Psyllid ID: psy430

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MSEVTTSLIEYSGSHPARAKFTKHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
cccccHHHHHHHHHccccHHHHccccccEEEcccccccccHHHHHHHHHHHcccccccEEEEccccccccccccHHHcccccHHHHHHccHHHHHHccccccccccc
ccccccHHHHHHHHHHcccHHHHHHHHcEEEEcHHHccccHHHHHHHHHHHHccccccccEEcccccccHHHHHHHHHHHcHHHHHccEEHHHHHHHcHHHHHHHcc
MSEVTTSLIEysgshparakftkhfphdvvlsggttmypgIADRMQKEITAlapstmkikiiapperkysvWIGGSILASLSTFQQMWISKqeydesgpsivhrkcf
MSEVTTSLIEYSgshparakftkhfphdvvlsGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKqeydesgpsivhrkcf
MSEVTTSLIEYSGSHPARAKFTKHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
*******************KFTKHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK****************
**EVTTSLIEYSGSHPARAKFTKHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
********IEYSGSHPARAKFTKHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE**************
***VTTSLIEYSGSHPARAKFTKHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEVTTSLIEYSGSHPARAKFTKHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
Q25010376 Actin, cytoplasmic A3a OS N/A N/A 0.794 0.226 0.929 4e-41
P10984376 Actin-2 OS=Caenorhabditis no N/A 0.794 0.226 0.929 4e-41
P29751375 Actin, cytoplasmic 1 OS=O yes N/A 0.794 0.226 0.929 5e-41
P53505376 Actin, cytoplasmic type 5 N/A N/A 0.794 0.226 0.929 5e-41
P53478376 Actin, cytoplasmic type 5 yes N/A 0.794 0.226 0.929 5e-41
P84336375 Actin, cytoplasmic 1 OS=C N/A N/A 0.794 0.226 0.929 5e-41
P10986376 Actin-4 OS=Caenorhabditis no N/A 0.794 0.226 0.929 5e-41
P10983376 Actin-1/3 OS=Caenorhabdit no N/A 0.794 0.226 0.929 5e-41
P41340376 Actin-3 OS=Limulus polyph N/A N/A 0.794 0.226 0.929 5e-41
O93400375 Actin, cytoplasmic 1 OS=X N/A N/A 0.794 0.226 0.929 5e-41
>sp|Q25010|ACT3A_HELAM Actin, cytoplasmic A3a OS=Helicoverpa armigera GN=actA3a PE=2 SV=1 Back     alignment and function desciption
 Score =  166 bits (420), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 79/85 (92%), Positives = 80/85 (94%)

Query: 23  KHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 82
           K    + VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS
Sbjct: 292 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 351

Query: 83  TFQQMWISKQEYDESGPSIVHRKCF 107
           TFQQMWISKQEYDESGPSIVHRKCF
Sbjct: 352 TFQQMWISKQEYDESGPSIVHRKCF 376
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Multiple isoforms are involved in various cellular functions such as cytoskeleton structure, cell mobility, chromosome movement and muscle contraction.
Helicoverpa armigera (taxid: 29058)
>sp|P10984|ACT2_CAEEL Actin-2 OS=Caenorhabditis elegans GN=act-2 PE=3 SV=3 Back     alignment and function description
>sp|P29751|ACTB_RABIT Actin, cytoplasmic 1 OS=Oryctolagus cuniculus GN=ACTB PE=2 SV=1 Back     alignment and function description
>sp|P53505|ACT5_XENLA Actin, cytoplasmic type 5 OS=Xenopus laevis PE=3 SV=1 Back     alignment and function description
>sp|P53478|ACT5_CHICK Actin, cytoplasmic type 5 OS=Gallus gallus PE=2 SV=1 Back     alignment and function description
>sp|P84336|ACTB_CAMDR Actin, cytoplasmic 1 OS=Camelus dromedarius GN=ACTB PE=1 SV=1 Back     alignment and function description
>sp|P10986|ACT4_CAEEL Actin-4 OS=Caenorhabditis elegans GN=act-4 PE=2 SV=2 Back     alignment and function description
>sp|P10983|ACT1_CAEEL Actin-1/3 OS=Caenorhabditis elegans GN=act-1 PE=1 SV=2 Back     alignment and function description
>sp|P41340|ACT3_LIMPO Actin-3 OS=Limulus polyphemus PE=1 SV=1 Back     alignment and function description
>sp|O93400|ACTB_XENLA Actin, cytoplasmic 1 OS=Xenopus laevis GN=actb PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
312087163186 actin 2 [Loa loa] 0.794 0.456 0.917 5e-40
167683058 263 actin [Plectreurys tristis] 0.906 0.368 0.824 7e-40
40226101 263 ACTG1 protein, partial [Homo sapiens] gi 0.794 0.323 0.929 8e-40
338227729175 beta-actin [Onthophagus binodis] gi|3382 0.906 0.554 0.824 9e-40
167683046198 actin [Euagrus chisoseus] 0.794 0.429 0.929 9e-40
390134715 376 beta-actin [Tachypleus tridentatus] 0.794 0.226 0.929 9e-40
167683050 248 actin [Hypochilus thorelli] 0.906 0.391 0.824 9e-40
344250136 244 Actin, cytoplasmic 2 [Cricetulus griseus 0.794 0.348 0.929 9e-40
341899417186 hypothetical protein CAEBREN_00853 [Caen 0.794 0.456 0.929 1e-39
167683054 247 actin [Hypochilus thorelli] gi|385881384 0.906 0.392 0.824 1e-39
>gi|312087163|ref|XP_003145362.1| actin 2 [Loa loa] Back     alignment and taxonomy information
 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 78/85 (91%), Positives = 81/85 (95%)

