603 | 1e-70 | |
| 288959154 | 391 | acetyl-CoA C-acetyltransferase [Azospiri | 0.469 | 0.529 | 0.612 | 1e-70 | |
| 380026455 | 396 | PREDICTED: acetyl-CoA acetyltransferase, | 0.482 | 0.537 | 0.607 | 3e-70 | |
| 374292777 | 391 | Acetyl-CoA acetyltransferase with thiola | 0.521 | 0.588 | 0.575 | 4e-70 | |
| 260782216 | 394 | hypothetical protein BRAFLDRAFT_109688 [ | 0.480 | 0.538 | 0.574 | 6e-70 | |
| 260823516 | 324 | hypothetical protein BRAFLDRAFT_211236 [ | 0.480 | 0.654 | 0.574 | 6e-70 | |
| 443702200 | 394 | hypothetical protein CAPTEDRAFT_145800 [ | 0.512 | 0.573 | 0.562 | 2e-69 | |
| 306841486 | 394 | acetyl-CoA acetyltransferase [Brucella s | 0.496 | 0.555 | 0.598 | 3e-69 | |
| 265984783 | 394 | acetyl-CoA acetyltransferase [Brucella s | 0.496 | 0.555 | 0.598 | 4e-69 | |
| 23502628 | 394 | acetyl-CoA acetyltransferase [Brucella s | 0.496 | 0.555 | 0.598 | 5e-69 |
| >gi|156548948|ref|XP_001607032.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 273 bits (699), Expect = 1e-70, Method: Compositional matrix adjust.
Identities = 128/212 (60%), Positives = 166/212 (78%)
Query: 214 AIKSGDATAIVAGGQECMSQAPHVINIRNGIKLNDAEMKDSMVFDGLTDAFHNIHMGITA 273
AIKSG++ IVAGGQE MS+APH I++R+G+K+ DA M D+M+ DGLTD F+NIHMG+TA
Sbjct: 104 AIKSGESEVIVAGGQESMSKAPHAIHLRDGVKMGDATMVDTMLVDGLTDVFNNIHMGVTA 163
Query: 274 ENIAKKWSISRLEQDEYAYQSQVKTAKAQEGGYFDEEIVPVVISTRKGDVVVAKDEYPKA 333
EN+AKK++ISR EQDE+A +SQ K A GYFD+EI+PV ++ R+ +V+KDE+PK
Sbjct: 164 ENLAKKYAISREEQDEFAARSQHKAEIAMTKGYFDKEIIPVPVTIRRKTTIVSKDEFPKP 223
Query: 334 NTTVEALQKLRPVFQKDGTVTAGNASGINDGAAAVLLMSYKTAQARNIQPLARIVAMSSA 393
TT + L L+PVF KDGTVT GNASGINDGAAAV+LMS +TA + ++P+ARIVAM+
Sbjct: 224 GTTAKDLAGLKPVFVKDGTVTPGNASGINDGAAAVVLMSSETATKKGLKPMARIVAMTVV 283
Query: 394 GVEPTLMGTGPIPAVNAVLAKAGWSKEEVGYF 425
G+EP +MG GP+PAV +L KA W KEEV F
Sbjct: 284 GLEPDIMGYGPVPAVELLLKKAQWKKEEVDLF 315
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|288959154|ref|YP_003449495.1| acetyl-CoA C-acetyltransferase [Azospirillum sp. B510] gi|288911462|dbj|BAI72951.1| acetyl-CoA C-acetyltransferase [Azospirillum sp. B510] | Back alignment and taxonomy information |
|---|
| >gi|380026455|ref|XP_003696967.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|374292777|ref|YP_005039812.1| Acetyl-CoA acetyltransferase with thiolase domain (Acetoacetyl-CoA thiolase) [Azospirillum lipoferum 4B] gi|357424716|emb|CBS87595.1| Acetyl-CoA acetyltransferase with thiolase domain (Acetoacetyl-CoA thiolase) [Azospirillum lipoferum 4B] | Back alignment and taxonomy information |
|---|
| >gi|260782216|ref|XP_002586186.1| hypothetical protein BRAFLDRAFT_109688 [Branchiostoma floridae] gi|229271281|gb|EEN42197.1| hypothetical protein BRAFLDRAFT_109688 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|260823516|ref|XP_002604229.1| hypothetical protein BRAFLDRAFT_211236 [Branchiostoma floridae] gi|229289554|gb|EEN60240.1| hypothetical protein BRAFLDRAFT_211236 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|443702200|gb|ELU00361.1| hypothetical protein CAPTEDRAFT_145800 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|306841486|ref|ZP_07474186.1| acetyl-CoA acetyltransferase [Brucella sp. BO2] gi|306288450|gb|EFM59806.1| acetyl-CoA acetyltransferase [Brucella sp. BO2] | Back alignment and taxonomy information |
|---|
| >gi|265984783|ref|ZP_06097518.1| acetyl-CoA acetyltransferase [Brucella sp. 83/13] gi|306839459|ref|ZP_07472267.1| acetyl-CoA acetyltransferase [Brucella sp. NF 2653] gi|264663375|gb|EEZ33636.1| acetyl-CoA acetyltransferase [Brucella sp. 83/13] gi|306405404|gb|EFM61675.1| acetyl-CoA acetyltransferase [Brucella sp. NF 2653] | Back alignment and taxonomy information |
|---|
| >gi|23502628|ref|NP_698755.1| acetyl-CoA acetyltransferase [Brucella suis 1330] gi|163845349|ref|YP_001623004.1| acetyl-CoA acetyltransferase [Brucella suis ATCC 23445] gi|256370178|ref|YP_003107689.1| acetyl-CoA acetyltransferase [Brucella microti CCM 4915] gi|261219353|ref|ZP_05933634.1| acetyl-CoA acetyltransferase [Brucella ceti M13/05/1] gi|261222890|ref|ZP_05937171.1| acetyl-CoA acetyltransferase [Brucella ceti B1/94] gi|261316270|ref|ZP_05955467.1| acetyl-CoA acetyltransferase [Brucella pinnipedialis B2/94] gi|261322415|ref|ZP_05961612.1| acetyl-CoA acetyltransferase [Brucella ceti M644/93/1] gi|261750922|ref|ZP_05994631.1| acetyl-CoA acetyltransferase [Brucella suis bv. 5 str. 513] gi|265987336|ref|ZP_06099893.1| acetyl-CoA acetyltransferase [Brucella pinnipedialis M292/94/1] gi|265998849|ref|ZP_06111406.1| acetyl-CoA acetyltransferase [Brucella ceti M490/95/1] gi|340791368|ref|YP_004756833.1| acetyl-CoA acetyltransferase [Brucella pinnipedialis B2/94] gi|376281423|ref|YP_005155429.1| acetyl-CoA acetyltransferase [Brucella suis VBI22] gi|384225415|ref|YP_005616579.1| acetyl-CoA acetyltransferase [Brucella suis 1330] gi|23348634|gb|AAN30670.1| acetyl-CoA acetyltransferase [Brucella suis 1330] gi|163676072|gb|ABY40182.1| acetyl-CoA acetyltransferase [Brucella suis ATCC 23445] gi|256000341|gb|ACU48740.1| acetyl-CoA acetyltransferase [Brucella microti CCM 4915] gi|260921474|gb|EEX88127.1| acetyl-CoA acetyltransferase [Brucella ceti B1/94] gi|260924442|gb|EEX91010.1| acetyl-CoA acetyltransferase [Brucella ceti M13/05/1] gi|261295105|gb|EEX98601.1| acetyl-CoA acetyltransferase [Brucella ceti M644/93/1] gi|261295493|gb|EEX98989.1| acetyl-CoA acetyltransferase [Brucella pinnipedialis B2/94] gi|261740675|gb|EEY28601.1| acetyl-CoA acetyltransferase [Brucella suis bv. 5 str. 513] gi|262553538|gb|EEZ09307.1| acetyl-CoA acetyltransferase [Brucella ceti M490/95/1] gi|264659533|gb|EEZ29794.1| acetyl-CoA acetyltransferase [Brucella pinnipedialis M292/94/1] gi|340559827|gb|AEK55065.1| acetyl-CoA acetyltransferase [Brucella pinnipedialis B2/94] gi|343383595|gb|AEM19087.1| acetyl-CoA acetyltransferase [Brucella suis 1330] gi|358259022|gb|AEU06757.1| acetyl-CoA acetyltransferase [Brucella suis VBI22] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 441 | ||||||
| UNIPROTKB|F1LS48 | 653 | Acat3 "Protein Acat3" [Rattus | 0.489 | 0.330 | 0.545 | 9.9e-64 | |
| UNIPROTKB|F1SB62 | 406 | ACAT2 "Uncharacterized protein | 0.489 | 0.532 | 0.577 | 1.6e-63 | |
| UNIPROTKB|F1Q466 | 406 | ACAT2 "Uncharacterized protein | 0.489 | 0.532 | 0.559 | 6.2e-62 | |
| UNIPROTKB|B7Z233 | 426 | ACAT2 "cDNA FLJ53975, highly s | 0.489 | 0.507 | 0.555 | 3.4e-61 | |
| UNIPROTKB|Q9BWD1 | 397 | ACAT2 "Acetyl-CoA acetyltransf | 0.489 | 0.544 | 0.555 | 3.4e-61 | |
| FB|FBgn0035203 | 392 | CG9149 [Drosophila melanogaste | 0.480 | 0.540 | 0.570 | 3.4e-61 | |
| MGI|MGI:87871 | 397 | Acat2 "acetyl-Coenzyme A acety | 0.489 | 0.544 | 0.550 | 1.9e-60 | |
| UNIPROTKB|Q17QI3 | 397 | ACAT2 "Uncharacterized protein | 0.489 | 0.544 | 0.541 | 2.4e-60 | |
| RGD|1359366 | 397 | Acat2 "acetyl-CoA acetyltransf | 0.489 | 0.544 | 0.545 | 2.4e-60 | |
| RGD|1562948 | 397 | RGD1562948 "similar to Ab2-076 | 0.489 | 0.544 | 0.536 | 1.7e-59 |
| UNIPROTKB|F1LS48 Acat3 "Protein Acat3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 618 (222.6 bits), Expect = 9.9e-64, Sum P(2) = 9.9e-64
Identities = 119/218 (54%), Positives = 162/218 (74%)
Query: 210 LARIAIKSGDATAIVAGGQECMSQAPHVINIRNGIKLNDAEMKDSMVFDGLTDAFHNIHM 269
LA +I GD+T +VAGG E MS+APH+ ++R+G+K+ + + DS++ DGLTDAFHN HM
Sbjct: 101 LAAQSIAMGDSTIVVAGGMENMSKAPHLAHLRSGVKMGEVPLADSILCDGLTDAFHNYHM 160
Query: 270 GITAENIAKKWSISRLEQDEYAYQSQVKTAKAQEGGYFDEEIVPVVISTRKGDVVVAKDE 329
GITAEN+AKKW +SR QD+ A SQ + AQ+ G+FD+EIVPV +S+RKG V DE
Sbjct: 161 GITAENVAKKWQVSREAQDKVAVVSQNRAEHAQKAGHFDKEIVPVHVSSRKGLTEVKIDE 220
Query: 330 YPKANTTVEALQKLRPVFQKDGT--VTAGNASGINDGAAAVLLMSYKTAQARNIQPLARI 387
+P+ + +EA+ KL+P F DGT VT NASG+NDGAAAV+LM A++R ++PLA++
Sbjct: 221 FPRHGSNLEAMSKLKPYFLTDGTGTVTPANASGMNDGAAAVVLMKKTEAESRMLKPLAQV 280
Query: 388 VAMSSAGVEPTLMGTGPIPAVNAVLAKAGWSKEEVGYF 425
V+ S AGVEP++MG GPIPA+ +AKAGWS E+V F
Sbjct: 281 VSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDVF 318
|
|
| UNIPROTKB|F1SB62 ACAT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q466 ACAT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z233 ACAT2 "cDNA FLJ53975, highly similar to Acetyl-CoA acetyltransferase, cytosolic (EC 2.3.1.9)" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BWD1 ACAT2 "Acetyl-CoA acetyltransferase, cytosolic" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0035203 CG9149 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:87871 Acat2 "acetyl-Coenzyme A acetyltransferase 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q17QI3 ACAT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1359366 Acat2 "acetyl-CoA acetyltransferase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1562948 RGD1562948 "similar to Ab2-076" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 441 | |||
| PRK05790 | 393 | PRK05790, PRK05790, putative acyltransferase; Prov | 1e-111 | |
| cd00751 | 386 | cd00751, thiolase, Thiolase are ubiquitous enzymes | 1e-101 | |
| TIGR01930 | 386 | TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltrans | 7e-88 | |
| PRK09051 | 394 | PRK09051, PRK09051, beta-ketothiolase; Provisional | 7e-86 | |
| PRK05656 | 393 | PRK05656, PRK05656, acetyl-CoA acetyltransferase; | 3e-75 | |
| pfam00108 | 262 | pfam00108, Thiolase_N, Thiolase, N-terminal domain | 1e-71 | |
| PRK05790 | 393 | PRK05790, PRK05790, putative acyltransferase; Prov | 3e-71 | |
| PRK08235 | 393 | PRK08235, PRK08235, acetyl-CoA acetyltransferase; | 5e-71 | |
| PRK09050 | 401 | PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; | 5e-68 | |
| PRK06633 | 392 | PRK06633, PRK06633, acetyl-CoA acetyltransferase; | 1e-65 | |
| TIGR02430 | 400 | TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase | 6e-64 | |
| cd00751 | 386 | cd00751, thiolase, Thiolase are ubiquitous enzymes | 1e-61 | |
| PRK06205 | 404 | PRK06205, PRK06205, acetyl-CoA acetyltransferase; | 3e-61 | |
| PRK13359 | 400 | PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; | 1e-59 | |
| pfam00108 | 262 | pfam00108, Thiolase_N, Thiolase, N-terminal domain | 2e-58 | |
| PLN02644 | 394 | PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | 3e-57 | |
| PRK09051 | 394 | PRK09051, PRK09051, beta-ketothiolase; Provisional | 1e-55 | |
| COG0183 | 392 | COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid | 1e-55 | |
| TIGR01930 | 386 | TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltrans | 3e-54 | |
| PRK08131 | 401 | PRK08131, PRK08131, acetyl-CoA acetyltransferase; | 5e-51 | |
| PRK09052 | 399 | PRK09052, PRK09052, acetyl-CoA acetyltransferase; | 1e-50 | |
| PRK08235 | 393 | PRK08235, PRK08235, acetyl-CoA acetyltransferase; | 7e-49 | |
| PRK07851 | 406 | PRK07851, PRK07851, acetyl-CoA acetyltransferase; | 3e-48 | |
| PRK06445 | 394 | PRK06445, PRK06445, acetyl-CoA acetyltransferase; | 1e-47 | |
| PRK07661 | 391 | PRK07661, PRK07661, acetyl-CoA acetyltransferase; | 1e-47 | |
| PRK08947 | 387 | PRK08947, fadA, 3-ketoacyl-CoA thiolase; Reviewed | 8e-47 | |
| PRK05656 | 393 | PRK05656, PRK05656, acetyl-CoA acetyltransferase; | 2e-45 | |
| PRK06954 | 397 | PRK06954, PRK06954, acetyl-CoA acetyltransferase; | 6e-45 | |
| PLN02287 | 452 | PLN02287, PLN02287, 3-ketoacyl-CoA thiolase | 1e-43 | |
| PRK08242 | 402 | PRK08242, PRK08242, acetyl-CoA acetyltransferase; | 1e-41 | |
| PRK07108 | 392 | PRK07108, PRK07108, acetyl-CoA acetyltransferase; | 4e-41 | |
| PRK09050 | 401 | PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; | 1e-39 | |
| PLN02644 | 394 | PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | 1e-37 | |
| PRK06633 | 392 | PRK06633, PRK06633, acetyl-CoA acetyltransferase; | 2e-37 | |
| PRK08170 | 426 | PRK08170, PRK08170, acetyl-CoA acetyltransferase; | 3e-37 | |
| PRK06205 | 404 | PRK06205, PRK06205, acetyl-CoA acetyltransferase; | 1e-36 | |
| TIGR02445 | 385 | TIGR02445, fadA, fatty oxidation complex, beta sub | 2e-36 | |
| PRK06366 | 388 | PRK06366, PRK06366, acetyl-CoA acetyltransferase; | 1e-35 | |
| TIGR02430 | 400 | TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase | 2e-35 | |
| PRK06690 | 361 | PRK06690, PRK06690, acetyl-CoA acetyltransferase; | 2e-34 | |
| PRK07801 | 382 | PRK07801, PRK07801, acetyl-CoA acetyltransferase; | 1e-33 | |
| PRK06025 | 417 | PRK06025, PRK06025, acetyl-CoA acetyltransferase; | 3e-33 | |
| PRK13359 | 400 | PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; | 1e-32 | |
| PRK05790 | 393 | PRK05790, PRK05790, putative acyltransferase; Prov | 4e-32 | |
| COG0183 | 392 | COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid | 2e-30 | |
| PRK09052 | 399 | PRK09052, PRK09052, acetyl-CoA acetyltransferase; | 3e-30 | |
| PRK07850 | 387 | PRK07850, PRK07850, acetyl-CoA acetyltransferase; | 3e-30 | |
| cd00751 | 386 | cd00751, thiolase, Thiolase are ubiquitous enzymes | 6e-30 | |
| cd00826 | 393 | cd00826, nondecarbox_cond_enzymes, nondecarboxylat | 1e-29 | |
| PRK07851 | 406 | PRK07851, PRK07851, acetyl-CoA acetyltransferase; | 3e-29 | |
| PRK06504 | 390 | PRK06504, PRK06504, acetyl-CoA acetyltransferase; | 3e-28 | |
| PRK09268 | 427 | PRK09268, PRK09268, acetyl-CoA acetyltransferase; | 6e-28 | |
| PRK08963 | 428 | PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed | 6e-28 | |
| PRK06954 | 397 | PRK06954, PRK06954, acetyl-CoA acetyltransferase; | 1e-27 | |
| PRK08131 | 401 | PRK08131, PRK08131, acetyl-CoA acetyltransferase; | 3e-27 | |
| PRK09051 | 394 | PRK09051, PRK09051, beta-ketothiolase; Provisional | 4e-27 | |
| PRK07661 | 391 | PRK07661, PRK07661, acetyl-CoA acetyltransferase; | 5e-27 | |
| PRK07108 | 392 | PRK07108, PRK07108, acetyl-CoA acetyltransferase; | 1e-26 | |
| PLN02287 | 452 | PLN02287, PLN02287, 3-ketoacyl-CoA thiolase | 1e-25 | |
| PRK08947 | 387 | PRK08947, fadA, 3-ketoacyl-CoA thiolase; Reviewed | 2e-25 | |
| PRK06445 | 394 | PRK06445, PRK06445, acetyl-CoA acetyltransferase; | 2e-24 | |
| TIGR01930 | 386 | TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltrans | 4e-24 | |
| PRK09050 | 401 | PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; | 2e-23 | |
| PRK08242 | 402 | PRK08242, PRK08242, acetyl-CoA acetyltransferase; | 2e-22 | |
| PRK08235 | 393 | PRK08235, PRK08235, acetyl-CoA acetyltransferase; | 1e-21 | |
| PRK08170 | 426 | PRK08170, PRK08170, acetyl-CoA acetyltransferase; | 3e-21 | |
| PRK05656 | 393 | PRK05656, PRK05656, acetyl-CoA acetyltransferase; | 1e-20 | |
| pfam00108 | 262 | pfam00108, Thiolase_N, Thiolase, N-terminal domain | 1e-20 | |
| PRK06366 | 388 | PRK06366, PRK06366, acetyl-CoA acetyltransferase; | 2e-20 | |
| PRK06690 | 361 | PRK06690, PRK06690, acetyl-CoA acetyltransferase; | 2e-19 | |
| TIGR02430 | 400 | TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase | 8e-19 | |
| PRK08963 | 428 | PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed | 8e-19 | |
| TIGR02446 | 430 | TIGR02446, FadI, fatty oxidation complex, beta sub | 1e-18 | |
| PRK07850 | 387 | PRK07850, PRK07850, acetyl-CoA acetyltransferase; | 2e-18 | |
| PRK06205 | 404 | PRK06205, PRK06205, acetyl-CoA acetyltransferase; | 3e-18 | |
| PRK09268 | 427 | PRK09268, PRK09268, acetyl-CoA acetyltransferase; | 3e-17 | |
| PRK13359 | 400 | PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; | 4e-17 | |
| cd00826 | 393 | cd00826, nondecarbox_cond_enzymes, nondecarboxylat | 4e-17 | |
| PRK06025 | 417 | PRK06025, PRK06025, acetyl-CoA acetyltransferase; | 2e-16 | |
| TIGR02445 | 385 | TIGR02445, fadA, fatty oxidation complex, beta sub | 3e-16 | |
| PLN02644 | 394 | PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | 5e-15 | |
| PRK07801 | 382 | PRK07801, PRK07801, acetyl-CoA acetyltransferase; | 5e-15 | |
| PRK06504 | 390 | PRK06504, PRK06504, acetyl-CoA acetyltransferase; | 1e-13 | |
| COG0183 | 392 | COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid | 3e-13 | |
| PRK08963 | 428 | PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed | 5e-13 | |
| PRK09268 | 427 | PRK09268, PRK09268, acetyl-CoA acetyltransferase; | 2e-12 | |
| TIGR02446 | 430 | TIGR02446, FadI, fatty oxidation complex, beta sub | 2e-11 | |
| PRK08170 | 426 | PRK08170, PRK08170, acetyl-CoA acetyltransferase; | 3e-11 | |
| pfam02803 | 123 | pfam02803, Thiolase_C, Thiolase, C-terminal domain | 3e-11 | |
| PRK06690 | 361 | PRK06690, PRK06690, acetyl-CoA acetyltransferase; | 5e-11 | |
| TIGR02446 | 430 | TIGR02446, FadI, fatty oxidation complex, beta sub | 1e-08 | |
| cd00327 | 254 | cd00327, cond_enzymes, Condensing enzymes; Family | 2e-08 | |
| PRK06366 | 388 | PRK06366, PRK06366, acetyl-CoA acetyltransferase; | 9e-08 | |
| COG0304 | 412 | COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) sy | 4e-07 | |
| cd00834 | 406 | cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier prot | 1e-06 | |
| PRK07801 | 382 | PRK07801, PRK07801, acetyl-CoA acetyltransferase; | 2e-06 | |
| PRK06504 | 390 | PRK06504, PRK06504, acetyl-CoA acetyltransferase; | 1e-05 | |
| TIGR03150 | 407 | TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protei | 8e-04 | |
| PRK07314 | 411 | PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protei | 0.002 | |
| PRK07103 | 410 | PRK07103, PRK07103, polyketide beta-ketoacyl:acyl | 0.003 |
| >gnl|CDD|180261 PRK05790, PRK05790, putative acyltransferase; Provisional | Back alignment and domain information |
|---|
Score = 331 bits (851), Expect = e-111
Identities = 126/215 (58%), Positives = 159/215 (73%), Gaps = 2/215 (0%)
Query: 210 LARIAIKSGDATAIVAGGQECMSQAPHVI-NIRNGIKLNDAEMKDSMVFDGLTDAFHNIH 268
LA AI++GDA +VAGGQE MSQAPHV+ R G K+ D E+ D+M+ DGLTDAF+ H
Sbjct: 97 LAAQAIRAGDADIVVAGGQESMSQAPHVLPGSRWGQKMGDVELVDTMIHDGLTDAFNGYH 156
Query: 269 MGITAENIAKKWSISRLEQDEYAYQSQVKTAKAQEGGYFDEEIVPVVISTRKGD-VVVAK 327
MGITAEN+A+++ I+R EQDE+A SQ K A + G F +EIVPV I RKGD VVV
Sbjct: 157 MGITAENLAEQYGITREEQDEFALASQQKAEAAIKAGRFKDEIVPVTIKQRKGDPVVVDT 216
Query: 328 DEYPKANTTVEALQKLRPVFQKDGTVTAGNASGINDGAAAVLLMSYKTAQARNIQPLARI 387
DE+P+ +TT E+L KLRP F KDGTVTAGNASGINDGAAAV++MS A+ + PLARI
Sbjct: 217 DEHPRPDTTAESLAKLRPAFDKDGTVTAGNASGINDGAAAVVVMSEAKAKELGLTPLARI 276
Query: 388 VAMSSAGVEPTLMGTGPIPAVNAVLAKAGWSKEEV 422
V+ + AGV+P +MG GP+PA+ L KAGWS ++
Sbjct: 277 VSYAVAGVDPAIMGIGPVPAIRKALEKAGWSLADL 311
|
Length = 393 |
| >gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|233642 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|181625 PRK09051, PRK09051, beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168156 PRK05656, PRK05656, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215722 pfam00108, Thiolase_N, Thiolase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|180261 PRK05790, PRK05790, putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181311 PRK08235, PRK08235, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181624 PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168632 PRK06633, PRK06633, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131483 TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase | Back alignment and domain information |