Query: 23  KHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 82
           K    ++VLSGGTTMYPGIADRMQKE+TALAPSTMKIKIIAPPERKYSVWIGGSILASLS
Sbjct: 102 KDLYANIVLSGGTTMYPGIADRMQKEVTALAPSTMKIKIIAPPERKYSVWIGGSILASLS 161

Query: 83  TFQQMWISKQEYDESGPSIVHRKCF 107
           TFQQMWISKQEYDESGPSIVHRKCF
Sbjct: 162 TFQQMWISKQEYDESGPSIVHRKCF 186

Source: Loa loa

Species: Loa loa

Genus: Loa

Family: Onchocercidae

Order: Spirurida

Class: Chromadorea

Phylum: Nematoda

Superkingdom: Eukaryota
>gi|167683058|gb|ABZ91671.1| actin [Plectreurys tristis] Back     alignment and taxonomy information
>gi|40226101|gb|AAH23548.1| ACTG1 protein, partial [Homo sapiens] gi|112980807|gb|ABI29185.1| beta-actin [Sus scrofa] Back     alignment and taxonomy information
>gi|338227729|gb|AEI91060.1| beta-actin [Onthophagus binodis] gi|338227731|gb|AEI91061.1| beta-actin [Onthophagus sagittarius] Back     alignment and taxonomy information
>gi|167683046|gb|ABZ91665.1| actin [Euagrus chisoseus] Back     alignment and taxonomy information
>gi|390134715|gb|AFL56351.1| beta-actin [Tachypleus tridentatus] Back     alignment and taxonomy information
>gi|167683050|gb|ABZ91667.1| actin [Hypochilus thorelli] Back     alignment and taxonomy information
>gi|344250136|gb|EGW06240.1| Actin, cytoplasmic 2 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|341899417|gb|EGT55352.1| hypothetical protein CAEBREN_00853 [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|167683054|gb|ABZ91669.1| actin [Hypochilus thorelli] gi|385881384|gb|AFI98413.1| actin, partial [Antricola delacruzi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
FB|FBgn0000042376 Act5C "Actin 5C" [Drosophila m 0.747 0.212 0.975 7e-38
UNIPROTKB|G1K2Y7374 LOC776816 "Uncharacterized pro 0.747 0.213 0.975 7e-38
UNIPROTKB|P53478376 P53478 "Actin, cytoplasmic typ 0.747 0.212 0.975 7e-38
UNIPROTKB|P60706375 ACTB "Actin, cytoplasmic 1" [G 0.747 0.213 0.975 7e-38
UNIPROTKB|Q5ZMQ2375 ACTG1 "Actin, cytoplasmic 2" [ 0.747 0.213 0.975 7e-38
UNIPROTKB|P60712375 ACTB "Actin, cytoplasmic 1" [B 0.747 0.213 0.975 7e-38
UNIPROTKB|P63258375 ACTG1 "Actin, cytoplasmic 2" [ 0.747 0.213 0.975 7e-38
UNIPROTKB|F1PQL8373 ACTG1 "Uncharacterized protein 0.747 0.214 0.975 7e-38
UNIPROTKB|J9NWY1364 J9NWY1 "Uncharacterized protei 0.747 0.219 0.975 7e-38
UNIPROTKB|J9NXE2373 ACTB "Actin, cytoplasmic 1" [C 0.747 0.214 0.975 7e-38
FB|FBgn0000042 Act5C "Actin 5C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 406 (148.0 bits), Expect = 7.0e-38, P = 7.0e-38
 Identities = 78/80 (97%), Positives = 79/80 (98%)