|---|
| >gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|235741 PRK06205, PRK06205, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183998 PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215722 pfam00108, Thiolase_N, Thiolase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215347 PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|181625 PRK09051, PRK09051, beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233642 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|181242 PRK08131, PRK08131, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181626 PRK09052, PRK09052, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181311 PRK08235, PRK08235, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181146 PRK07851, PRK07851, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180563 PRK06445, PRK06445, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181072 PRK07661, PRK07661, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181592 PRK08947, fadA, 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|168156 PRK05656, PRK05656, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180775 PRK06954, PRK06954, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215161 PLN02287, PLN02287, 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >gnl|CDD|236197 PRK08242, PRK08242, acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180843 PRK07108, PRK07108, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181624 PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215347 PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|168632 PRK06633, PRK06633, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181265 PRK08170, PRK08170, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235741 PRK06205, PRK06205, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131498 TIGR02445, fadA, fatty oxidation complex, beta subunit FadA | Back alignment and domain information |
|---|
| >gnl|CDD|102340 PRK06366, PRK06366, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131483 TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase | Back alignment and domain information |
|---|
| >gnl|CDD|180659 PRK06690, PRK06690, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181123 PRK07801, PRK07801, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235675 PRK06025, PRK06025, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183998 PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180261 PRK05790, PRK05790, putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181626 PRK09052, PRK09052, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181145 PRK07850, PRK07850, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|238422 cd00826, nondecarbox_cond_enzymes, nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|181146 PRK07851, PRK07851, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180595 PRK06504, PRK06504, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236440 PRK09268, PRK09268, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181597 PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180775 PRK06954, PRK06954, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181242 PRK08131, PRK08131, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181625 PRK09051, PRK09051, beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181072 PRK07661, PRK07661, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180843 PRK07108, PRK07108, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215161 PLN02287, PLN02287, 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >gnl|CDD|181592 PRK08947, fadA, 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180563 PRK06445, PRK06445, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233642 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|181624 PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236197 PRK08242, PRK08242, acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181311 PRK08235, PRK08235, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181265 PRK08170, PRK08170, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168156 PRK05656, PRK05656, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215722 pfam00108, Thiolase_N, Thiolase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|102340 PRK06366, PRK06366, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180659 PRK06690, PRK06690, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131483 TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase | Back alignment and domain information |
|---|
| >gnl|CDD|181597 PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|131499 TIGR02446, FadI, fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >gnl|CDD|181145 PRK07850, PRK07850, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235741 PRK06205, PRK06205, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236440 PRK09268, PRK09268, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183998 PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238422 cd00826, nondecarbox_cond_enzymes, nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|235675 PRK06025, PRK06025, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131498 TIGR02445, fadA, fatty oxidation complex, beta subunit FadA | Back alignment and domain information |
|---|
| >gnl|CDD|215347 PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|181123 PRK07801, PRK07801, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180595 PRK06504, PRK06504, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181597 PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236440 PRK09268, PRK09268, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131499 TIGR02446, FadI, fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >gnl|CDD|181265 PRK08170, PRK08170, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|145779 pfam02803, Thiolase_C, Thiolase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|180659 PRK06690, PRK06690, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131499 TIGR02446, FadI, fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >gnl|CDD|102340 PRK06366, PRK06366, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223381 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238430 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II | Back alignment and domain information |
|---|
| >gnl|CDD|181123 PRK07801, PRK07801, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180595 PRK06504, PRK06504, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200247 TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protein synthase II | Back alignment and domain information |
|---|
| >gnl|CDD|235987 PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180839 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl carrier protein synthase; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 441 | |||
| KOG1391|consensus | 396 | 100.0 | ||
| KOG1390|consensus | 396 | 100.0 | ||
| PRK06025 | 417 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| KOG1390|consensus | 396 | 100.0 | ||
| PRK13359 | 400 | beta-ketoadipyl CoA thiolase; Provisional | 100.0 | |
| PRK08242 | 402 | acetyl-CoA acetyltransferase; Validated | 100.0 | |
| PRK09051 | 394 | beta-ketothiolase; Provisional | 100.0 | |
| PRK08235 | 393 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| TIGR02445 | 385 | fadA fatty oxidation complex, beta subunit FadA. T | 100.0 | |
| PRK06504 | 390 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK09050 | 401 | beta-ketoadipyl CoA thiolase; Validated | 100.0 | |
| TIGR02430 | 400 | pcaF beta-ketoadipyl CoA thiolase. Members of this | 100.0 | |
| PRK06205 | 404 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK08947 | 387 | fadA 3-ketoacyl-CoA thiolase; Reviewed | 100.0 | |
| PRK06366 | 388 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK06633 | 392 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| TIGR02446 | 430 | FadI fatty oxidation complex, beta subunit FadI. T | 100.0 | |
| PRK08131 | 401 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK07850 | 387 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK05656 | 393 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK06445 | 394 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK06954 | 397 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK08963 | 428 | fadI 3-ketoacyl-CoA thiolase; Reviewed | 100.0 | |
| KOG1391|consensus | 396 | 100.0 | ||
| PRK09052 | 399 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK07661 | 391 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK05790 | 393 | putative acyltransferase; Provisional | 100.0 | |
| PRK08170 | 426 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK09268 | 427 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PLN02287 | 452 | 3-ketoacyl-CoA thiolase | 100.0 | |
| TIGR01930 | 386 | AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi | 100.0 | |