Query:    28 DVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 87
             + VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct:   297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query:    88 WISKQEYDESGPSIVHRKCF 107
             WISKQEYDESGPSIVHRKCF
Sbjct:   357 WISKQEYDESGPSIVHRKCF 376
GO:0005200 "structural constituent of cytoskeleton" evidence=ISS
GO:0005884 "actin filament" evidence=ISS;NAS
GO:0007010 "cytoskeleton organization" evidence=ISS
GO:0007291 "sperm individualization" evidence=IEP
GO:0005524 "ATP binding" evidence=IEA
GO:0000910 "cytokinesis" evidence=IMP
GO:0031011 "Ino80 complex" evidence=IDA
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0032507 "maintenance of protein location in cell" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0016319 "mushroom body development" evidence=IMP
GO:0002121 "inter-male aggressive behavior" evidence=IMP
UNIPROTKB|G1K2Y7 LOC776816 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P53478 P53478 "Actin, cytoplasmic type 5" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P60706 ACTB "Actin, cytoplasmic 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMQ2 ACTG1 "Actin, cytoplasmic 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P60712 ACTB "Actin, cytoplasmic 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P63258 ACTG1 "Actin, cytoplasmic 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQL8 ACTG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWY1 J9NWY1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXE2 ACTB "Actin, cytoplasmic 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P84183ACT4_BOMMONo assigned EC number0.92940.79430.2260N/AN/A
A2BDB0ACTG_XENLANo assigned EC number0.92940.79430.2266N/AN/A
Q6NVA9ACTB_XENTRNo assigned EC number0.92940.79430.2266yesN/A
P84185ACT5C_ANOGANo assigned EC number0.92940.79430.2260yesN/A
O93400ACTB_XENLANo assigned EC number0.92940.79430.2266N/AN/A
Q5R1X3ACTB_PANTRNo assigned EC number0.92940.79430.2266yesN/A
Q8JJB8ACTG_TRISCNo assigned EC number0.92940.79430.2266N/AN/A
P53486ACTB3_TAKRUNo assigned EC number0.92940.79430.2266N/AN/A
Q5R6G0ACTB_PONABNo assigned EC number0.92940.79430.2266yesN/A
P41340ACT3_LIMPONo assigned EC number0.92940.79430.2260N/AN/A
P63256ACTG_ANSANNo assigned EC number0.92940.79430.2266N/AN/A
P63257ACTG_TRIVUNo assigned EC number0.92940.79430.2266N/AN/A
P79818ACTB_ORYLANo assigned EC number0.92940.79430.2266N/AN/A
P53506ACT8_XENLANo assigned EC number0.92940.79430.2260N/AN/A
P53505ACT5_XENLANo assigned EC number0.92940.79430.2260N/AN/A
P84184ACT3B_HELAMNo assigned EC number0.92940.79430.2260N/AN/A
P63258ACTG_BOVINNo assigned EC number0.92940.79430.2266yesN/A
P63259ACTG_RATNo assigned EC number0.92940.79430.2266yesN/A
P84856ACTB_CERPYNo assigned EC number0.92940.79430.2354N/AN/A
P60709ACTB_HUMANNo assigned EC number0.92940.79430.2266yesN/A
P60708ACTB_HORSENo assigned EC number0.92940.79430.2266yesN/A
P60707ACTB_TRIVUNo assigned EC number0.92940.79430.2266N/AN/A
P60706ACTB_CHICKNo assigned EC number0.92940.79430.2266yesN/A
Q5ZMQ2ACTG_CHICKNo assigned EC number0.92940.79430.2266yesN/A
Q5JAK2ACTG_RANLENo assigned EC number0.92940.79430.2266N/AN/A
O18840ACTB_CANFANo assigned EC number0.92940.79430.2266yesN/A
Q6P378ACTG_XENTRNo assigned EC number0.92940.79430.2266yesN/A
Q4L0Y2ACTB_SPECINo assigned EC number0.92940.79430.2266N/AN/A
P10986ACT4_CAEELNo assigned EC number0.92940.79430.2260noN/A
Q25010ACT3A_HELAMNo assigned EC number0.92940.79430.2260N/AN/A
P10987ACT1_DROMENo assigned EC number0.92940.79430.2260yesN/A
P53478ACT5_CHICKNo assigned EC number0.92940.79430.2260yesN/A
P60712ACTB_BOVINNo assigned EC number0.92940.79430.2266yesN/A
Q711N9ACTB_MESAUNo assigned EC number0.92940.79430.2266N/AN/A
Q76N69ACTB_CHLAENo assigned EC number0.92940.79430.2266N/AN/A
P60710ACTB_MOUSENo assigned EC number0.92940.79430.2266yesN/A
P60711ACTB_RATNo assigned EC number0.92940.79430.2266yesN/A
P84336ACTB_CAMDRNo assigned EC number0.92940.79430.2266N/AN/A
P60713ACTB_SHEEPNo assigned EC number0.92940.79430.2266N/AN/A
Q4R561ACTB_MACFANo assigned EC number0.92940.79430.2266N/AN/A
P29751ACTB_RABITNo assigned EC number0.92940.79430.2266yesN/A
Q6QAQ1ACTB_PIGNo assigned EC number0.92940.79430.2266yesN/A
P63261ACTG_HUMANNo assigned EC number0.92940.79430.2266yesN/A
P63260ACTG_MOUSENo assigned EC number0.92940.79430.2266yesN/A
P10984ACT2_CAEELNo assigned EC number0.92940.79430.2260noN/A
Q71FK5ACTB_CAVPONo assigned EC number0.92940.79430.2266yesN/A
P10983ACT1_CAEELNo assigned EC number0.92940.79430.2260noN/A
P68143ACTB_OREMONo assigned EC number0.92940.79430.2266N/AN/A
P68142ACTB1_TAKRUNo assigned EC number0.92940.79430.2266N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
pfam00022367 pfam00022, Actin, Actin 1e-51
PTZ00281376 PTZ00281, PTZ00281, actin; Provisional 1e-50
PTZ00004378 PTZ00004, PTZ00004, actin-2; Provisional 3e-47
smart00268373 smart00268, ACTIN, Actin 7e-46
COG5277444 COG5277, COG5277, Actin and related proteins [Cyto 4e-37
PTZ00452375 PTZ00452, PTZ00452, actin; Provisional 1e-34
PTZ00466380 PTZ00466, PTZ00466, actin-like protein; Provisiona 1e-34
PTZ00280414 PTZ00280, PTZ00280, Actin-related protein 3; Provi 7e-20
>gnl|CDD|200935 pfam00022, Actin, Actin Back     alignment and domain information 
 Score =  165 bits (421), Expect = 1e-51
 Identities = 55/80 (68%), Positives = 69/80 (86%), Gaps = 1/80 (1%)

Query: 29  VVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP-ERKYSVWIGGSILASLSTFQQM 87
           +V++GGTT++PG  +R++KE+  LAPS +K+KIIAPP ERKYS WIGGSILASL TFQQM
Sbjct: 288 IVVTGGTTLFPGFTERLEKELAQLAPSGVKVKIIAPPNERKYSAWIGGSILASLGTFQQM 347

Query: 88  WISKQEYDESGPSIVHRKCF 107
           W+SKQEY+E G S+V RKCF
Sbjct: 348 WVSKQEYEEHGSSVVERKCF 367

Length = 367
>gnl|CDD|173506 PTZ00281, PTZ00281, actin; Provisional Back     alignment and domain information
>gnl|CDD|240225 PTZ00004, PTZ00004, actin-2; Provisional Back     alignment and domain information
>gnl|CDD|214592 smart00268, ACTIN, Actin Back     alignment and domain information
>gnl|CDD|227602 COG5277, COG5277, Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|185631 PTZ00452, PTZ00452, actin; Provisional Back     alignment and domain information
>gnl|CDD|240426 PTZ00466, PTZ00466, actin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240343 PTZ00280, PTZ00280, Actin-related protein 3; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
PTZ00452375 actin; Provisional 99.97
PTZ00466380 actin-like protein; Provisional 99.97
PTZ00281376 actin; Provisional 99.97
PTZ00004378 actin-2; Provisional 99.97
KOG0676|consensus372 99.97
PF00022393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 99.97
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 99.96
PTZ00280414 Actin-related protein 3; Provisional 99.96
KOG0679|consensus426 99.95
COG5277444 Actin and related proteins [Cytoskeleton] 99.95
KOG0680|consensus400 99.94
cd00012371 ACTIN Actin; An ubiquitous protein involved in the 99.93
KOG0681|consensus645 99.81
KOG0677|consensus389 99.74
KOG0678|consensus415 99.73
KOG0797|consensus618 99.49
PRK13929335 rod-share determining protein MreBH; Provisional 98.7
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 98.66
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 98.64
PRK13930335 rod shape-determining protein MreB; Provisional 98.62
PRK13927334 rod shape-determining protein MreB; Provisional 98.56
PRK13928336 rod shape-determining protein Mbl; Provisional 98.4
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 97.61
PRK15080267 ethanolamine utilization protein EutJ; Provisional 97.59
COG1077342 MreB Actin-like ATPase involved in cell morphogene 97.55
CHL00094 621 dnaK heat shock protein 70 96.54
TIGR02350 595 prok_dnaK chaperone protein DnaK. Members of this 96.34
PRK09472420 ftsA cell division protein FtsA; Reviewed 96.32
PRK00290 627 dnaK molecular chaperone DnaK; Provisional 96.28
PRK01433 595 hscA chaperone protein HscA; Provisional 95.98
TIGR01991 599 HscA Fe-S protein assembly chaperone HscA. The Hea 95.94
PTZ00400 663 DnaK-type molecular chaperone; Provisional 95.91
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 95.68
PRK05183 616 hscA chaperone protein HscA; Provisional 95.67
TIGR02261262 benz_CoA_red_D benzoyl-CoA reductase, bcr type, su 95.64
TIGR02259432 benz_CoA_red_A benzoyl-CoA reductase, bcr type, su 95.54
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 95.5
TIGR03286404 methan_mark_15 putative methanogenesis marker prot 95.42
PRK13410 668 molecular chaperone DnaK; Provisional 95.21
PLN03184 673 chloroplast Hsp70; Provisional 95.07
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 94.96
TIGR00241248 CoA_E_activ CoA-substrate-specific enzyme activase 94.54
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HS 94.5
PRK13411 653 molecular chaperone DnaK; Provisional 94.42
PRK11678450 putative chaperone; Provisional 94.38
PTZ00009 653 heat shock 70 kDa protein; Provisional 93.99
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 93.85
PF00012 602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 93.75
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 92.64
PRK13317277 pantothenate kinase; Provisional 92.46
COG0849418 ftsA Cell division ATPase FtsA [Cell division and 91.55
COG4820277 EutJ Ethanolamine utilization protein, possible ch 88.39
PF01869271 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In 86.77
PRK13917344 plasmid segregation protein ParM; Provisional 83.61
>PTZ00452 actin; Provisional Back     alignment and domain information 
Probab=99.97  E-value=8e-33  Score=212.12  Aligned_cols=96  Identities=54%  Similarity=1.015  Sum_probs=92.6