| cd00751 | 386 | thiolase Thiolase are ubiquitous enzymes that cata | 100.0 | |
| PRK07108 | 392 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK06690 | 361 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| KOG1389|consensus | 435 | 100.0 | ||
| PF00108 | 264 | Thiolase_N: Thiolase, N-terminal domain; InterPro: | 100.0 | |
| KOG1389|consensus | 435 | 100.0 | ||
| PRK06025 | 417 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PLN02644 | 394 | acetyl-CoA C-acetyltransferase | 100.0 | |
| PRK07801 | 382 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PRK07851 | 406 | acetyl-CoA acetyltransferase; Provisional | 100.0 | |
| PF00108 | 264 | Thiolase_N: Thiolase, N-terminal domain; InterPro: | 100.0 | |
| PRK08256 | 391 | lipid-transfer protein; Provisional | 99.98 | |
| PRK06157 | 398 | acetyl-CoA acetyltransferase; Validated | 99.97 | |
| PRK06066 | 385 | acetyl-CoA acetyltransferase; Provisional | 99.97 | |
| PRK08242 | 402 | acetyl-CoA acetyltransferase; Validated | 99.97 | |
| PRK06065 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.97 | |
| PRK06289 | 403 | acetyl-CoA acetyltransferase; Provisional | 99.97 | |
| PRK06365 | 430 | acetyl-CoA acetyltransferase; Provisional | 99.97 | |
| PRK08142 | 388 | acetyl-CoA acetyltransferase; Provisional | 99.97 | |
| PRK07937 | 352 | lipid-transfer protein; Provisional | 99.97 | |
| cd00829 | 375 | SCP-x_thiolase Thiolase domain associated with ste | 99.97 | |
| PRK13359 | 400 | beta-ketoadipyl CoA thiolase; Provisional | 99.97 | |
| PRK12578 | 385 | acetyl-CoA acetyltransferase; Provisional | 99.97 | |
| COG0183 | 392 | PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis | 99.96 | |
| PRK08313 | 386 | acetyl-CoA acetyltransferase; Provisional | 99.96 | |
| PRK06158 | 384 | thiolase; Provisional | 99.96 | |
| cd00826 | 393 | nondecarbox_cond_enzymes nondecarboxylating conden | 99.96 | |
| PTZ00455 | 438 | 3-ketoacyl-CoA thiolase; Provisional | 99.96 | |
| PRK07516 | 389 | acetyl-CoA acetyltransferase; Provisional | 99.96 | |
| PRK07855 | 386 | lipid-transfer protein; Provisional | 99.96 | |
| PRK06059 | 399 | lipid-transfer protein; Provisional | 99.96 | |
| PRK06064 | 389 | acetyl-CoA acetyltransferase; Provisional | 99.96 | |
| KOG1392|consensus | 465 | 99.96 | ||
| PRK09050 | 401 | beta-ketoadipyl CoA thiolase; Validated | 99.95 | |
| TIGR02430 | 400 | pcaF beta-ketoadipyl CoA thiolase. Members of this | 99.95 | |
| PRK08235 | 393 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PRK05656 | 393 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PRK09051 | 394 | beta-ketothiolase; Provisional | 99.94 | |
| PRK06205 | 404 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PRK06504 | 390 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PRK06954 | 397 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PRK07850 | 387 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PRK08131 | 401 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PRK06633 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PRK08257 | 498 | acetyl-CoA acetyltransferase; Validated | 99.92 | |
| PRK07108 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.92 | |
| KOG1406|consensus | 408 | 99.92 | ||
| KOG1392|consensus | 465 | 99.92 | ||
| PRK09268 | 427 | acetyl-CoA acetyltransferase; Provisional | 99.91 | |
| PRK09052 | 399 | acetyl-CoA acetyltransferase; Provisional | 99.91 | |
| PRK06366 | 388 | acetyl-CoA acetyltransferase; Provisional | 99.91 | |
| TIGR02446 | 430 | FadI fatty oxidation complex, beta subunit FadI. T | 99.9 | |
| PRK08963 | 428 | fadI 3-ketoacyl-CoA thiolase; Reviewed | 99.9 | |
| TIGR02445 | 385 | fadA fatty oxidation complex, beta subunit FadA. T | 99.9 | |
| COG0183 | 392 | PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis | 99.9 | |
| PRK08170 | 426 | acetyl-CoA acetyltransferase; Provisional | 99.89 | |
| PRK06445 | 394 | acetyl-CoA acetyltransferase; Provisional | 99.89 | |
| PRK07661 | 391 | acetyl-CoA acetyltransferase; Provisional | 99.88 | |
| PRK06690 | 361 | acetyl-CoA acetyltransferase; Provisional | 99.87 | |
| PRK08947 | 387 | fadA 3-ketoacyl-CoA thiolase; Reviewed | 99.86 | |
| PLN02287 | 452 | 3-ketoacyl-CoA thiolase | 99.85 | |
| PLN02644 | 394 | acetyl-CoA C-acetyltransferase | 99.85 | |
| PRK05790 | 393 | putative acyltransferase; Provisional | 99.84 | |
| PRK07851 | 406 | acetyl-CoA acetyltransferase; Provisional | 99.76 | |
| TIGR01930 | 386 | AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi | 99.72 | |
| cd00751 | 386 | thiolase Thiolase are ubiquitous enzymes that cata | 99.7 | |
| PRK07801 | 382 | acetyl-CoA acetyltransferase; Provisional | 99.64 | |
| cd00826 | 393 | nondecarbox_cond_enzymes nondecarboxylating conden | 99.34 | |
| PF02803 | 123 | Thiolase_C: Thiolase, C-terminal domain; InterPro: | 99.22 | |
| TIGR03150 | 407 | fabF beta-ketoacyl-acyl-carrier-protein synthase I | 99.04 | |
| PTZ00050 | 421 | 3-oxoacyl-acyl carrier protein synthase; Provision | 98.98 | |
| PRK06333 | 424 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.87 | |
| PRK14691 | 342 | 3-oxoacyl-(acyl carrier protein) synthase II; Prov | 98.86 | |
| cd00829 | 375 | SCP-x_thiolase Thiolase domain associated with ste | 98.83 | |
| PRK07314 | 411 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.74 | |
| PRK08256 | 391 | lipid-transfer protein; Provisional | 98.74 | |
| PTZ00455 | 438 | 3-ketoacyl-CoA thiolase; Provisional | 98.68 | |
| PLN02836 | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase | 98.59 | |
| PRK06064 | 389 | acetyl-CoA acetyltransferase; Provisional | 98.55 | |
| PRK06289 | 403 | acetyl-CoA acetyltransferase; Provisional | 98.52 | |
| PRK08722 | 414 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.51 | |
| PRK06157 | 398 | acetyl-CoA acetyltransferase; Validated | 98.49 | |
| cd00327 | 254 | cond_enzymes Condensing enzymes; Family of enzymes | 98.48 | |
| PRK06365 | 430 | acetyl-CoA acetyltransferase; Provisional | 98.47 | |
| cd00828 | 407 | elong_cond_enzymes "elongating" condensing enzymes | 98.37 | |
| PRK07910 | 418 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.3 | |
| PRK05952 | 381 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.29 | |
| PRK12578 | 385 | acetyl-CoA acetyltransferase; Provisional | 98.28 | |
| PRK07103 | 410 | polyketide beta-ketoacyl:acyl carrier protein synt | 98.26 | |
| smart00825 | 424 | PKS_KS Beta-ketoacyl synthase. The structure of be | 98.25 | |
| cd00834 | 406 | KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) | 98.13 | |
| cd00833 | 421 | PKS polyketide synthases (PKSs) polymerize simple | 98.13 | |
| PRK07516 | 389 | acetyl-CoA acetyltransferase; Provisional | 98.04 | |
| cd00825 | 332 | decarbox_cond_enzymes decarboxylating condensing e | 97.97 | |
| PRK06059 | 399 | lipid-transfer protein; Provisional | 97.92 | |
| PRK06501 | 425 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 97.91 | |
| PRK09116 | 405 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 97.86 | |
| COG0304 | 412 | FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li | 97.84 | |
| PLN02787 | 540 | 3-oxoacyl-[acyl-carrier-protein] synthase II | 97.79 | |
| KOG1394|consensus | 440 | 97.67 | ||
| cd00832 | 399 | CLF Chain-length factor (CLF) is a factor required | 97.55 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 97.51 | |
| PRK06158 | 384 | thiolase; Provisional | 97.5 | |
| PRK06519 | 398 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 97.43 | |
| PRK08439 | 406 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 97.15 | |
| PRK06066 | 385 | acetyl-CoA acetyltransferase; Provisional | 97.12 | |
| PRK09185 | 392 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 97.01 | |
| PRK06147 | 348 | 3-oxoacyl-(acyl carrier protein) synthase; Validat | 96.64 | |
| PRK08313 | 386 | acetyl-CoA acetyltransferase; Provisional | 96.52 | |
| PRK07967 | 406 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 96.32 | |
| COG3321 | 1061 | Polyketide synthase modules and related proteins [ | 96.06 | |
| PRK07855 | 386 | lipid-transfer protein; Provisional | 95.18 | |
| PRK06065 | 392 | acetyl-CoA acetyltransferase; Provisional | 94.8 | |
| PF02801 | 119 | Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina | 94.55 | |
| PRK07937 | 352 | lipid-transfer protein; Provisional | 93.64 | |
| PRK08142 | 388 | acetyl-CoA acetyltransferase; Provisional | 92.73 | |
| PRK07515 | 372 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 88.39 | |
| PRK08257 | 498 | acetyl-CoA acetyltransferase; Validated | 87.78 | |
| cd00830 | 320 | KAS_III Ketoacyl-acyl carrier protein synthase III | 83.99 | |
| PRK07204 | 329 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 80.88 |
| >KOG1391|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-45 Score=346.38 Aligned_cols=228 Identities=43% Similarity=0.670 Sum_probs=218.4
Q ss_pred chhhHHhhhcCeeEEEEeecccCCCCccchh-cccccccCcccccchhhhcccccccccchHHHHHHHHHHHhCCCHHHH
Q psy4157 209 PLARIAIKSGDATAIVAGGQECMSQAPHVIN-IRNGIKLNDAEMKDSMVFDGLTDAFHNIHMGITAENIAKKWSISRLEQ 287 (441)
Q Consensus 209 ~~A~~~I~sG~advvla~G~E~ms~~P~~~~-~r~g~~~g~~~~~~d~~~~g~~~~~~~~~ma~~Ae~~a~~~Gitre~l 287 (441)
..+++.|..|+++++|++|.|+||++|+... -|+|.++|....+.|.+|.++++++....|+++||++..+|.|+||+.