Q ss_pred             hcCCCCChhhhhccccCeEEecCCCCCcChHHHHHHHHHhhCCCCceeEEeCCCCCccceeehhhhhccccccccccccH
Q psy430           12 SGSHPARAKFTKHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK   91 (107)
Q Consensus        12 ~~i~~~~~d~r~~l~~nIvltGG~s~~~G~~~Rl~~eL~~~~p~~~~v~v~~~~~~~~~~W~Ggsi~a~l~~~~~~~Itr   91 (107)
                      .+|.+||+|+|+.|++||+|+||+|++|||.+||++||+.++|+..+++|..++++.+++|+|||++|+++.|+++||||
T Consensus       280 ~si~~c~~d~r~~L~~nIvL~GG~Sl~~Gf~~RL~~El~~~~p~~~~v~v~~~~~r~~~aW~GgSilasl~~f~~~~vtk  359 (375)
T PTZ00452        280 SSIKKCDLDLRQELCRNIVLSGGTTLFPGIANRLSNELTNLVPSQLKIQVAAPPDRRFSAWIGGSIQCTLSTQQPQWIKR  359 (375)
T ss_pred             HHHHhCCHhHHHHhhccEEEecccccccCHHHHHHHHHHHhCCCCceeEEecCCCcceeEEECchhhcCccchhhhEeEH
Confidence            45778999999999999999999999999999999999999999889999999999999999999999999999999999


Q ss_pred             HHHhhcCchhhhhhcC
Q psy430           92 QEYDESGPSIVHRKCF  107 (107)
Q Consensus        92 ~eY~e~G~~~~~~k~~  107 (107)
                      +||+|+|+++++||||
T Consensus       360 ~eYeE~G~~i~~~k~~  375 (375)
T PTZ00452        360 QEYDEQGPSIVHRKCF  375 (375)
T ss_pred             HHHhccCcceeeeecC
Confidence            9999999999999997

>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>KOG0676|consensus Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>KOG0680|consensus Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>KOG0681|consensus Back     alignment and domain information
>KOG0677|consensus Back     alignment and domain information
>KOG0678|consensus Back     alignment and domain information
>KOG0797|consensus Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D Back     alignment and domain information
>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
3eks_A375 Crystal Structure Of Monomeric Actin Bound To Cytoc 3e-42
2hf3_A374 Crystal Structure Of Monomeric Actin In The Adp Bou 3e-42
2btf_A375 The Structure Of Crystalline Profilin-Beta-Actin Le 4e-42
2oan_A375 Structure Of Oxidized Beta-Actin Length = 375 4e-42
1d4x_A375 Crystal Structure Of Caenorhabditis Elegans Mg-Atp 4e-42
3u4l_A375 Cryocooled Bovine Profilin:actin Crystal Structure 4e-42
3byh_A374 Model Of Actin-Fimbrin Abd2 Complex Length = 374 4e-42
3w3d_A374 Crystal Structure Of Smooth Muscle G Actin Dnase I 1e-41
4efh_A375 Acanthamoeba Actin Complex With Spir Domain D Lengt 2e-41
3a5l_C375 Crystal Structure Of A Dictyostelium P109a Mg2+-Act 3e-41
3a5m_C375 Crystal Structure Of A Dictyostelium P109i Mg2+-Act 4e-41
3g37_O376 Cryo-Em Structure Of Actin Filament In The Presence 4e-41
1qz5_A375 Structure Of Rabbit Actin In Complex With Kabiramid 4e-41
3ci5_A375 Complex Of Phosphorylated Dictyostelium Discoideum 4e-41
3mn5_A359 Structures Of Actin-Bound Wh2 Domains Of Spire And 4e-41
1eqy_A377 Complex Between Rabbit Muscle Alpha-Actin: Human Ge 4e-41
3chw_A375 Complex Of Dictyostelium Discoideum Actin With Prof 4e-41
1kxp_A375 Crystal Structure Of Human Vitamin D-binding Protei 4e-41
4b1v_A376 Structure Of The Phactr1 Rpel-N Domain Bound To G-A 4e-41
2gwj_A371 Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form 4e-41
1nlv_A375 Crystal Structure Of Dictyostelium Discoideum Actin 4e-41
1ijj_A377 The X-Ray Crystal Structure Of The Complex Between 5e-41
1c0f_A368 Crystal Structure Of Dictyostelium Caatp-Actin In C 5e-41
1t44_A370 Structural Basis Of Actin Sequestration By Thymosin 5e-41
1lcu_A371 Polylysine Induces An Antiparallel Actin Dimer That 5e-41
1c0g_A375 Crystal Structure Of 1:1 Complex Between Gelsolin S 8e-41
1dej_A375 Crystal Structure Of A DictyosteliumTETRAHYMENA CHI 9e-41
1yag_A375 Structure Of The Yeast Actin-human Gelsolin Segment 1e-39
1yvn_A375 The Yeast Actin Val 159 Asn Mutant Complex With Hum 1e-39
1atn_A373 Atomic Structure Of The Actin:dnase I Complex Lengt 1e-38
2w49_D372 Isometrically Contracting Insect Asynchronous Fligh 2e-38
3b63_L365 Actin Filament Model In The Extended Form Of Acroms 6e-38
3m6g_A371 Crystal Structure Of Actin In Complex With Lobophor 8e-38
3b63_B364 Actin Filament Model In The Extended Form Of Acroms 6e-37
3b63_E365 Actin Filament Model In The Extended Form Of Acroms 7e-37
3b63_A365 Actin Filament Model In The Extended Form Of Acroms 3e-36
3b63_C365 Actin Filament Model In The Extended Form Of Acroms 4e-36
3b63_D357 Actin Filament Model In The Extended Form Of Acroms 7e-34
3b63_F357 Actin Filament Model In The Extended Form Of Acroms 2e-32
3qb0_A498 Crystal Structure Of Actin-Related Protein Arp4 Fro 7e-16
1k8k_B394 Crystal Structure Of Arp23 COMPLEX Length = 394 1e-13
2p9k_B394 Crystal Structure Of Bovine Arp23 COMPLEX CO-Crysta 1e-13
1k8k_A418 Crystal Structure Of Arp23 COMPLEX Length = 418 5e-10
3dwl_A427 Crystal Structure Of Fission Yeast Arp2/3 Complex L 2e-07
4fo0_A593 Human Actin-Related Protein Arp8 In Its Atp-Bound S 9e-04
>pdb|3EKS|A Chain A, Crystal Structure Of Monomeric Actin Bound To Cytochalasin D Length = 375 Back     alignment and structure 
Iteration: 1