T Consensus 99 VNgaQ~I~vgea~ivL~GGtEnMSq~Pf~vRnvRFGT~LG~~y~lED~LW~sLtD~y~kLpMa~TAEnL~~qyKisRee~ 178 (396)
T KOG1391|consen 99 VNGAQEICVGEAEIVLCGGTENMSQAPFCVRNVRFGTKLGSDYKLEDSLWVSLTDQYVKLPMAMTAENLAVQYKISREEC 178 (396)
T ss_pred HhhHHHhhcCcceEEEecCccccccCcceeeeeeeccccccccchhhhHhhhccchhhhcchhhhHHHhhhhheecHHHh
Confidence 4689999999999999999999999999765 788999887667788888899999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhhhhCCCCCccccceeeecCCCceeEeccCCCCCCCCHHHHhcCCCccccCCccccCCCCCCCCCcEE
Q psy4157 288 DEYAYQSQVKTAKAQEGGYFDEEIVPVVISTRKGDVVVAKDEYPKANTTVEALQKLRPVFQKDGTVTAGNASGINDGAAA 367 (441)
Q Consensus 288 d~~A~~S~~~A~~A~~~g~f~~ei~Pv~v~~~~g~~~~~~D~~~r~~~t~e~l~~~~~v~~p~G~lt~~n~~~~sDGAAA 367 (441)
|+||++|++++.++++.|.|++||.|++++.++|+..+.-|||+|+.+|+|+|.++||+|+++|++|++|.+.++|||+|
T Consensus 179 DefaL~SQ~~Wkkaq~aG~fn~Ei~pI~~K~kkge~~f~vDEHpRp~TT~E~L~KLppvFkKdG~VtAGnASGi~DGA~A 258 (396)
T KOG1391|consen 179 DEFALQSQQRWKKAQDAGYFNDEIAPIEVKTKKGEQTFQVDEHPRPQTTLEQLQKLPPVFKKDGTVTAGNASGIADGAGA 258 (396)
T ss_pred hHHHhhhHHHHHhhhhcCcccccccceEEeeccCceeeEecCCCCccchHHHHhhCCchhccCCeeeccccccccCCcee
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEcCHHHHHhcCCCceEEEEEEEeecCCCCcCCCChHHHHHHHHHHcCCCCCCccEEEecCCChhhhh
Q psy4157 368 VLLMSYKTAQARNIQPLARIVAMSSAGVEPTLMGTGPIPAVNAVLAKAGWSKEEVGYFNRVATSGGIAN 436 (441)
Q Consensus 368 vVLaSe~~A~~lg~~p~a~I~~~~~~~~~p~~~~~~~~~Aa~~al~~AGl~~~DID~~Ei~D~Ft~~~~ 436 (441)
||++|||..++++++|++||++|..++++|..|+.+|++|++.+|+++|+++.|||++|+||+|+....
T Consensus 259 vivAsEdavK~~NlkPLARiVays~vGcdP~IMGIGPvPAI~~vLKksGlkl~DiDl~EvNEAFApQ~L 327 (396)
T KOG1391|consen 259 VIVASEDAVKKHNLKPLARIVAYSVVGCDPSIMGIGPVPAISGVLKKSGLKLKDIDLVEVNEAFAPQYL 327 (396)
T ss_pred EEEechhHHhhcCCchhhhhheeeeeccChhhccccCcHHHHHHHHHcCCcccccceEEechhhchHHH
Confidence 999999999999999999999999999999999999999999999999999999999999999997654
|
|
| >KOG1390|consensus | Back alignment and domain information |
|---|
| >PRK06025 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1390|consensus | Back alignment and domain information |
|---|
| >PRK13359 beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK08242 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK09051 beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >PRK08235 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02445 fadA fatty oxidation complex, beta subunit FadA | Back alignment and domain information |
|---|
| >PRK06504 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09050 beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >TIGR02430 pcaF beta-ketoadipyl CoA thiolase | Back alignment and domain information |
|---|
| >PRK06205 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >PRK06366 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06633 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02446 FadI fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >PRK08131 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07850 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05656 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06445 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06954 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >KOG1391|consensus | Back alignment and domain information |
|---|
| >PRK09052 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07661 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05790 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08170 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09268 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02287 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >PRK07108 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06690 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1389|consensus | Back alignment and domain information |
|---|
| >PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 | Back alignment and domain information |
|---|
| >KOG1389|consensus | Back alignment and domain information |
|---|
| >PRK06025 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02644 acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >PRK07801 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07851 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 | Back alignment and domain information |
|---|
| >PRK08256 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06157 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK06066 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08242 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK06065 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06289 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06365 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08142 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07937 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism | Back alignment and domain information |
|---|
| >PRK13359 beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK12578 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK08313 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06158 thiolase; Provisional | Back alignment and domain information |
|---|
| >cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >PTZ00455 3-ketoacyl-CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK07516 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07855 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06059 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06064 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1392|consensus | Back alignment and domain information |
|---|
| >PRK09050 beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >TIGR02430 pcaF beta-ketoadipyl CoA thiolase | Back alignment and domain information |
|---|
| >PRK08235 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05656 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09051 beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >PRK06205 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06504 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06954 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07850 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08131 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06633 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08257 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07108 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1406|consensus | Back alignment and domain information |
|---|
| >KOG1392|consensus | Back alignment and domain information |
|---|
| >PRK09268 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09052 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06366 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02446 FadI fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02445 fadA fatty oxidation complex, beta subunit FadA | Back alignment and domain information |
|---|
| >COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK08170 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06445 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07661 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06690 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >PLN02287 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >PLN02644 acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >PRK05790 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07851 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >PRK07801 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 | Back alignment and domain information |
|---|
| >TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II | Back alignment and domain information |
|---|
| >PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional | Back alignment and domain information |
|---|
| >PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional | Back alignment and domain information |
|---|
| >cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism | Back alignment and domain information |
|---|
| >PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK08256 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00455 3-ketoacyl-CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase | Back alignment and domain information |
|---|
| >PRK06064 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06289 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK06157 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >PRK06365 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases | Back alignment and domain information |
|---|
| >PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK12578 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated | Back alignment and domain information |
|---|
| >smart00825 PKS_KS Beta-ketoacyl synthase | Back alignment and domain information |
|---|
| >cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II | Back alignment and domain information |
|---|
| >cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations | Back alignment and domain information |
|---|
| >PRK07516 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >PRK06059 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II | Back alignment and domain information |
|---|
| >KOG1394|consensus | Back alignment and domain information |
|---|
| >cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >PRK06158 thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK06066 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated | Back alignment and domain information |
|---|
| >PRK08313 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK07855 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06065 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 | Back alignment and domain information |
|---|
| >PRK07937 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK08142 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK08257 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems | Back alignment and domain information |
|---|
| >PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 441 | ||||
| 1wl4_A | 397 | Human Cytosolic Acetoacetyl-Coa Thiolase Complexed | 2e-67 | ||
| 1dlu_A | 389 | Unliganded Biosynthetic Thiolase From Zoogloea Rami | 2e-65 | ||
| 2wkv_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 2e-65 | ||
| 2wku_A | 392 | Biosynthetic Thiolase From Z. Ramigera. The N316h M | 2e-65 | ||
| 1m1t_A | 392 | Biosynthetic Thiolase, Q64a Mutant Length = 392 | 2e-65 | ||
| 2wl5_C | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 2e-65 | ||
| 2wl6_A | 392 | Biosynthetic Thiolase From Z. Ramigera. The N316h-H | 3e-65 | ||
| 2wkt_C | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 3e-65 | ||
| 2vu2_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Wit | 3e-65 | ||
| 2wl4_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 3e-65 | ||
| 2wl4_C | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 3e-65 | ||
| 1qfl_A | 389 | Biosynthetic Thiolase From Zoogloea Ramigera In Com | 3e-65 | ||
| 2wl5_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 4e-65 | ||
| 1m4s_A | 392 | Biosynthetic Thiolase, Cys89 Acetylated, Unliganded | 4e-65 | ||
| 2wkt_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 4e-65 | ||
| 2wl4_B | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 4e-65 | ||
| 2wl4_D | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 4e-65 | ||
| 1m1o_A | 392 | Crystal Structure Of Biosynthetic Thiolase, C89a Mu | 5e-65 | ||
| 4dd5_A | 396 | Biosynthetic Thiolase (Thla1) From Clostridium Diff | 7e-61 | ||
| 4e1l_A | 395 | Crystal Structure Of Acetoacetyl-Coa Thiolase (Thla | 1e-56 | ||
| 3ss6_A | 394 | Crystal Structure Of The Bacillus Anthracis Acetyl- | 9e-53 | ||
| 2ibu_A | 395 | Crystallographic And Kinetic Studies Of Human Mitoc | 5e-40 | ||
| 2ib7_A | 395 | Crystallographic And Kinetic Studies Of Human Mitoc | 5e-40 | ||
| 2f2s_A | 406 | Human Mitochondrial Acetoacetyl-Coa Thiolase Length | 6e-40 | ||
| 1ulq_A | 401 | Crystal Structure Of Tt0182 From Thermus Thermophil | 1e-39 | ||
| 2iik_A | 418 | Crystal Structure Of Human Peroxisomal Acetyl-Coa A | 4e-31 | ||
| 1afw_A | 393 | The 1.8 Angstrom Crystal Structure Of The Dimeric P | 7e-29 | ||
| 1pxt_A | 390 | The 2.8 Angstroms Structure Of Peroxisomal 3-Ketoac | 9e-29 | ||
| 2wua_A | 440 | Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolas | 6e-28 | ||
| 2wu9_A | 442 | Crystal Structure Of Peroxisomal Kat2 From Arabidop | 8e-28 | ||
| 2c7y_A | 404 | Plant Enzyme Length = 404 | 1e-27 | ||
| 3svk_A | 407 | Crystal Structure Of Acetyl-Coa Acetyltransferase F | 8e-27 | ||
| 1wdk_C | 390 | Fatty Acid Beta-Oxidation Multienzyme Complex From | 3e-26 | ||
| 3goa_A | 387 | Crystal Structure Of The Salmonella Typhimurium Fad | 6e-26 |
| >pdb|1WL4|A Chain A, Human Cytosolic Acetoacetyl-Coa Thiolase Complexed With Coa Length = 397 | Back alignment and structure |
|
| >pdb|1DLU|A Chain A, Unliganded Biosynthetic Thiolase From Zoogloea Ramigera Length = 389 | Back alignment and structure |
| >pdb|2WKV|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The N316d Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|2WKU|A Chain A, Biosynthetic Thiolase From Z. Ramigera. The N316h Mutant. Length = 392 | Back alignment and structure |
| >pdb|1M1T|A Chain A, Biosynthetic Thiolase, Q64a Mutant Length = 392 | Back alignment and structure |
| >pdb|2WL5|C Chain C, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348n Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|2WL6|A Chain A, Biosynthetic Thiolase From Z. Ramigera. The N316h-H348n Mutant. Length = 392 | Back alignment and structure |
| >pdb|2WKT|C Chain C, Biosynthetic Thiolase From Z. Ramigera. Complex Of The N316a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|2VU2|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex With S- Pantetheine-11-pivalate. Length = 392 | Back alignment and structure |
| >pdb|2WL4|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|2WL4|C Chain C, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|1QFL|A Chain A, Biosynthetic Thiolase From Zoogloea Ramigera In Complex With A Reaction Intermediate. Length = 389 | Back alignment and structure |
| >pdb|2WL5|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348n Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|1M4S|A Chain A, Biosynthetic Thiolase, Cys89 Acetylated, Unliganded Form Length = 392 | Back alignment and structure |
| >pdb|2WKT|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The N316a Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|2WL4|B Chain B, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|2WL4|D Chain D, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|1M1O|A Chain A, Crystal Structure Of Biosynthetic Thiolase, C89a Mutant, Complexed With Acetoacetyl-Coa Length = 392 | Back alignment and structure |
| >pdb|4DD5|A Chain A, Biosynthetic Thiolase (Thla1) From Clostridium Difficile Length = 396 | Back alignment and structure |
| >pdb|4E1L|A Chain A, Crystal Structure Of Acetoacetyl-Coa Thiolase (Thla2) From Clostridium Difficile Length = 395 | Back alignment and structure |
| >pdb|3SS6|A Chain A, Crystal Structure Of The Bacillus Anthracis Acetyl-Coa Acetyltransferase Length = 394 | Back alignment and structure |
| >pdb|2IBU|A Chain A, Crystallographic And Kinetic Studies Of Human Mitochondrial Acetoacetyl-coa Thiolase (t2): The Importance Of Potassium And Chloride For Its Structure And Function Length = 395 | Back alignment and structure |
| >pdb|2IB7|A Chain A, Crystallographic And Kinetic Studies Of Human Mitochondrial Acetoacetyl-Coa Thiolase (T2): The Importance Of Potassium And Chloride For Its Structure And Function Length = 395 | Back alignment and structure |
| >pdb|2F2S|A Chain A, Human Mitochondrial Acetoacetyl-Coa Thiolase Length = 406 | Back alignment and structure |
| >pdb|1ULQ|A Chain A, Crystal Structure Of Tt0182 From Thermus Thermophilus Hb8 Length = 401 | Back alignment and structure |
| >pdb|2IIK|A Chain A, Crystal Structure Of Human Peroxisomal Acetyl-Coa Acyl Transferase 1 (Acaa1) Length = 418 | Back alignment and structure |
| >pdb|1AFW|A Chain A, The 1.8 Angstrom Crystal Structure Of The Dimeric Peroxisomal Thiolase Of Saccharomyces Cerevisiae Length = 393 | Back alignment and structure |
| >pdb|1PXT|A Chain A, The 2.8 Angstroms Structure Of Peroxisomal 3-Ketoacyl-Coa Thiolase Of Saccharomyces Cerevisiae: A Five Layered A-B-A- B-A Structure, Constructed From Two Core Domains Of Identical Topology Length = 390 | Back alignment and structure |
| >pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase From Sunflower Length = 440 | Back alignment and structure |
| >pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis Thaliana Length = 442 | Back alignment and structure |
| >pdb|2C7Y|A Chain A, Plant Enzyme Length = 404 | Back alignment and structure |
| >pdb|3SVK|A Chain A, Crystal Structure Of Acetyl-Coa Acetyltransferase From Mycobacterium Avium Length = 407 | Back alignment and structure |
| >pdb|1WDK|C Chain C, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 390 | Back alignment and structure |
| >pdb|3GOA|A Chain A, Crystal Structure Of The Salmonella Typhimurium Fada 3- Ketoacyl-Coa Thiolase Length = 387 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 441 | |||
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 1e-126 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 8e-82 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 4e-36 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 1e-125 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 5e-81 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 2e-36 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 1e-124 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 2e-82 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 1e-123 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 1e-78 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 3e-33 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 1e-122 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 3e-78 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 3e-36 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 1e-111 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 2e-69 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 9e-34 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 1e-109 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 1e-67 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 6e-28 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 1e-100 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 1e-58 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 1e-29 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 2e-99 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 2e-57 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 3e-29 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 1e-94 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 5e-60 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 2e-92 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 2e-51 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 6e-28 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 5e-90 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 8e-55 | |
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 1e-72 | |
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 1e-45 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-06 |
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Length = 392 | Back alignment and structure |
|---|
Score = 370 bits (953), Expect = e-126
Identities = 116/216 (53%), Positives = 150/216 (69%)
Query: 210 LARIAIKSGDATAIVAGGQECMSQAPHVINIRNGIKLNDAEMKDSMVFDGLTDAFHNIHM 269
L I +GDA+ IVAGG E MS APH ++R G+K+ D +M D+M+ DGLTDAF+ HM
Sbjct: 98 LGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHM 157
Query: 270 GITAENIAKKWSISRLEQDEYAYQSQVKTAKAQEGGYFDEEIVPVVISTRKGDVVVAKDE 329
G TAEN+AK+W +SR EQD +A SQ K AQ+ G F +EIVP ++ RKGD+ V DE
Sbjct: 158 GTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADE 217
Query: 330 YPKANTTVEALQKLRPVFQKDGTVTAGNASGINDGAAAVLLMSYKTAQARNIQPLARIVA 389
Y + T++++ KLRP F K+GTVTAGNASG+NDGAAA LLMS A R IQPL RIV+
Sbjct: 218 YIRHGATLDSMAKLRPAFDKEGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVS 277
Query: 390 MSSAGVEPTLMGTGPIPAVNAVLAKAGWSKEEVGYF 425
++ GV+P +MGTGPIPA L +AGW ++
Sbjct: 278 WATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLV 313
|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Length = 392 | Back alignment and structure |
|---|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Length = 392 | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Length = 396 | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Length = 396 | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Length = 396 | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Length = 395 | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Length = 395 | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Length = 397 | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Length = 397 | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Length = 397 | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Length = 394 | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Length = 394 | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Length = 394 | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 401 | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 401 | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 401 | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Length = 395 | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Length = 395 | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Length = 395 | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Length = 390 | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Length = 390 | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Length = 390 | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Length = 393 | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Length = 393 | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Length = 393 | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Length = 387 | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Length = 387 | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Length = 387 | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Length = 442 | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Length = 442 | Back alignment and structure |
|---|
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Length = 407 | Back alignment and structure |
|---|
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Length = 407 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 441 | |||
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 100.0 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 100.0 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 100.0 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 100.0 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 100.0 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 100.0 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 100.0 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 100.0 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 100.0 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 100.0 | |
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 100.0 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 100.0 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 100.0 | |
| 4egv_A | 520 | Acetyl-COA acetyltransferase; NEW SUB-family, thio | 99.96 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 99.93 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 99.92 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 99.91 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 99.91 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 99.9 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 99.9 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 99.88 | |
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 99.85 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 99.84 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 99.81 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 99.8 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 99.79 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 99.79 | |
| 4egv_A | 520 | Acetyl-COA acetyltransferase; NEW SUB-family, thio | 99.61 | |
| 4ddo_A | 451 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci | 99.18 | |
| 3kzu_A | 428 | 3-oxoacyl-(acyl-carrier-protein) synthase II; seat | 99.18 | |
| 2wge_A | 416 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta | 99.18 | |
| 3o04_A | 413 | LMO2201 protein, beta-keto-acyl carrier protein sy | 99.1 | |
| 2gp6_A | 434 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol | 99.04 | |
| 3mqd_A | 428 | Beta-ketoacyl synthase; ssgcid, ALS collaborative | 98.95 | |
| 2hg4_A | 917 | DEBS, 6-deoxyerythronolide B synthase; ketosynthas | 98.82 | |
| 1j3n_A | 408 | 3-oxoacyl-(acyl-carrier protein) synthase II; cond | 98.74 | |
| 2iwz_A | 438 | 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho | 98.73 | |
| 2ix4_A | 431 | 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke | 98.71 | |
| 1e5m_A | 416 | KAS II, beta ketoacyl acyl carrier protein synthas | 98.71 | |
| 1ox0_A | 430 | Beta ketoacyl-acyl carrier protein synthase; trans | 98.7 | |
| 3ho9_A | 427 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, | 98.68 | |
| 1tqy_B | 415 | Actinorhodin polyketide putative beta-ketoacyl SY; | 98.68 | |
| 2gqd_A | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli | 98.66 | |
| 1tqy_A | 424 | Beta-ketoacyl synthase/acyl transferase; alpha-bet | 98.6 | |
| 4ewg_A | 412 | Beta-ketoacyl synthase; ssgcid, structural genomic | 98.59 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 98.57 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 98.49 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 98.41 | |
| 3hhd_A | 965 | Fatty acid synthase; transferase, multienzyme, meg | 98.37 | |
| 2vba_A | 406 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop | 98.32 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 98.31 | |
| 2qo3_A | 915 | Eryaii erythromycin polyketide synthase modules 3; | 98.24 | |
| 2ebd_A | 309 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 96.65 | |
| 1u6e_A | 335 | 3-oxoacyl-[acyl-carrier-protein] synthase III; tra | 96.35 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 96.06 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 95.98 | |
| 1zow_A | 313 | 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB | 95.96 | |
| 3lma_A | 347 | Stage V sporulation protein AD (spovad); NESG, str | 95.82 | |
| 1ub7_A | 322 | 3-oxoacyl-[acyl-carrier protein] synthase; fatty a | 95.46 | |
| 1ted_A | 393 | PKS18; thiolase fold, substrate binding tunnel, tr | 94.78 | |
| 1hnj_A | 317 | Beta-ketoacyl-acyl carrier protein synthase III; F | 94.18 | |
| 1u0m_A | 382 | Putative polyketide synthase; type III polyketide | 93.86 | |
| 2h84_A | 374 | Steely1; thiolase-fold, type III polyketide syntha | 93.58 | |
| 2x3e_A | 331 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, | 93.48 | |
| 4dfe_A | 333 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci | 92.1 | |
| 1mzj_A | 339 | Beta-ketoacylsynthase III; beta-ketosynthase, arom | 91.4 | |
| 1xpm_A | 396 | 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s | 89.7 | |
| 3il3_A | 323 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 85.49 | |
| 3s21_A | 345 | 3-oxoacyl-[ACP] synthase III; non-decarboxylative | 85.21 | |
| 3led_A | 392 | 3-oxoacyl-acyl carrier protein synthase III; struc | 83.47 | |
| 3s3l_A | 357 | CERJ; acyltransferase, FABH homologue, KS III homo | 80.08 |
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-39 Score=334.63 Aligned_cols=231 Identities=49% Similarity=0.733 Sum_probs=204.7
Q ss_pred chhhHHhhhcCeeEEEEeecccCCCCccchh-cccccccCcccccchhhh-cccccccccchHHHHHHHHHHHhCCCHHH
Q psy4157 209 PLARIAIKSGDATAIVAGGQECMSQAPHVIN-IRNGIKLNDAEMKDSMVF-DGLTDAFHNIHMGITAENIAKKWSISRLE 286 (441)
Q Consensus 209 ~~A~~~I~sG~advvla~G~E~ms~~P~~~~-~r~g~~~g~~~~~~d~~~-~g~~~~~~~~~ma~~Ae~~a~~~Gitre~ 286 (441)
.+|+.+|++|.++++|++|+|+|+..|+... .+++..+++ ..+.+.+. .++++++.+..|++.|++||++||+|||+
T Consensus 101 ~~A~~~I~~G~~~~vLv~g~e~~s~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~g~tre~ 179 (396)
T 4dd5_A 101 SMASQLIALGDADIMLVGGAENMSMSPYLVPSARYGARMGD-AAFVDSMIKDGLSDIFNNYHMGITAENIAEQWNITREE 179 (396)
T ss_dssp HHHHHHHHHTSCSEEEEEEEEESTTCCEECTTTTTCCCSSC-CCCEEHHHHHTSEETTTTEEHHHHHHHHHHHHTCCHHH
T ss_pred HHHHHHHhcCCCCEEEEEEEecccCCcccccccccccccCc-ccccchhhhcccccccccchHHHHHHHHHHHhCCCHHH
Confidence 3689999999999999999999999998653 455555554 33334332 26667766778999999999999999999
Q ss_pred HHHHHHHHHHHHHhhhhCCCCCccccceeeecCCCceeEeccCCCCCCCCHHHHhcCCCccccCCccccCCCCCCCCCcE
Q psy4157 287 QDEYAYQSQVKTAKAQEGGYFDEEIVPVVISTRKGDVVVAKDEYPKANTTVEALQKLRPVFQKDGTVTAGNASGINDGAA 366 (441)
Q Consensus 287 ld~~A~~S~~~A~~A~~~g~f~~ei~Pv~v~~~~g~~~~~~D~~~r~~~t~e~l~~~~~v~~p~G~lt~~n~~~~sDGAA 366 (441)
||+||++||+||.+|++.|+|++||+|++++.++|...++.|+++|+++|+|+|.+++|+|+|+|++|++|||+++|||+
T Consensus 180 ~~~~a~~s~~~a~~a~~~g~f~~ei~pv~~~~~~~~~~~~~d~~~r~~~t~e~l~~~~~v~~p~g~~t~~~~~~~~dGaa 259 (396)
T 4dd5_A 180 QDELALASQNKAEKAQAEGKFDEEIVPVVIKGRKGDTVVDKDEYIKPGTTMEKLAKLRPAFKKDGTVTAGNASGINDGAA 259 (396)
T ss_dssp HHHHHHHHHHHHHHHHHTTTTTTTBCCEEEC----CEEECSCSCCCTTCCHHHHHHCCBSSSTTCSCBTTTBCCCEEEEE
T ss_pred HHHHHHHHHHHHHHhHHcCCcccceeeeeeccCCCceeecCcccccCCCCHHHHhhCCCccCCCCCeecCCCCCcCccee
Confidence 99999999999999999999999999999998888888999999999999999999999999999999999999999999
Q ss_pred EEEEcCHHHHHhcCCCceEEEEEEEeecCCCCcCCCChHHHHHHHHHHcCCCCCCccEEEecCCChhhhhhhhc
Q psy4157 367 AVLLMSYKTAQARNIQPLARIVAMSSAGVEPTLMGTGPIPAVNAVLAKAGWSKEEVGYFNRVATSGGIANRRQE 440 (441)
Q Consensus 367 AvVLaSe~~A~~lg~~p~a~I~~~~~~~~~p~~~~~~~~~Aa~~al~~AGl~~~DID~~Ei~D~Ft~~~~~~~~ 440 (441)
+|||++++.|++++.+|+++|++++..+.+|..++.++..+++++|+++||+++|||++|+||+|++....++|
T Consensus 260 avvL~s~~~A~~~g~~~~a~I~g~~~~~~~p~~~~~~~~~a~~~al~~Agl~~~dId~ve~~d~f~~~~~~~~~ 333 (396)
T 4dd5_A 260 MLVVMAKEKAEELGIEPLATIVSYGTAGVDPKIMGYGPVPATKKALEAANMTIEDIDLVEANEAFAAQSVAVIR 333 (396)
T ss_dssp EEEEEEHHHHHHHTCCCSEEEEEEEEEECCGGGGGGTHHHHHHHHHHHHTCCGGGCSEEEECCSBHHHHHHHHH
T ss_pred EEEEeeHHHHHHCCCCceEEEEEEEEecCCCCcccHHHHHHHHHHHHHcCCCHHHcCEEEecChHHHHHHHHHH
Confidence 99999999999999999999999999888888888899999999999999999999999999999998877655
|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A | Back alignment and structure |
|---|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* | Back alignment and structure |
|---|
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* | Back alignment and structure |
|---|
| >4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* | Back alignment and structure |
|---|
| >3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A | Back alignment and structure |
|---|
| >2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* | Back alignment and structure |
|---|
| >3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* | Back alignment and structure |
|---|
| >2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A | Back alignment and structure |
|---|
| >2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A | Back alignment and structure |
|---|
| >1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A | Back alignment and structure |
|---|
| >3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A | Back alignment and structure |
|---|
| >1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A | Back alignment and structure |
|---|
| >2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A | Back alignment and structure |
|---|
| >3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A | Back alignment and structure |
|---|
| >1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A | Back alignment and structure |
|---|
| >1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* | Back alignment and structure |
|---|
| >1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* | Back alignment and structure |
|---|
| >3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A | Back alignment and structure |
|---|
| >3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 441 | ||||
| d1m3ka1 | 268 | c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea | 4e-56 | |
| d1m3ka1 | 268 | c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea | 4e-47 | |
| d1m3ka1 | 268 | c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea | 1e-22 | |
| d1ulqa1 | 273 | c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {T | 1e-40 | |
| d1ulqa1 | 273 | c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {T | 5e-30 | |
| d1ulqa1 | 273 | c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {T | 3e-22 | |
| d1afwa1 | 269 | c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Sacch | 2e-33 | |
| d1afwa1 | 269 | c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Sacch | 2e-27 | |
| d1afwa1 | 269 | c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Sacch | 3e-20 | |
| d1wdkc1 | 262 | c.95.1.1 (C:2-263) Fatty oxidation complex beta su | 4e-30 | |
| d1wdkc1 | 262 | c.95.1.1 (C:2-263) Fatty oxidation complex beta su | 9e-23 | |
| d1wdkc1 | 262 | c.95.1.1 (C:2-263) Fatty oxidation complex beta su | 4e-19 | |
| d1m3ka2 | 124 | c.95.1.1 (A:269-392) Biosynthetic thiolase {Zooglo | 5e-11 | |
| d1afwa2 | 124 | c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Sacc | 2e-10 | |
| d1wdkc2 | 128 | c.95.1.1 (C:264-391) Fatty oxidation complex beta | 4e-09 | |
| d1ulqa2 | 125 | c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase | 7e-09 |
| >d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Length = 268 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiolase-like superfamily: Thiolase-like family: Thiolase-related domain: Biosynthetic thiolase species: Zoogloea ramigera [TaxId: 350]
Score = 184 bits (469), Expect = 4e-56
Identities = 99/199 (49%), Positives = 130/199 (65%), Gaps = 1/199 (0%)
Query: 181 AGNASGINDGAAAVLLMSYKRAQARNIQPLARIAIKSGDATAIVAGGQECMSQAPHVINI 240
A +G+ A A + + R + L I +GDA+ IVAGG E MS APH ++
Sbjct: 70 AAMKAGVPQEATAWGMNQLAGSGLRAV-ALGMQQIATGDASIIVAGGMESMSMAPHCAHL 128
Query: 241 RNGIKLNDAEMKDSMVFDGLTDAFHNIHMGITAENIAKKWSISRLEQDEYAYQSQVKTAK 300
R G+K+ D +M D+M+ DGLTDAF+ HMG TAEN+AK+W +SR EQD +A SQ K
Sbjct: 129 RGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAENVAKQWQLSRDEQDAFAVASQNKAEA 188
Query: 301 AQEGGYFDEEIVPVVISTRKGDVVVAKDEYPKANTTVEALQKLRPVFQKDGTVTAGNASG 360
AQ+ G F +EIVP ++ RKGD+ V DEY + T++++ KLRP F K+GTVTAGNASG
Sbjct: 189 AQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTVTAGNASG 248
Query: 361 INDGAAAVLLMSYKTAQAR 379
+NDGAAA LLMS A R
Sbjct: 249 LNDGAAAALLMSEAEASRR 267
|
| >d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Length = 268 | Back information, alignment and structure |
|---|
| >d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Length = 268 | Back information, alignment and structure |
|---|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Length = 273 | Back information, alignment and structure |
|---|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Length = 273 | Back information, alignment and structure |
|---|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Length = 273 | Back information, alignment and structure |
|---|
| >d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 269 | Back information, alignment and structure |
|---|
| >d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 269 | Back information, alignment and structure |
|---|
| >d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 269 | Back information, alignment and structure |
|---|
| >d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Length = 262 | Back information, alignment and structure |
|---|
| >d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Length = 262 | Back information, alignment and structure |
|---|
| >d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Length = 262 | Back information, alignment and structure |
|---|
| >d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Length = 124 | Back information, alignment and structure |
|---|
| >d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 | Back information, alignment and structure |
|---|
| >d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Length = 128 | Back information, alignment and structure |
|---|
| >d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Length = 125 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 441 | |||
| d1m3ka1 | 268 | Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 | 100.0 | |
| d1ulqa1 | 273 | Beta-ketoadipyl CoA thiolase {Thermus thermophilus | 100.0 | |
| d1m3ka1 | 268 | Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 | 100.0 | |
| d1ulqa1 | 273 | Beta-ketoadipyl CoA thiolase {Thermus thermophilus | 100.0 | |
| d1wdkc1 | 262 | Fatty oxidation complex beta subunit (3-ketoacyl-C | 99.97 | |
| d1wdkc1 | 262 | Fatty oxidation complex beta subunit (3-ketoacyl-C | 99.97 | |
| d1afwa1 | 269 | Thiolase {Baker's yeast (Saccharomyces cerevisiae) | 99.97 | |
| d1afwa1 | 269 | Thiolase {Baker's yeast (Saccharomyces cerevisiae) | 99.96 | |
| d1afwa2 | 124 | Thiolase {Baker's yeast (Saccharomyces cerevisiae) | 99.33 | |
| d1m3ka2 | 124 | Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 | 99.26 | |
| d1wdkc2 | 128 | Fatty oxidation complex beta subunit (3-ketoacyl-C | 99.24 | |
| d1ulqa2 | 125 | Beta-ketoadipyl CoA thiolase {Thermus thermophilus | 99.21 | |
| d1tqyb2 | 194 | Actinorhodin polyketide putative beta-ketoacyl syn | 97.75 | |
| d1tqya2 | 205 | Actinorhodin polyketide putative beta-ketoacyl syn | 97.73 | |
| d1ox0a2 | 158 | Beta-ketoacyl-ACP synthase II {Streptococcus pneum | 95.02 | |
| d1e5ma2 | 161 | Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ | 94.47 | |
| d1j3na2 | 159 | Beta-ketoacyl-ACP synthase II {Thermus thermophilu | 94.43 | |
| d2ix4a2 | 161 | Beta-ketoacyl-ACP synthase II {Thale cress (Arabid | 93.7 | |
| d2gfva2 | 161 | Beta-ketoacyl-ACP synthase II {Escherichia coli [T | 93.47 | |
| d1afwa2 | 124 | Thiolase {Baker's yeast (Saccharomyces cerevisiae) | 90.82 | |
| d1teda_ | 372 | Polyketide synthase PKS18 {Mycobacterium tuberculo | 81.66 | |
| d1wdkc2 | 128 | Fatty oxidation complex beta subunit (3-ketoacyl-C | 81.52 |
| >d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiolase-like superfamily: Thiolase-like family: Thiolase-related domain: Biosynthetic thiolase species: Zoogloea ramigera [TaxId: 350]
Probab=100.00 E-value=1.3e-37 Score=301.35 Aligned_cols=141 Identities=55% Similarity=0.878 Sum_probs=136.5
Q ss_pred CCCCCcccccccCcCCCccccccccccCCcccccCCCchHhhHHHHHHHhCCCHHHHhHHHHhcHHHHHHHHhCCCCCcc
Q psy4157 1 MSQAPHVINIRNGIKLNDAEMKDSMVFDGLTDAFHNIHMGITAENIAKKWSISRLEQDEYAYQSQVKTAKAQEGGYFDEE 80 (441)
Q Consensus 1 mS~~P~~~~~r~g~~~g~~~~~d~~~~~~l~d~~~~~~mg~~ae~~a~~~~isRe~~D~~a~~s~~ra~~a~~~g~~~~e 80 (441)
|||.||....|.+.+.++....|.++.++|+|++.+.+||++||++|++||||||+||+||++||+||.+|+++|+|++|
T Consensus 119 mS~~p~~~~~~~~~~~~~~~~~~~~~~~~l~d~~~~~~Mg~~Ae~~A~~~gisRe~~D~~A~~S~~ra~~A~~~g~f~~e 198 (268)
T d1m3ka1 119 MSMAPHCAHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDE 198 (268)
T ss_dssp STTCCEEECCSSCCSSSCEEEEEHHHHHHTBCTTTCSBHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHTTTTTT
T ss_pred cccCchhhhcccCCcCCCcccccccccccCcCcccCCcHHHHHHHHHHHHCcCHHHHHHHHHHHHHHhhhHHHcCCchhh
Confidence 89999988888999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeeeEeccCCCceeeeccCCCCCCccHHHhhhcCcccccCCceecCCCCCCCCccccchhh
Q psy4157 81 IVPVVISTRKGDVVVAKDEYPKANTSVDALQKLRPVFQKDGTVTAGNASGINDGAAAGKLY 141 (441)
Q Consensus 81 i~p~~~~~~~g~~~~~~de~~~~~~~~~~l~~l~p~f~~~g~~t~~~~~~~~dg~~~~~~~ 141 (441)
|+|+.++.++|..++++||++|+++++|+|++|||+|.++|+|||||||+++|||||++|.
T Consensus 199 i~p~~~~~~~g~~~v~~d~~~r~~tt~e~L~~L~p~f~~~GtvTagnss~~~DGAAa~ll~ 259 (268)
T d1m3ka1 199 IVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTVTAGNASGLNDGAAAALLM 259 (268)
T ss_dssp BCCEEECCTTCCEEECSCSSCCTTCCHHHHHTCCBSSCTTCCCBSSSBCCCEEEEEEEEEE
T ss_pred ccccccCCCCCCeEEeCCCCCCCCCCHHHHcCCCCCcCCCCcEEChhhChHHHHHHHHHHh
Confidence 9999999989988999999999999999999999999999999999999999999998665
|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} | Back information, alignment and structure |
|---|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} | Back information, alignment and structure |
|---|
| >d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|