 Score =  166 bits (420), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 82/97 (84%)
Query: 11  YSGSHPARAKFTKHFPHDVVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYS 70
           Y+          K    + VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYS
Sbjct: 279 YNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYS 338
Query: 71  VWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 107
           VWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
Sbjct: 339 VWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
>pdb|2HF3|A Chain A, Crystal Structure Of Monomeric Actin In The Adp Bound State Length = 374 Back     alignment and structure
>pdb|2BTF|A Chain A, The Structure Of Crystalline Profilin-Beta-Actin Length = 375 Back     alignment and structure
>pdb|2OAN|A Chain A, Structure Of Oxidized Beta-Actin Length = 375 Back     alignment and structure
>pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 375 Back     alignment and structure
>pdb|3U4L|A Chain A, Cryocooled Bovine Profilin:actin Crystal Structure To 2.4 A Length = 375 Back     alignment and structure
>pdb|3BYH|A Chain A, Model Of Actin-Fimbrin Abd2 Complex Length = 374 Back     alignment and structure
>pdb|3W3D|A Chain A, Crystal Structure Of Smooth Muscle G Actin Dnase I Complex Length = 374 Back     alignment and structure
>pdb|4EFH|A Chain A, Acanthamoeba Actin Complex With Spir Domain D Length = 375 Back     alignment and structure
>pdb|3A5L|C Chain C, Crystal Structure Of A Dictyostelium P109a Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3A5M|C Chain C, Crystal Structure Of A Dictyostelium P109i Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3G37|O Chain O, Cryo-Em Structure Of Actin Filament In The Presence Of Phosphate Length = 376 Back     alignment and structure
>pdb|1QZ5|A Chain A, Structure Of Rabbit Actin In Complex With Kabiramide C Length = 375 Back     alignment and structure
>pdb|3CI5|A Chain A, Complex Of Phosphorylated Dictyostelium Discoideum Actin With Gelsolin Length = 375 Back     alignment and structure
>pdb|3MN5|A Chain A, Structures Of Actin-Bound Wh2 Domains Of Spire And The Implication For Filament Nucleation Length = 359 Back     alignment and structure
>pdb|1EQY|A Chain A, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Domain 1 Length = 377 Back     alignment and structure
>pdb|3CHW|A Chain A, Complex Of Dictyostelium Discoideum Actin With Profilin And The Last Poly-Pro Of Human Vasp Length = 375 Back     alignment and structure
>pdb|1KXP|A Chain A, Crystal Structure Of Human Vitamin D-binding Protein In Complex With Skeletal Actin Length = 375 Back     alignment and structure
>pdb|4B1V|A Chain A, Structure Of The Phactr1 Rpel-N Domain Bound To G-Actin Length = 376 Back     alignment and structure
>pdb|2GWJ|A Chain A, Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form Length = 371 Back     alignment and structure
>pdb|1NLV|A Chain A, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca Atp And Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1IJJ|A Chain A, The X-Ray Crystal Structure Of The Complex Between Rabbit Skeletal Muscle Actin And Latrunculin A At 2.85 A Resolution Length = 377 Back     alignment and structure
>pdb|1C0F|A Chain A, Crystal Structure Of Dictyostelium Caatp-Actin In Complex With Gelsolin Segment 1 Length = 368 Back     alignment and structure
>pdb|1T44|A Chain A, Structural Basis Of Actin Sequestration By Thymosin-B4: Implications For Arp23 ACTIVATION Length = 370 Back     alignment and structure
>pdb|1LCU|A Chain A, Polylysine Induces An Antiparallel Actin Dimer That Nucleates Filament Assembly: Crystal Structure At 3.5 A Resolution Length = 371 Back     alignment and structure
>pdb|1C0G|A Chain A, Crystal Structure Of 1:1 Complex Between Gelsolin Segment 1 And A DictyosteliumTETRAHYMENA CHIMERA ACTIN (MUTANT 228: Q228kT229AA230YE360H) Length = 375 Back     alignment and structure
>pdb|1DEJ|A Chain A, Crystal Structure Of A DictyosteliumTETRAHYMENA CHIMERA Actin (Mutant 646: Q228kT229AA230YA231KS232EE360H) IN Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1YAG|A Chain A, Structure Of The Yeast Actin-human Gelsolin Segment 1 Complex Length = 375 Back     alignment and structure
>pdb|1YVN|A Chain A, The Yeast Actin Val 159 Asn Mutant Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1ATN|A Chain A, Atomic Structure Of The Actin:dnase I Complex Length = 373 Back     alignment and structure
>pdb|2W49|D Chain D, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 372 Back     alignment and structure
>pdb|3B63|L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3M6G|A Chain A, Crystal Structure Of Actin In Complex With Lobophorolide Length = 371 Back     alignment and structure
>pdb|3B63|B Chain B, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 364 Back     alignment and structure
>pdb|3B63|E Chain E, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3B63|A Chain A, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3B63|C Chain C, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3B63|D Chain D, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|3B63|F Chain F, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|3QB0|A Chain A, Crystal Structure Of Actin-Related Protein Arp4 From S. Cerevisiae Complexed With Atp Length = 498 Back     alignment and structure
>pdb|1K8K|B Chain B, Crystal Structure Of Arp23 COMPLEX Length = 394 Back     alignment and structure
>pdb|2P9K|B Chain B, Crystal Structure Of Bovine Arp23 COMPLEX CO-Crystallized With Atp And Crosslinked With Glutaraldehyde Length = 394 Back     alignment and structure
>pdb|1K8K|A Chain A, Crystal Structure Of Arp23 COMPLEX Length = 418 Back     alignment and structure
>pdb|3DWL|A Chain A, Crystal Structure Of Fission Yeast Arp2/3 Complex Lacking The Arp2 Subunit Length = 427 Back     alignment and structure
>pdb|4FO0|A Chain A, Human Actin-Related Protein Arp8 In Its Atp-Bound State Length = 593 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 5e-62
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 1e-52
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 2e-51
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 6e-51
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 1e-50
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 Back     alignment and structure
 Score =  192 bits (489), Expect = 5e-62
 Identities = 75/79 (94%), Positives = 78/79 (98%)

Query: 29  VVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW 88
            V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW
Sbjct: 297 NVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW 356

Query: 89  ISKQEYDESGPSIVHRKCF 107
           I+KQEYDE+GPSIVHRKCF
Sbjct: 357 ITKQEYDEAGPSIVHRKCF 375
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 99.97
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 99.97
4fo0_A593 Actin-related protein 8; chromatin remodeling, nuc 99.96
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.96
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.95
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 99.94
4am6_A655 Actin-like protein ARP8; nuclear protein, chromati 99.81
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 98.96
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 98.4
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 98.39
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 97.98
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 97.88
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 97.66
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 97.2
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 97.02
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 96.86
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 96.79
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 96.66
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 96.52
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 96.35
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 95.55
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 94.84
2ews_A287 Pantothenate kinase; PANK, structural genomics, st 93.31
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 93.08
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 93.02
1nbw_A607 Glycerol dehydratase reactivase alpha subunit; mol 88.39
3js6_A355 Uncharacterized PARM protein; partition, segregati 88.14
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 85.26
2d0o_A610 DIOL dehydratase-reactivating factor large subunit 84.87
2i7n_A360 Pantothenate kinase 1; PANK, transferase; HET: ACO 81.02
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=99.97  E-value=3.2e-32  Score=210.57  Aligned_cols=96  Identities=26%  Similarity=0.555  Sum_probs=89.3

Q ss_pred             hcCCCCChhhhhccccCeEEecCCCCCcChHHHHHHHHHhhC--------------CCCceeEEeCCCCCccceeehhhh
Q psy430           12 SGSHPARAKFTKHFPHDVVLSGGTTMYPGIADRMQKEITALA--------------PSTMKIKIIAPPERKYSVWIGGSI   77 (107)
Q Consensus        12 ~~i~~~~~d~r~~l~~nIvltGG~s~~~G~~~Rl~~eL~~~~--------------p~~~~v~v~~~~~~~~~~W~Ggsi   77 (107)
                      .+|++||+|+|+.|++||||+||+|++|||.+||++||+.++              |..++++|..++++.+++|+|||+
T Consensus       313 ~sI~~c~~dlr~~L~~nIvLtGG~sl~~G~~~RL~~El~~l~~~~~~~~~~~~~~~p~~~~vkv~~~~~r~~s~WiGGSi  392 (427)
T 3dwl_A          313 NVVQSSPIDVRKGLYKNIVLSGGSTLFKNFGNRLQRDLKRIVDERIHRSEMLSGAKSGGVDVNVISHKRQRNAVWFGGSL  392 (427)
T ss_dssp             HHHHTSCHHHHHHHHHCEEEESGGGCSTTTTHHHHHHHHHHHTTC-------------CCCCCEECCTTCTTHHHHHHHH
T ss_pred             HHHHhCCHHHHHHHhCCEEEEccCcCCCChHHHHHHHHHHhhhhhccccccccccCCCceeEEEecCCccccceecCcee
Confidence            357889999999999999999999999999999999999987              556789999999999999999999


Q ss_pred             hccccccccccccHHHHhhcCchhhhhhcC
Q psy430           78 LASLSTFQQMWISKQEYDESGPSIVHRKCF  107 (107)
Q Consensus        78 ~a~l~~~~~~~Itr~eY~e~G~~~~~~k~~  107 (107)
                      ||+++.|+++||||+||+|+|++++|++++
T Consensus       393 lasl~~f~~~witk~EYeE~G~~iv~~~~~  422 (427)
T 3dwl_A          393 LAQTPEFGSYCHTKADYEEYGASIARRYQI  422 (427)
T ss_dssp             HHHSTTHHHHSEEHHHHHHSCGGGGSCCCC
T ss_pred             eccccchhheeEEHHHHhhhChHhheeccc
Confidence            999999999999999999999999999974
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A Back     alignment and structure
>2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 3smp_A* 3sms_A* 2i7p_A* 3mk6_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 107
d1k8ka2258 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 2e-40
d2fxua2225 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxI 6e-39
d1k8kb1190 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 6e-13
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 258 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Actin-related protein 3, Arp3
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  132 bits (332), Expect = 2e-40
 Identities = 32/102 (31%), Positives = 54/102 (52%), Gaps = 17/102 (16%)

Query: 23  KHFPHDVVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPE 66
           +    ++VLSGG+TM+     R+Q+++                  L P  + +++I    
Sbjct: 153 RPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHM 212

Query: 67  RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 107
           ++Y+VW GGS+LAS   F Q+  +K++Y+E GPSI  H   F
Sbjct: 213 QRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVF 254
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 225 Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 99.97
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 99.46
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 98.27
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 97.48
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 97.3
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 96.72
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 95.79
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 95.16
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus 88.46
d2i7na2212 Pantothenate kinase 1, PANK1 {Human (Homo sapiens) 88.15
d2hoea2169 N-acetylglucosamine kinase {Thermotoga maritima [T 85.83
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 84.95
d2aa4a2170 N-acetylmannosamine kinase NanK {Escherichia coli 84.02
d1xc3a2176 Putative fructokinase YhdR {Bacillus subtilis [Tax 81.09
d2ap1a1186 Putative regulator protein YcfX {Salmonella typhim 80.15
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Actin-related protein 3, Arp3
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.97  E-value=8.9e-34  Score=204.19  Aligned_cols=95  Identities=33%  Similarity=0.670  Sum_probs=87.5

Q ss_pred             cCCCCChhhhhccccCeEEecCCCCCcChHHHHHHHHHhhC----------------CCCceeEEeCCCCCccceeehhh
Q psy430           13 GSHPARAKFTKHFPHDVVLSGGTTMYPGIADRMQKEITALA----------------PSTMKIKIIAPPERKYSVWIGGS   76 (107)
Q Consensus        13 ~i~~~~~d~r~~l~~nIvltGG~s~~~G~~~Rl~~eL~~~~----------------p~~~~v~v~~~~~~~~~~W~Ggs   76 (107)
                      ++++||+|+|+.|++||+|+||+|++|||.+||++||+.++                |..+.++|..++++.+++|+||+
T Consensus       143 si~~~~~d~r~~L~~nIvl~GG~s~~~Gf~eRL~~EL~~~~~~~~~~~~~~~~~~~~~~~~~i~v~~~~~r~~s~W~Ggs  222 (258)
T d1k8ka2         143 VIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGS  222 (258)
T ss_dssp             HHHHSCGGGTTHHHHCEEEESGGGCSTTHHHHHHHHHHHHHHHHHHHHHHHC----CCCCCCCCEECCTTCTTHHHHHHH
T ss_pred             HHHhccHHhhHHHHhCEEEecCcccCCCHHHHHHHHHHhhcchhhhhhhhccccccCCCCceeeEecCCCCCceehHHHH
Confidence            47789999999999999999999999999999999998653                44567889999999999999999


Q ss_pred             hhccccccccccccHHHHhhcCchhh-hhhcC
Q psy430           77 ILASLSTFQQMWISKQEYDESGPSIV-HRKCF  107 (107)
Q Consensus        77 i~a~l~~~~~~~Itr~eY~e~G~~~~-~~k~~  107 (107)
                      ++|+++.|+++||||+||+|+|++++ +||||
T Consensus       223 ila~l~~f~~~~Itk~eY~E~G~~iv~~rk~f  254 (258)
T d1k8ka2         223 MLASTPEFYQVCHTKKDYEEIGPSICRHNPVF  254 (258)
T ss_dssp             HHTTSHHHHHHSEEHHHHHHHCGGGGGCCCCC
T ss_pred             HHHcCccHHhheecHHHHhhhChHHHhcCCCc
Confidence            99999999999999999999999999 57787
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2aa4a2 c.55.1.10 (A:120-289) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xc3a2 c.55.1.10 (A:119-294) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ap1a1 c.55.1.10 (A:118-303) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure