Psyllid ID: psy4323
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| 242007933 | 450 | conserved hypothetical protein [Pediculu | 0.863 | 0.366 | 0.832 | 9e-87 | |
| 240848649 | 217 | C-type lectin-like precursor [Acyrthosip | 0.874 | 0.769 | 0.823 | 2e-85 | |
| 347973243 | 219 | AGAP010196-PA [Anopheles gambiae str. PE | 0.863 | 0.753 | 0.827 | 5e-85 | |
| 357617272 | 271 | C-type lectin 4 [Danaus plexippus] | 0.863 | 0.608 | 0.816 | 7e-85 | |
| 380017281 | 219 | PREDICTED: uncharacterized protein LOC10 | 0.863 | 0.753 | 0.827 | 8e-85 | |
| 284813583 | 221 | C-type lectin 4 precursor [Bombyx mori] | 0.863 | 0.746 | 0.837 | 8e-85 | |
| 290578550 | 217 | conserved hypothetical protein [Apis mel | 0.863 | 0.760 | 0.827 | 1e-84 | |
| 339717139 | 217 | C-type lectin 5 precursor [Apis mellifer | 0.863 | 0.760 | 0.827 | 1e-84 | |
| 340729763 | 217 | PREDICTED: l-selectin-like [Bombus terre | 0.863 | 0.760 | 0.816 | 3e-84 | |
| 332029555 | 216 | hypothetical protein G5I_01734 [Acromyrm | 0.863 | 0.763 | 0.816 | 4e-84 |
| >gi|242007933|ref|XP_002424769.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508292|gb|EEB12031.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 324 bits (831), Expect = 9e-87, Method: Compositional matrix adjust.
Identities = 154/185 (83%), Positives = 160/185 (86%), Gaps = 20/185 (10%)
Query: 27 RVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVK 86
RVRHSTYRDARGV H+YFFSWEH PTR+LEVDWLDARNICRRHCMDAVSLETPQENEFVK
Sbjct: 265 RVRHSTYRDARGVAHAYFFSWEHGPTRNLEVDWLDARNICRRHCMDAVSLETPQENEFVK 324
Query: 87 QRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATG 146
QRI RG VRYIWTSGRKCNFNGCDRPDLQP N+NGWFWSGSGAKIGPTTQRNTGDWS+TG
Sbjct: 325 QRIARGGVRYIWTSGRKCNFNGCDRPDLQPPNINGWFWSGSGAKIGPTTQRNTGDWSSTG 384
Query: 147 GFGQAQPDNREAAQ--------------------HDVACHHLKPFVCEDSDELLNFVRSR 186
G+GQAQPDNREAAQ HDVACHH+KPFVCEDSDELLNFVRSR
Sbjct: 385 GYGQAQPDNREAAQGNDESCLSILNNFYNDGIKWHDVACHHVKPFVCEDSDELLNFVRSR 444
Query: 187 NPGIR 191
NPGIR
Sbjct: 445 NPGIR 449
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|240848649|ref|NP_001155798.1| C-type lectin-like precursor [Acyrthosiphon pisum] gi|239788217|dbj|BAH70797.1| ACYPI009411 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|347973243|ref|XP_319374.4| AGAP010196-PA [Anopheles gambiae str. PEST] gi|333469652|gb|EAA13809.5| AGAP010196-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|357617272|gb|EHJ70690.1| C-type lectin 4 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|380017281|ref|XP_003692588.1| PREDICTED: uncharacterized protein LOC100869862 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|284813583|ref|NP_001165397.1| C-type lectin 4 precursor [Bombyx mori] gi|283139166|gb|ADB12588.1| C-type lectin 11 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|290578550|gb|ADD51171.1| conserved hypothetical protein [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|339717139|ref|NP_001229926.1| C-type lectin 5 precursor [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340729763|ref|XP_003403165.1| PREDICTED: l-selectin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|332029555|gb|EGI69444.1| hypothetical protein G5I_01734 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| FB|FBgn0031918 | 219 | CG6055 [Drosophila melanogaste | 0.727 | 0.634 | 0.878 | 2.8e-84 | |
| FB|FBgn0038017 | 220 | CG4115 [Drosophila melanogaste | 0.691 | 0.6 | 0.595 | 2.9e-54 | |
| FB|FBgn0031629 | 231 | Clect27 "C-type lectin 27kD" [ | 0.591 | 0.489 | 0.470 | 4.6e-25 | |
| FB|FBgn0259958 | 175 | Sfp24F "Seminal fluid protein | 0.591 | 0.645 | 0.267 | 0.00064 |
| FB|FBgn0031918 CG6055 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 698 (250.8 bits), Expect = 2.8e-84, Sum P(2) = 2.8e-84
Identities = 123/140 (87%), Positives = 132/140 (94%)
Query: 27 RVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVK 86
RVRH++YRDARGV+HSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQEN+FVK
Sbjct: 34 RVRHASYRDARGVSHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENDFVK 93
Query: 87 QRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATG 146
QRI RGNVRYIWTSGRKCNF GCDRPDLQP N NGWFWSGSGAKIGPT+QRNTGDWS+TG
Sbjct: 94 QRIARGNVRYIWTSGRKCNFAGCDRPDLQPPNENGWFWSGSGAKIGPTSQRNTGDWSSTG 153
Query: 147 GFGQAQPDNREAAQ-HDVAC 165
G+ Q QPDNREAAQ +D +C
Sbjct: 154 GYQQPQPDNREAAQGNDESC 173
|
|
| FB|FBgn0038017 CG4115 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031629 Clect27 "C-type lectin 27kD" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0259958 Sfp24F "Seminal fluid protein 24F" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| cd00037 | 116 | cd00037, CLECT, C-type lectin (CTL)/C-type lectin- | 3e-08 | |
| pfam00059 | 108 | pfam00059, Lectin_C, Lectin C-type domain | 5e-07 | |
| smart00034 | 124 | smart00034, CLECT, C-type lectin (CTL) or carbohyd | 2e-04 | |
| cd03602 | 108 | cd03602, CLECT_1, C-type lectin (CTL)/C-type lecti | 0.003 |
| >gnl|CDD|153057 cd00037, CLECT, C-type lectin (CTL)/C-type lectin-like (CTLD) domain | Back alignment and domain information |
|---|
Score = 49.9 bits (119), Expect = 3e-08
Identities = 24/120 (20%), Positives = 47/120 (39%), Gaps = 14/120 (11%)
Query: 56 EVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQ 115
++ W +A+ CR S+ + +EN+F+ + + + +W + G
Sbjct: 9 KLTWEEAQEYCRSLGGHLASIHSEEENDFLASLLKKSSSSDVWIGLNDLSSEG------- 61
Query: 116 PANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQ-HDVACHHLKPFVCE 174
W WS G+ + T G+ + G + + +DV+C PF+CE
Sbjct: 62 -----TWKWS-DGSPLVDYTNWAPGEPNPGGSEDCVVLSSSSDGKWNDVSCSSKLPFICE 115
|
CLECT: C-type lectin (CTL)/C-type lectin-like (CTLD) domain; protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins. This group is chiefly comprised of eukaryotic CTLDs, but contains some, as yet functionally uncharacterized, bacterial CTLDs. Many CTLDs are calcium-dependent carbohydrate binding modules; other CTLDs bind protein ligands, lipids, and inorganic surfaces, including CaCO3 and ice. Animal C-type lectins are involved in such functions as extracellular matrix organization, endocytosis, complement activation, pathogen recognition, and cell-cell interactions. For example: mannose-binding lectin and lung surfactant proteins A and D bind carbohydrates on surfaces (e.g. pathogens, allergens, necrotic, and apoptotic cells) and mediate functions associated with killing and phagocytosis; P (platlet)-, E (endothelial)-, and L (leukocyte)- selectins (sels) mediate the initial attachment, tethering, and rolling of lymphocytes on inflamed vascular walls enabling subsequent lymphocyte adhesion and transmigration. CTLDs may bind a variety of carbohydrate ligands including mannose, N-acetylglucosamine, galactose, N-acetylgalactosamine, and fucose. Several CTLDs bind to protein ligands, and only some of these binding interactions are Ca2+-dependent; including the CTLDs of Coagulation Factors IX/X (IX/X) and Von Willebrand Factor (VWF) binding proteins, and natural killer cell receptors. C-type lectins, such as lithostathine, and some type II antifreeze glycoproteins function in a Ca2+-independent manner to bind inorganic surfaces. Many proteins in this group contain a single CTLD; these CTLDs associate with each other through several different surfaces to form dimers, trimers, or tetramers, from which ligand-binding sites project in different orientations. Various vertebrate type 1 transmembrane proteins including macrophage mannose receptor, endo180, phospholipase A2 receptor, and dendritic and epithelial cell receptor (DEC205) have extracellular domains containing 8 or more CTLDs; these CTLDs remain in the parent model. In some members (IX/X and VWF binding proteins), a loop extends to the adjoining domain to form a loop-swapped dimer. A similar conformation is seen in the macrophage mannose receptor CRD4's putative non-sugar bound form of the domain in the acid environment of the endosome. Lineage specific expansions of CTLDs have occurred in several animal lineages including Drosophila melanogaster and Caenorhabditis elegans; these CTLDs also remain in the parent model. Length = 116 |
| >gnl|CDD|215684 pfam00059, Lectin_C, Lectin C-type domain | Back alignment and domain information |
|---|
| >gnl|CDD|214480 smart00034, CLECT, C-type lectin (CTL) or carbohydrate-recognition domain (CRD) | Back alignment and domain information |
|---|
| >gnl|CDD|153072 cd03602, CLECT_1, C-type lectin (CTL)/C-type lectin-like (CTLD) domain subgroup 1; a subgroup of protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| cd03591 | 114 | CLECT_collectin_like C-type lectin-like domain (CT | 99.9 | |
| cd03598 | 117 | CLECT_EMBP_like C-type lectin-like domain (CTLD) o | 99.9 | |
| cd03603 | 118 | CLECT_VCBS A bacterial subgroup of the C-type lect | 99.9 | |
| cd03592 | 115 | CLECT_selectins_like C-type lectin-like domain (CT | 99.9 | |
| cd03596 | 129 | CLECT_tetranectin_like C-type lectin-like domain ( | 99.89 | |
| cd03601 | 119 | CLECT_TC14_like C-type lectin-like domain (CTLD) o | 99.89 | |
| cd03588 | 124 | CLECT_CSPGs C-type lectin-like domain (CTLD) of th | 99.89 | |
| cd03597 | 129 | CLECT_attractin_like C-type lectin-like domain (CT | 99.88 | |
| cd03589 | 137 | CLECT_CEL-1_like C-type lectin-like domain (CTLD) | 99.88 | |
| cd03590 | 126 | CLECT_DC-SIGN_like C-type lectin-like domain (CTLD | 99.87 | |
| cd03602 | 108 | CLECT_1 C-type lectin (CTL)/C-type lectin-like (CT | 99.87 | |
| cd03594 | 129 | CLECT_REG-1_like C-type lectin-like domain (CTLD) | 99.86 | |
| cd03599 | 153 | CLECT_DGCR2_like C-type lectin-like domain (CTLD) | 99.86 | |
| cd03593 | 116 | CLECT_NK_receptors_like C-type lectin-like domain | 99.85 | |
| cd03595 | 149 | CLECT_chondrolectin_like C-type lectin-like domain | 99.84 | |
| cd03600 | 141 | CLECT_thrombomodulin_like C-type lectin-like domai | 99.82 | |
| smart00034 | 126 | CLECT C-type lectin (CTL) or carbohydrate-recognit | 99.79 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 99.78 | |
| PHA02642 | 216 | C-type lectin-like protein; Provisional | 99.78 | |
| PHA02953 | 170 | IEV and EEV membrane glycoprotein; Provisional | 99.73 | |
| PHA03097 | 157 | C-type lectin-like protein; Provisional | 99.7 | |
| cd00037 | 116 | CLECT C-type lectin (CTL)/C-type lectin-like (CTLD | 99.67 | |
| PF00059 | 105 | Lectin_C: Lectin C-type domain; InterPro: IPR00130 | 99.67 | |
| PHA02867 | 167 | C-type lectin protein; Provisional | 99.53 | |
| PHA02911 | 213 | C-type lectin-like protein; Provisional | 99.2 | |
| PF05473 | 200 | Herpes_UL45: UL45 protein; InterPro: IPR008646 Thi | 97.7 | |
| cd03519 | 91 | Link_domain_HAPLN_module_2 Link_domain_HAPLN_modul | 94.09 | |
| cd01102 | 92 | Link_Domain The link domain is a hyaluronan (HA)-b | 91.59 | |
| cd03520 | 96 | Link_domain_CSPGs_modules_2_4 Link_domain_CSPGs_mo | 91.54 | |
| smart00445 | 94 | LINK Link (Hyaluronan-binding). | 91.12 | |
| cd03518 | 95 | Link_domain_HAPLN_module_1 Link_domain_HAPLN_modul | 90.21 | |
| cd03521 | 95 | Link_domain_KIAA0527_like Link_domain_KIAA0527_lik | 90.13 | |
| PF00193 | 92 | Xlink: Extracellular link domain; InterPro: IPR000 | 89.96 | |
| cd03515 | 93 | Link_domain_TSG_6_like This is the extracellular l | 89.66 | |
| PHA03093 | 185 | EEV glycoprotein; Provisional | 88.81 | |
| cd03517 | 95 | Link_domain_CSPGs_modules_1_3 Link_domain_CSPGs_mo | 88.72 | |
| PHA02673 | 161 | ORF109 EEV glycoprotein; Provisional | 87.17 | |
| KOG4297|consensus | 207 | 85.37 | ||
| cd03516 | 144 | Link_domain_CD44_like This domain is a hyaluronan | 84.29 |
| >cd03591 CLECT_collectin_like C-type lectin-like domain (CTLD) of the type found in human collectins including lung surfactant proteins A and D, mannose- or mannan binding lectin (MBL), and CL-L1 (collectin liver 1) | Back alignment and domain information |
|---|
Probab=99.90 E-value=1.4e-23 Score=155.54 Aligned_cols=96 Identities=21% Similarity=0.434 Sum_probs=84.0
Q ss_pred CcccCHHHHHHHHHHCCCeEeEecCHHHHHHHHHHHHcCCCCcEEEceeeCCCCCCCCCCCCCCCCCceEEccCCCcccc
Q psy4323 54 SLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGP 133 (191)
Q Consensus 54 ~~~~sW~~A~~~C~~~gg~LasI~s~~E~~~i~~~l~~~~~~~~WIGl~~~~~~gc~~~~~~~~~~~~w~W~~dGs~~~~ 133 (191)
.++++|.+|+.+|+.+||+||+|+|++|+++|..++.+ ....+||||++...++ .|.|+ ||+++
T Consensus 8 ~~~~~w~~A~~~C~~~g~~La~i~s~~e~~~l~~~~~~-~~~~~WiGl~~~~~~~------------~~~w~-dg~~~-- 71 (114)
T cd03591 8 GEEKNFDDAQKLCSEAGGTLAMPRNAAENAAIASYVKK-GNTYAFIGITDLETEG------------QFVYL-DGGPL-- 71 (114)
T ss_pred CceeCHHHHHHHHhhcCCEEecCCCHHHHHHHHHHHhc-CCccEEEecccCCcCC------------cEEeC-CCCCc--
Confidence 57899999999999999999999999999999999986 3457999999987766 99997 99998
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCccCCC-----------cCcCCCCCcceEEee
Q psy4323 134 TTQRNTGDWSATGGFGQAQPDNREAAQ-----------HDVACHHLKPFVCED 175 (191)
Q Consensus 134 ~~~~~y~nW~~~~~~~~~qP~~~~~~~-----------~d~~C~~~~~FICe~ 175 (191)
.|.+|.+ ++|++....+ .|.+|+.+++||||+
T Consensus 72 ----~y~~W~~------~ep~~~~~~~~Cv~~~~~~~W~~~~C~~~~~fICe~ 114 (114)
T cd03591 72 ----TYTNWKP------GEPNNAGGGEDCVEMYTSGKWNDVACNLTRLFVCEF 114 (114)
T ss_pred ----ccCCcCC------CCCCCCCCCCCeEEECCCCcCcCccCCCCeeEEeeC
Confidence 5779999 8898654211 789999999999985
|
CLECT_collectin_like: C-type lectin-like domain (CTLD) of the type found in human collectins including lung surfactant proteins A and D, mannose- or mannan binding lectin (MBL), and CL-L1 (collectin liver 1). CTLD refers to a domain homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins. The CTLDs of these collectins bind carbohydrates on surfaces (e.g. pathogens, allergens, necrotic, or apoptotic cells) and mediate functions associated with killing and phagocytosis. MBPs recognize high mannose oligosaccharides in a calcium dependent manner, bind to a broad range of pathogens, and trigger cell killing by activating the complement pathway. MBP also acts directly as an opsonin. SP-A and SP-D in addition to functioning as host defense components, a |
| >cd03598 CLECT_EMBP_like C-type lectin-like domain (CTLD) of the type found in the human proteins, eosinophil major basic protein (EMBP) and prepro major basic protein homolog (MBPH) | Back alignment and domain information |
|---|
| >cd03603 CLECT_VCBS A bacterial subgroup of the C-type lectin-like (CTLD) domain; a subgroup of bacterial protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins | Back alignment and domain information |
|---|
| >cd03592 CLECT_selectins_like C-type lectin-like domain (CTLD) of the type found in the type 1 transmembrane proteins: P(platlet)-, E(endothelial)-, and L(leukocyte)- selectins (sels) | Back alignment and domain information |
|---|
| >cd03596 CLECT_tetranectin_like C-type lectin-like domain (CTLD) of the type found in the tetranectin (TN), cartilage derived C-type lectin (CLECSF1), and stem cell growth factor (SCGF) | Back alignment and domain information |
|---|
| >cd03601 CLECT_TC14_like C-type lectin-like domain (CTLD) of the type found in lectins TC14, TC14-2, TC14-3, and TC14-4 from the budding tunicate Polyandrocarpa misakiensis and PfG6 from the Acorn worm | Back alignment and domain information |
|---|
| >cd03588 CLECT_CSPGs C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins | Back alignment and domain information |
|---|
| >cd03597 CLECT_attractin_like C-type lectin-like domain (CTLD) of the type found in human and mouse attractin (AtrN) and attractin-like protein (ALP) | Back alignment and domain information |
|---|
| >cd03589 CLECT_CEL-1_like C-type lectin-like domain (CTLD) of the type found in CEL-1 from Cucumaria echinata and Echinoidin from Anthocidaris crassispina | Back alignment and domain information |
|---|
| >cd03590 CLECT_DC-SIGN_like C-type lectin-like domain (CTLD) of the type found in human dendritic cell (DC)-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) and the related receptor, DC-SIGN receptor (DC-SIGNR) | Back alignment and domain information |
|---|
| >cd03602 CLECT_1 C-type lectin (CTL)/C-type lectin-like (CTLD) domain subgroup 1; a subgroup of protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins | Back alignment and domain information |
|---|
| >cd03594 CLECT_REG-1_like C-type lectin-like domain (CTLD) of the type found in Human REG-1 (lithostathine), REG-4, and avian eggshell-specific proteins: ansocalcin, structhiocalcin-1(SCA-1), and -2(SCA-2) | Back alignment and domain information |
|---|
| >cd03599 CLECT_DGCR2_like C-type lectin-like domain (CTLD) of the type found in DGCR2, an integral membrane protein deleted in DiGeorge Syndrome (DGS) | Back alignment and domain information |
|---|
| >cd03593 CLECT_NK_receptors_like C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs) | Back alignment and domain information |
|---|
| >cd03595 CLECT_chondrolectin_like C-type lectin-like domain (CTLD) of the type found in the human type-1A transmembrane proteins chondrolectin (CHODL) and layilin | Back alignment and domain information |
|---|
| >cd03600 CLECT_thrombomodulin_like C-type lectin-like domain (CTLD) of the type found in human thrombomodulin(TM), Endosialin, C14orf27, and C1qR | Back alignment and domain information |
|---|
| >smart00034 CLECT C-type lectin (CTL) or carbohydrate-recognition domain (CRD) | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >PHA02642 C-type lectin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02953 IEV and EEV membrane glycoprotein; Provisional | Back alignment and domain information |
|---|
| >PHA03097 C-type lectin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00037 CLECT C-type lectin (CTL)/C-type lectin-like (CTLD) domain | Back alignment and domain information |
|---|
| >PF00059 Lectin_C: Lectin C-type domain; InterPro: IPR001304 Lectins occur in plants, animals, bacteria and viruses | Back alignment and domain information |
|---|
| >PHA02867 C-type lectin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02911 C-type lectin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF05473 Herpes_UL45: UL45 protein; InterPro: IPR008646 This family consists several UL45 proteins and homologues found in the herpes simplex virus family | Back alignment and domain information |
|---|
| >cd03519 Link_domain_HAPLN_module_2 Link_domain_HAPLN_module_2; this link domain is found in the second link module of proteins similar to the vertebrate HAPLN (hyaluronan/HA and proteoglycan binding link) protein family which includes cartilage link protein | Back alignment and domain information |
|---|
| >cd01102 Link_Domain The link domain is a hyaluronan (HA)-binding domain | Back alignment and domain information |
|---|
| >cd03520 Link_domain_CSPGs_modules_2_4 Link_domain_CSPGs_modules_2_4; this link domain is found in the second and fourth link modules of the chondroitin sulfate proteoglycan core protein (CSPG) aggrecan and, in the second link module of three other CSPGs: versican, neurocan, and brevican | Back alignment and domain information |
|---|
| >smart00445 LINK Link (Hyaluronan-binding) | Back alignment and domain information |
|---|
| >cd03518 Link_domain_HAPLN_module_1 Link_domain_HAPLN_module_1; this link domain is found in the first link module of proteins similar to the vertebrate HAPLN (hyaluronan/HA and proteoglycan binding link) protein family which includes cartilage link protein | Back alignment and domain information |
|---|
| >cd03521 Link_domain_KIAA0527_like Link_domain_KIAA0527_like; this domain is found in the human protein KIAA0527 | Back alignment and domain information |
|---|
| >PF00193 Xlink: Extracellular link domain; InterPro: IPR000538 The link domain [] is a hyaluronan(HA)-binding region found in proteins of vertebrates that are involved in the assembly of extracellular matrix, cell adhesion, and migration | Back alignment and domain information |
|---|
| >cd03515 Link_domain_TSG_6_like This is the extracellular link domain of the type found in human TSG-6 | Back alignment and domain information |
|---|
| >PHA03093 EEV glycoprotein; Provisional | Back alignment and domain information |
|---|
| >cd03517 Link_domain_CSPGs_modules_1_3 Link_domain_CSPGs_modules_1_3; this extracellular link domain is found in the first and third link modules of the chondroitin sulfate proteoglycan core protein (CSPG) aggrecan | Back alignment and domain information |
|---|
| >PHA02673 ORF109 EEV glycoprotein; Provisional | Back alignment and domain information |
|---|
| >KOG4297|consensus | Back alignment and domain information |
|---|
| >cd03516 Link_domain_CD44_like This domain is a hyaluronan (HA)-binding domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 4e-06 | |
| 1egg_A | 147 | Macrophage mannose receptor; C-type lectin, sugar | 5e-06 | |
| 1pwb_A | 177 | SP-D, PSP-D, pulmonary surfactant-associated prote | 8e-06 | |
| 2ox9_A | 140 | Collectin placenta 1; C-type lectin, sugar binding | 8e-06 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 1e-05 | |
| 2vuv_A | 129 | Codakine; sugar-binding protein, C-type, lectin, m | 2e-05 | |
| 1ukm_A | 134 | EMS16 A chain, EMS16 subunit A; domain swapping, C | 2e-05 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 2e-05 | |
| 3kqg_A | 182 | Langerin, C-type lectin domain family 4 member K; | 5e-05 | |
| 3c22_A | 156 | C-type lectin domain family 4 member K; coiled coi | 1e-04 | |
| 1j34_A | 129 | Coagulation factor IX-binding protein A chain; mag | 1e-04 | |
| 1jzn_A | 135 | Galactose-specific lectin; C-type lectin, protein- | 1e-04 | |
| 1h8u_A | 117 | MBP, eosinophil granule major basic protein 1; lec | 1e-04 | |
| 1jwi_A | 131 | Bitiscetin; domain swapping, C-type lectin, toxin; | 2e-04 | |
| 1oz7_A | 131 | Echicetin A-chain; platelet aggregation, dimer, to | 3e-04 | |
| 1sl6_A | 184 | C-type lectin DC-signr; sugar binding protein; HET | 3e-04 | |
| 1byf_A | 125 | TC14, protein (polyandrocarpa lectin); C-type lect | 4e-04 | |
| 2b6b_D | 175 | CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe | 5e-04 | |
| 2py2_A | 136 | Antifreeze protein type II; type II antifreeze pro | 5e-04 | |
| 3gpr_C | 134 | Rhodocetin subunit gamma; disulfide bond, lectin, | 5e-04 | |
| 1umr_A | 135 | Convulxin alpha, CVX alpha; lectin, C-type lectin, | 5e-04 | |
| 2h2t_B | 175 | Low affinity immunoglobulin epsilon FC receptor ( | 6e-04 | |
| 2xr6_A | 170 | CD209 antigen; sugar binding protein, carbohydrate | 6e-04 | |
| 1rdl_1 | 113 | SUB-MBP-C, mannose-binding protein-C; C-type lecti | 9e-04 | |
| 1hup_A | 141 | Mannose-binding protein; alpha-helical coiled-coil | 9e-04 |
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
Score = 44.0 bits (104), Expect = 4e-06
Identities = 29/148 (19%), Positives = 51/148 (34%), Gaps = 48/148 (32%)
Query: 43 YFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGR 102
Y +S + ++W AR CR + D V+++ E E++++ + Y W R
Sbjct: 3 YHYSEK-------PMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYY-WIGIR 54
Query: 103 KCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQH- 161
K W W G+ + +W G +P+N++ +
Sbjct: 55 KIG--------------GIWTWVGT----NKSLTEEAENW-GDG-----EPNNKKNKEDC 90
Query: 162 ---------------DVACHHLKPFVCE 174
D ACH LK +C
Sbjct: 91 VEIYIKRNKDAGKWNDDACHKLKAALCY 118
|
| >1egg_A Macrophage mannose receptor; C-type lectin, sugar binding protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1egi_A Length = 147 | Back alignment and structure |
|---|
| >1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... Length = 177 | Back alignment and structure |
|---|
| >2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A Length = 140 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 | Back alignment and structure |
|---|
| >2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* Length = 129 | Back alignment and structure |
|---|
| >1ukm_A EMS16 A chain, EMS16 subunit A; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_A* Length = 134 | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 | Back alignment and structure |
|---|
| >3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} Length = 182 | Back alignment and structure |
|---|
| >3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* Length = 156 | Back alignment and structure |
|---|
| >1j34_A Coagulation factor IX-binding protein A chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_A* 1j35_A* 1x2t_A* 1x2w_A 1ixx_A 1y17_A 1wt9_A 1iod_A* Length = 129 | Back alignment and structure |
|---|
| >1jzn_A Galactose-specific lectin; C-type lectin, protein-disaccharide complex, sugar binding P; HET: BGC GAL; 2.20A {Crotalus atrox} SCOP: d.169.1.1 PDB: 1muq_A* Length = 135 | Back alignment and structure |
|---|
| >1h8u_A MBP, eosinophil granule major basic protein 1; lectin, eosinophil granule protein, EMBP; 1.8A {Homo sapiens} SCOP: d.169.1.1 PDB: 2brs_A* Length = 117 | Back alignment and structure |
|---|
| >1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A Length = 131 | Back alignment and structure |
|---|
| >1oz7_A Echicetin A-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Length = 131 | Back alignment and structure |
|---|
| >1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A Length = 184 | Back alignment and structure |
|---|
| >1byf_A TC14, protein (polyandrocarpa lectin); C-type lectin, galactose-specific, sugar binding protein; 2.00A {Polyandrocarpa misakiensis} SCOP: d.169.1.1 PDB: 1tlg_A* Length = 125 | Back alignment and structure |
|---|
| >2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 Length = 175 | Back alignment and structure |
|---|
| >2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} Length = 136 | Back alignment and structure |
|---|
| >3gpr_C Rhodocetin subunit gamma; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Length = 134 | Back alignment and structure |
|---|
| >1umr_A Convulxin alpha, CVX alpha; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_A Length = 135 | Back alignment and structure |
|---|
| >2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A Length = 175 | Back alignment and structure |
|---|
| >2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* Length = 170 | Back alignment and structure |
|---|
| >1rdl_1 SUB-MBP-C, mannose-binding protein-C; C-type lectin, calcium-binding protein; HET: MMA; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1rdj_1* 1rdk_1* 1rdi_1* 1rdm_1* 1rdn_1* 1rdo_1 1bv4_A 1kza_1* 1kzb_1* 1kzc_1* 1kzd_1* 1kze_1* Length = 113 | Back alignment and structure |
|---|
| >1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Length = 141 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| 2msb_A | 115 | Mannose-binding protein-A; lectin; HET: BMA MAN; 1 | 99.91 | |
| 1rdl_1 | 113 | SUB-MBP-C, mannose-binding protein-C; C-type lecti | 99.91 | |
| 1h8u_A | 117 | MBP, eosinophil granule major basic protein 1; lec | 99.9 | |
| 2py2_A | 136 | Antifreeze protein type II; type II antifreeze pro | 99.9 | |
| 1ypq_A | 135 | Oxidised low density lipoprotein (lectin-like) rec | 99.9 | |
| 3vpp_A | 132 | C-type lectin domain family 9 member A; dendritic | 99.9 | |
| 2zib_A | 133 | Type II antifreeze protein; thermal hysteresis, le | 99.9 | |
| 1qdd_A | 144 | Lithostathine; pancreatic stone inhibitor, metal b | 99.9 | |
| 1tn3_A | 137 | Tetranectin; plasminogen binding, kringle 4, C-typ | 99.9 | |
| 2kv3_A | 131 | Regenerating islet-derived protein 4; GISP, C-type | 99.89 | |
| 1rtm_1 | 149 | Mannose-binding protein-A; lectin; 1.80A {Rattus n | 99.89 | |
| 1egg_A | 147 | Macrophage mannose receptor; C-type lectin, sugar | 99.89 | |
| 1byf_A | 125 | TC14, protein (polyandrocarpa lectin); C-type lect | 99.89 | |
| 1hup_A | 141 | Mannose-binding protein; alpha-helical coiled-coil | 99.89 | |
| 2ox9_A | 140 | Collectin placenta 1; C-type lectin, sugar binding | 99.89 | |
| 3kqg_A | 182 | Langerin, C-type lectin domain family 4 member K; | 99.89 | |
| 3alu_A | 157 | Lectin CEL-IV, C-type; C-type lectin, raffinose, s | 99.89 | |
| 3pbf_A | 148 | Pulmonary surfactant-associated protein A; collect | 99.89 | |
| 1gz2_A | 142 | Ovocleidin-17, OC-17 ovocleidin; structural protei | 99.89 | |
| 1tdq_B | 130 | Aggrecan core protein; extracellular matrix, lecti | 99.89 | |
| 1wmz_A | 140 | Lectin CEL-I, N-acetyl-D-galactosamine-specific C- | 99.89 | |
| 1jzn_A | 135 | Galactose-specific lectin; C-type lectin, protein- | 99.89 | |
| 2bpd_A | 142 | Dectin-1; receptor, beta-glucan, fungal recognitio | 99.89 | |
| 1buu_A | 168 | Protein (mannose-binding protein A); lectin, HOST | 99.89 | |
| 3ubu_A | 131 | Agglucetin subunit alpha-1; platelet inhibiting, a | 99.89 | |
| 3bx4_A | 136 | Aggretin alpha chain; toxin; 1.70A {Agkistrodon rh | 99.89 | |
| 1ukm_A | 134 | EMS16 A chain, EMS16 subunit A; domain swapping, C | 99.88 | |
| 3gpr_C | 134 | Rhodocetin subunit gamma; disulfide bond, lectin, | 99.88 | |
| 1dv8_A | 128 | Asialoglycoprotein receptor 1; C-type lectin CRD, | 99.88 | |
| 1fvu_B | 125 | Botrocetin beta chain; VON WILLBRAND factor modula | 99.88 | |
| 1uv0_A | 149 | Pancreatitis-associated protein 1; lectin, C-type, | 99.88 | |
| 2c6u_A | 122 | CLEC1B protein; lectin, rhodocytin, aggretin, C-ty | 99.88 | |
| 1jwi_B | 125 | Platelet aggregation inducer; domain swapping, C-t | 99.88 | |
| 2b6b_D | 175 | CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe | 99.88 | |
| 1umr_A | 135 | Convulxin alpha, CVX alpha; lectin, C-type lectin, | 99.88 | |
| 1c3a_A | 135 | Flavocetin-A: alpha subunit; C-type lectin-like do | 99.88 | |
| 2vuv_A | 129 | Codakine; sugar-binding protein, C-type, lectin, m | 99.88 | |
| 3g8k_A | 130 | Lectin-related NK cell receptor LY49L1; natural ki | 99.88 | |
| 2yhf_A | 118 | C-type lectin domain family 5 member A; immune sys | 99.87 | |
| 1sl6_A | 184 | C-type lectin DC-signr; sugar binding protein; HET | 99.87 | |
| 3c22_A | 156 | C-type lectin domain family 4 member K; coiled coi | 99.87 | |
| 2afp_A | 129 | Protein (SEA raven type II antifreeze protein); re | 99.87 | |
| 1wk1_A | 150 | Hypothetical protein YK1067A12; lectin C-type doma | 99.87 | |
| 1j34_A | 129 | Coagulation factor IX-binding protein A chain; mag | 99.87 | |
| 1htn_A | 182 | Tetranectin; plasminogen binding, kringle 4, alpha | 99.87 | |
| 3rs1_A | 122 | C-type lectin domain family 2 member I; C-type lec | 99.87 | |
| 2xr6_A | 170 | CD209 antigen; sugar binding protein, carbohydrate | 99.87 | |
| 2e3x_B | 134 | Coagulation factor X-activating enzyme light CHAI; | 99.87 | |
| 1hq8_A | 123 | NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A { | 99.87 | |
| 3bdw_A | 123 | Natural killer cells antigen CD94; NK cells, recep | 99.87 | |
| 1sb2_B | 129 | Rhodocetin beta subunit; C-type lectin, domain swa | 99.87 | |
| 2h2t_B | 175 | Low affinity immunoglobulin epsilon FC receptor ( | 99.87 | |
| 1mpu_A | 138 | NKG2-D type II integral membrane protein; C-type l | 99.87 | |
| 1pwb_A | 177 | SP-D, PSP-D, pulmonary surfactant-associated prote | 99.87 | |
| 1jwi_A | 131 | Bitiscetin; domain swapping, C-type lectin, toxin; | 99.87 | |
| 2ls8_A | 156 | C-type lectin domain family 4 member D; structural | 99.78 | |
| 3ff7_C | 112 | Killer cell lectin-like receptor subfamily G membe | 99.86 | |
| 1umr_C | 125 | Convulxin beta, CVX beta; lectin, C-type lectin, p | 99.85 | |
| 1oz7_A | 131 | Echicetin A-chain; platelet aggregation, dimer, to | 99.85 | |
| 3gpr_D | 124 | Rhodocetin subunit delta; disulfide bond, lectin, | 99.85 | |
| 1oz7_B | 123 | Echicetin B-chain; platelet aggregation, dimer, to | 99.85 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 99.85 | |
| 3m9z_A | 139 | Killer cell lectin-like receptor subfamily B MEMB; | 99.85 | |
| 1j34_B | 123 | Coagulation factor IX-binding protein B chain; mag | 99.85 | |
| 1fvu_A | 133 | Botrocetin alpha chain; VON WILLBRAND factor modul | 99.85 | |
| 3ubu_B | 126 | Agglucetin subunit beta-2; platelet inhibiting, ag | 99.85 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 99.85 | |
| 2e3x_C | 122 | Coagulation factor X-activating enzyme light CHAI; | 99.84 | |
| 1c3a_B | 125 | Flavocetin-A: beta subunit; C-type lectin-like dom | 99.84 | |
| 3bdw_B | 120 | NKG2-A/NKG2-B type II integral membrane protein; N | 99.84 | |
| 3ff9_A | 115 | Killer cell lectin-like receptor subfamily G membe | 99.84 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 99.84 | |
| 1ukm_B | 128 | EMS16 B chain, EMS16 subunit B; domain swapping, C | 99.84 | |
| 1sb2_A | 133 | Rhodocetin alpha subunit; C-type lectin, domain sw | 99.84 | |
| 3g8l_A | 190 | Lectin-related NK cell receptor LY49L1; natural ki | 99.84 | |
| 3hup_A | 130 | Early activation antigen CD69; C-type lectin-like | 99.84 | |
| 3bx4_B | 146 | Aggretin beta chain; toxin; 1.70A {Agkistrodon rho | 99.83 | |
| 3c8j_A | 203 | Natural killer cell receptor LY49C; MHC, virus, im | 99.83 | |
| 1fm5_A | 199 | Early activation antigen CD69; C-type lectin-like | 99.77 | |
| 3k7b_A | 96 | Protein A33; C-type lectin-like domain, homodimer, | 98.27 | |
| 1o7b_T | 98 | Tumor necrosis factor-inducible protein TSG-6; hya | 88.87 | |
| 2jcq_A | 154 | CD44 antigen; sugar-binding protein, hyauronan, LI | 81.91 |
| >2msb_A Mannose-binding protein-A; lectin; HET: BMA MAN; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1msb_A 1ytt_A* | Back alignment and structure |
|---|
Probab=99.91 E-value=1.6e-24 Score=158.70 Aligned_cols=102 Identities=12% Similarity=0.333 Sum_probs=86.6
Q ss_pred ceeEEEeccCCCCCCcccCHHHHHHHHHHCCCeEeEecCHHHHHHHHHHHHcCCCCcEEEceeeCCCCCCCCCCCCCCCC
Q psy4323 40 THSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANV 119 (191)
Q Consensus 40 ~~~Y~fs~~~~~~~~~~~sW~~A~~~C~~~gg~LasI~s~~E~~~i~~~l~~~~~~~~WIGl~~~~~~gc~~~~~~~~~~ 119 (191)
++||+++ ..+++|.+|+..|+.+||+||+|+|++|++||.+++. ..+||||++...++
T Consensus 3 ~~Cy~~~-------~~~~~w~~A~~~C~~~g~~La~i~s~~e~~~l~~~~~----~~~WiGl~~~~~~~----------- 60 (115)
T 2msb_A 3 KKFFVTN-------HERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAK----TSAFLGITDEVTEG----------- 60 (115)
T ss_dssp -CEEEEE-------EEEECHHHHHHHHHHTTCEECCCSSHHHHHHHHHHHS----SCEEEEEECSSSTT-----------
T ss_pred CEEEEEe-------CCCcCHHHHHHHHHhCCCEEeccCCHHHHHHHHHhhc----CCEEEeeEcCCCCC-----------
Confidence 4568886 3689999999999999999999999999999999884 57999999887766
Q ss_pred CceEEccCCCccccCCCCCCCCCCCCCCCCCCCCCCccCCC-----------cCcCCCCCcceEEeecc
Q psy4323 120 NGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQ-----------HDVACHHLKPFVCEDSD 177 (191)
Q Consensus 120 ~~w~W~~dGs~~~~~~~~~y~nW~~~~~~~~~qP~~~~~~~-----------~d~~C~~~~~FICe~~~ 177 (191)
.|+|+ ||+++ .|.+|.+ ++|++....+ +|.+|..+++||||+++
T Consensus 61 -~w~W~-dg~~~------~~~~W~~------~~P~~~~~~~~C~~~~~~g~W~~~~C~~~~~fiCe~~a 115 (115)
T 2msb_A 61 -QFMYV-TGGRL------TYSNWKK------DEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCEFPA 115 (115)
T ss_dssp -CCEET-TSSBC------CSCCBCT------TCCCCCTTCCCEEEECTTSCEEEECTTSCEEEEEEEC-
T ss_pred -cEEEC-CCCEe------eecCcCC------CCCCCCCCCCCeEEECCCCCEECcCCCCCeEEEEeEcC
Confidence 99997 99998 4779999 9998732211 89999999999999864
|
| >1rdl_1 SUB-MBP-C, mannose-binding protein-C; C-type lectin, calcium-binding protein; HET: MMA; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1rdj_1* 1rdk_1* 1rdi_1* 1rdm_1* 1rdn_1* 1rdo_1 1bv4_A 1kza_1* 1kzb_1* 1kzc_1* 1kzd_1* 1kze_1* | Back alignment and structure |
|---|
| >1h8u_A MBP, eosinophil granule major basic protein 1; lectin, eosinophil granule protein, EMBP; 1.8A {Homo sapiens} SCOP: d.169.1.1 PDB: 2brs_A* | Back alignment and structure |
|---|
| >2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} | Back alignment and structure |
|---|
| >1ypq_A Oxidised low density lipoprotein (lectin-like) receptor 1; oxidized low density lipoprotein receptor, LOX-1, CTLD, C- type lectin like domain; 1.40A {Homo sapiens} SCOP: d.169.1.1 PDB: 1ypu_A 1yxk_A 3vlg_A 1ypo_A 1yxj_A | Back alignment and structure |
|---|
| >3vpp_A C-type lectin domain family 9 member A; dendritic cell, C-type lectin-like domain, membrane, immune; 1.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2zib_A Type II antifreeze protein; thermal hysteresis, lectin; 1.34A {Brachyopsis rostratus} | Back alignment and structure |
|---|
| >1qdd_A Lithostathine; pancreatic stone inhibitor, metal binding protein; HET: SIA NDG GAL; 1.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1lit_A | Back alignment and structure |
|---|
| >1tn3_A Tetranectin; plasminogen binding, kringle 4, C-type lectin, carbohydrate recognition domain; 2.00A {Homo sapiens} SCOP: d.169.1.1 PDB: 1rjh_A 3l9j_C | Back alignment and structure |
|---|
| >2kv3_A Regenerating islet-derived protein 4; GISP, C-type lectin, REG IV, disulfide bond, glycoPro lectin, secreted, sugar binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rtm_1 Mannose-binding protein-A; lectin; 1.80A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 PDB: 1kwu_A* 1kwv_A* 1kwt_A* 1kwx_A* 1kwy_A* 1kx1_A* 1kww_A 1kwz_A* 1kx0_A* 3kmb_1* 1kmb_1* 2kmb_1* 4kmb_1* 1afb_1* 1afa_1* 1afd_1 1bch_1* 1bcj_1* 1fif_A 1fih_A* | Back alignment and structure |
|---|
| >1egg_A Macrophage mannose receptor; C-type lectin, sugar binding protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1egi_A | Back alignment and structure |
|---|
| >1byf_A TC14, protein (polyandrocarpa lectin); C-type lectin, galactose-specific, sugar binding protein; 2.00A {Polyandrocarpa misakiensis} SCOP: d.169.1.1 PDB: 1tlg_A* | Back alignment and structure |
|---|
| >1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 | Back alignment and structure |
|---|
| >2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A | Back alignment and structure |
|---|
| >3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3alu_A Lectin CEL-IV, C-type; C-type lectin, raffinose, sugar binding protein; HET: RAF; 1.65A {Cucumaria echinata} PDB: 3als_A* 3alt_A* | Back alignment and structure |
|---|
| >3pbf_A Pulmonary surfactant-associated protein A; collectin, carbohydrate binding, lectin, mannose, sugar BIND protein; 1.80A {Rattus norvegicus} PDB: 1r14_A* 1r13_A* 3paq_A* 3par_A 3pak_A | Back alignment and structure |
|---|
| >1gz2_A Ovocleidin-17, OC-17 ovocleidin; structural protein, CTLD, eggshell structural protein, phosphoprotein, sugar-binding protein, glycoprotein; HET: SEP; 1.5A {Gallus gallus} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1tdq_B Aggrecan core protein; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1wmz_A Lectin CEL-I, N-acetyl-D-galactosamine-specific C-type; C-type lectin, N-acetylgalactosamine, invertebrate, sugar binding protein; HET: NGA A2G; 1.70A {Cucumaria echinata} SCOP: d.169.1.1 PDB: 1wmy_A* | Back alignment and structure |
|---|
| >1jzn_A Galactose-specific lectin; C-type lectin, protein-disaccharide complex, sugar binding P; HET: BGC GAL; 2.20A {Crotalus atrox} SCOP: d.169.1.1 PDB: 1muq_A* | Back alignment and structure |
|---|
| >2bpd_A Dectin-1; receptor, beta-glucan, fungal recognition, C-type lectin-like domain, CTLD, carbohydrate; 1.5A {Mus musculus} PDB: 2bph_A 2bpe_A 2cl8_A* | Back alignment and structure |
|---|
| >1buu_A Protein (mannose-binding protein A); lectin, HOST defense, metalloprotein, sugar binding protein; 1.90A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 | Back alignment and structure |
|---|
| >3ubu_A Agglucetin subunit alpha-1; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} | Back alignment and structure |
|---|
| >3bx4_A Aggretin alpha chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_A | Back alignment and structure |
|---|
| >1ukm_A EMS16 A chain, EMS16 subunit A; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_A* | Back alignment and structure |
|---|
| >3gpr_C Rhodocetin subunit gamma; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} | Back alignment and structure |
|---|
| >1dv8_A Asialoglycoprotein receptor 1; C-type lectin CRD, signaling protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1fvu_B Botrocetin beta chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_C 1u0n_C 1u0o_B | Back alignment and structure |
|---|
| >1uv0_A Pancreatitis-associated protein 1; lectin, C-type, secreted, inflammatory response, acute phase; 1.78A {Homo sapiens} SCOP: d.169.1.1 PDB: 2go0_A | Back alignment and structure |
|---|
| >2c6u_A CLEC1B protein; lectin, rhodocytin, aggretin, C-type lectin-like, platelets, thrombosis; 1.6A {Homo sapiens} | Back alignment and structure |
|---|
| >1jwi_B Platelet aggregation inducer; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_B | Back alignment and structure |
|---|
| >2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1umr_A Convulxin alpha, CVX alpha; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_A | Back alignment and structure |
|---|
| >1c3a_A Flavocetin-A: alpha subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_A | Back alignment and structure |
|---|
| >2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* | Back alignment and structure |
|---|
| >2yhf_A C-type lectin domain family 5 member A; immune system; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A | Back alignment and structure |
|---|
| >3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* | Back alignment and structure |
|---|
| >2afp_A Protein (SEA raven type II antifreeze protein); recombinant SEA raven protein, solution backbone fold, C- type lectin; NMR {Hemitripterus americanus} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1wk1_A Hypothetical protein YK1067A12; lectin C-type domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Caenorhabditis elegans} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1j34_A Coagulation factor IX-binding protein A chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_A* 1j35_A* 1x2t_A* 1x2w_A 1ixx_A 1y17_A 1wt9_A 1iod_A* | Back alignment and structure |
|---|
| >1htn_A Tetranectin; plasminogen binding, kringle 4, alpha-helical coiled coil, C-type lectin, carbohydrate recognition domain; 2.80A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 | Back alignment and structure |
|---|
| >3rs1_A C-type lectin domain family 2 member I; C-type lectin-like, ligand of NK receptor, natural killer CE receptors, surface of activated T lymphocytes; 1.94A {Mus musculus} | Back alignment and structure |
|---|
| >2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* | Back alignment and structure |
|---|
| >2e3x_B Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} | Back alignment and structure |
|---|
| >1hq8_A NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A {Mus musculus} SCOP: d.169.1.1 PDB: 1jsk_A 1kcg_A* | Back alignment and structure |
|---|
| >3bdw_A Natural killer cells antigen CD94; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 3cdg_J 1b6e_A 3cii_G | Back alignment and structure |
|---|
| >1sb2_B Rhodocetin beta subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_B | Back alignment and structure |
|---|
| >2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A | Back alignment and structure |
|---|
| >1mpu_A NKG2-D type II integral membrane protein; C-type lectin-like domain, immune system; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 1hyr_B | Back alignment and structure |
|---|
| >1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... | Back alignment and structure |
|---|
| >1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A | Back alignment and structure |
|---|
| >2ls8_A C-type lectin domain family 4 member D; structural genomics, NEW YORK structural genomics research consortium, nysgrc, PSI-biology, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ff7_C Killer cell lectin-like receptor subfamily G member 1; KLRG1-cadherin complex, calcium, cell adhesion, cell junction, cell membrane; 1.80A {Homo sapiens} SCOP: d.169.1.0 | Back alignment and structure |
|---|
| >1umr_C Convulxin beta, CVX beta; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_B | Back alignment and structure |
|---|
| >1oz7_A Echicetin A-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >3gpr_D Rhodocetin subunit delta; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} | Back alignment and structure |
|---|
| >1oz7_B Echicetin B-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >3m9z_A Killer cell lectin-like receptor subfamily B MEMB; C-type lectin-like domain, domain swapping, disulfide bond, transmembrane protein; 1.70A {Mus musculus} SCOP: d.169.1.0 PDB: 3t3a_A | Back alignment and structure |
|---|
| >1j34_B Coagulation factor IX-binding protein B chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_B 1ixx_B* 1j35_B* 1x2t_B* 1x2w_B 1wt9_B 1iod_B 1y17_B | Back alignment and structure |
|---|
| >1fvu_A Botrocetin alpha chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_B 1u0n_B 1u0o_A | Back alignment and structure |
|---|
| >3ubu_B Agglucetin subunit beta-2; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2e3x_C Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} | Back alignment and structure |
|---|
| >1c3a_B Flavocetin-A: beta subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_B | Back alignment and structure |
|---|
| >3bdw_B NKG2-A/NKG2-B type II integral membrane protein; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} PDB: 3cdg_K 3cii_H | Back alignment and structure |
|---|
| >3ff9_A Killer cell lectin-like receptor subfamily G member 1; natural killer cell receptor KLTG1, glycoprotein, membrane, phosphoprotein, signal-anchor; 1.80A {Mus musculus} SCOP: d.169.1.0 PDB: 3ff8_C | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1ukm_B EMS16 B chain, EMS16 subunit B; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_B* | Back alignment and structure |
|---|
| >1sb2_A Rhodocetin alpha subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_A | Back alignment and structure |
|---|
| >3g8l_A Lectin-related NK cell receptor LY49L1; natural killer cell receptor, immune system; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3hup_A Early activation antigen CD69; C-type lectin-like domain, disulfide bond, glycoprotein, LEC membrane, phosphoprotein, signal-anchor, transmembrane; 1.37A {Homo sapiens} SCOP: d.169.1.1 PDB: 1e87_A 1e8i_A 3cck_A | Back alignment and structure |
|---|
| >3bx4_B Aggretin beta chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_B | Back alignment and structure |
|---|
| >3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D | Back alignment and structure |
|---|
| >1fm5_A Early activation antigen CD69; C-type lectin-like domain, natural killer cell receptor, lectin, C-type lectin, immune system; 2.27A {Homo sapiens} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >3k7b_A Protein A33; C-type lectin-like domain, homodimer, poxvirus, EEV, EV, VIR protein; 2.10A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >1o7b_T Tumor necrosis factor-inducible protein TSG-6; hyaluronan-binding domain, carbohydrate-binding domain, LINK module, cell adhesion, glycoprotein; NMR {Homo sapiens} SCOP: d.169.1.4 PDB: 1o7c_T 2pf5_A* | Back alignment and structure |
|---|
| >2jcq_A CD44 antigen; sugar-binding protein, hyauronan, LINK-domain, proteoglycan, polymorphism, blood group antigen, alternative splicing, lectin; HET: NAG GCU 5AX GOL; 1.25A {Mus musculus} PDB: 2jcr_A* 2jcp_A 2i83_A 1poz_A 1uuh_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 191 | ||||
| d1wk1a_ | 150 | d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caeno | 3e-06 | |
| d1byfa_ | 123 | d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocar | 2e-04 | |
| d1hupa1 | 117 | d.169.1.1 (A:112-228) Mannose-binding protein A, C | 7e-04 | |
| d1h8ua_ | 115 | d.169.1.1 (A:) Eosinophil major basic protein {Hum | 9e-04 |
| >d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 150 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: C-type lectin-like superfamily: C-type lectin-like family: C-type lectin domain domain: Hypothetical protein F28B4.3 species: Caenorhabditis elegans [TaxId: 6239]
Score = 43.1 bits (100), Expect = 3e-06
Identities = 16/119 (13%), Positives = 28/119 (23%), Gaps = 7/119 (5%)
Query: 56 EVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQ 115
+ ARN C +N F W K + Q
Sbjct: 17 ILSMPQARNFCASAGGYLADDLGDDKNNFYSSIAANT---QFWIGLFKNSDGQFYWDRGQ 73
Query: 116 PANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQHDVACHHLKPFVCE 174
N + + G + T + ++ C +PF+C+
Sbjct: 74 GINPDLLNQPITYWANGEPSNDPTRQCVYF----DGRSGDKSKVWTTDTCATPRPFICQ 128
|
| >d1byfa_ d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]} Length = 123 | Back information, alignment and structure |
|---|
| >d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| d2msba_ | 112 | Mannose-binding protein A, C-lectin domain {Rat (R | 99.91 | |
| d1rdl1_ | 111 | Mannose-binding protein A, C-lectin domain {Rat (R | 99.9 | |
| d1qdda_ | 144 | Lithostathine, inhibitor of stone formation {Human | 99.89 | |
| d1r13a1 | 119 | Surfactant protein, lectin domain {Rat (Rattus nor | 99.89 | |
| d1pwba1 | 121 | Surfactant protein, lectin domain {Human (Homo sap | 99.89 | |
| d1hupa1 | 117 | Mannose-binding protein A, C-lectin domain {Human | 99.89 | |
| d1h8ua_ | 115 | Eosinophil major basic protein {Human (Homo sapien | 99.89 | |
| d1xpha1 | 130 | DC-SIGNR (DC-SIGN related receptor) {Human (Homo s | 99.89 | |
| d1gz2a_ | 139 | Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 903 | 99.89 | |
| d1tn3a_ | 137 | Tetranectin {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1v7pa_ | 134 | Snake coagglutinin alpha chain {Snake (Echis multi | 99.89 | |
| d1tdqb_ | 126 | Aggrecan core protein {Rat (Rattus norvegicus) [Ta | 99.88 | |
| d1jwia_ | 124 | Snake coagglutinin alpha chain {Puff adder (Bitis | 99.88 | |
| d1c3aa_ | 135 | Snake coagglutinin alpha chain {Habu snake (Trimer | 99.88 | |
| d1jzna_ | 135 | Galactose-specific C-type lectin {Western diamondb | 99.88 | |
| d1wmza_ | 140 | Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} | 99.88 | |
| d1umrc_ | 125 | Snake coagglutinin beta chain {South american ratt | 99.87 | |
| d1dv8a_ | 128 | H1 subunit of the asialoglycoprotein receptor {Hum | 99.87 | |
| d1egga_ | 136 | Macrophage mannose receptor, CRD4 {Human (Homo sap | 99.87 | |
| d1oz7b_ | 123 | Snake coagglutinin beta chain {Saw-scaled viper (E | 99.87 | |
| d1umra_ | 135 | Snake coagglutinin alpha chain {South american rat | 99.87 | |
| d2afpa_ | 129 | Type II antifreeze protein {Sea raven (Hemitripter | 99.87 | |
| d1j34a_ | 129 | Snake coagglutinin alpha chain {Habu snake (Trimer | 99.87 | |
| d1c3ab_ | 125 | Snake coagglutinin beta chain {Habu snake (Trimere | 99.87 | |
| d1fvub_ | 125 | Snake coagglutinin beta chain {Jararaca (Bothrops | 99.87 | |
| d1ypqa1 | 131 | Oxidised low density lipoprotein {Human (Homo sapi | 99.87 | |
| d1jwib_ | 123 | Snake coagglutinin beta chain {Puff adder (Bitis a | 99.86 | |
| d1v7pb_ | 127 | Snake coagglutinin beta chain {Snake (Echis multis | 99.86 | |
| d1hq8a_ | 123 | NK cell-activating receptor nkg2d {Mouse (Mus musc | 99.86 | |
| d1fvua_ | 133 | Snake coagglutinin alpha chain {Jararaca (Bothrops | 99.86 | |
| d1j34b_ | 123 | Snake coagglutinin beta chain {Habu snake (Trimere | 99.86 | |
| d1sb2b1 | 127 | Snake coagglutinin beta chain {Malayan pit viper ( | 99.86 | |
| d1t8da1 | 143 | Low affinity immunoglobulin epsilon Fc receptor {H | 99.86 | |
| d1qo3c_ | 133 | NK cell receptor {Mouse (Mus musculus), ly49-a [Ta | 99.85 | |
| d3c8ja1 | 122 | NK cell receptor {Mouse (Mus musculus), ly49-c [Ta | 99.85 | |
| d1uv0a_ | 140 | Pancreatitis-associated protein 1 {Human (Homo sap | 99.85 | |
| d1g1ta1 | 118 | E-selectin, C-lectin domain {Human (Homo sapiens) | 99.85 | |
| d1wk1a_ | 150 | Hypothetical protein F28B4.3 {Caenorhabditis elega | 99.85 | |
| d3bdwa1 | 121 | CD94 {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1g1sa1 | 118 | P-selectin, C-lectin domain {Human (Homo sapiens) | 99.84 | |
| d1e87a_ | 117 | CD69 {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1sb2a1 | 132 | Snake coagglutinin alpha chain {Malayan pit viper | 99.84 | |
| d1oz7a_ | 131 | Snake coagglutinin alpha chain {Saw-scaled viper ( | 99.83 | |
| d1byfa_ | 123 | Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) | 99.81 | |
| d1kg0c_ | 136 | EBV gp42 {Epstein-Barr virus [TaxId: 10376]} | 99.71 | |
| d2pf5a1 | 95 | TSG-6, Link module {Human (Homo sapiens) [TaxId: 9 | 91.63 | |
| d1uuha_ | 150 | CD44, hyaluronan binding domain {Human (Homo sapie | 83.06 |
| >d2msba_ d.169.1.1 (A:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: C-type lectin-like superfamily: C-type lectin-like family: C-type lectin domain domain: Mannose-binding protein A, C-lectin domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.91 E-value=8.5e-25 Score=159.12 Aligned_cols=94 Identities=13% Similarity=0.356 Sum_probs=82.6
Q ss_pred CcccCHHHHHHHHHHCCCeEeEecCHHHHHHHHHHHHcCCCCcEEEceeeCCCCCCCCCCCCCCCCCceEEccCCCcccc
Q psy4323 54 SLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGP 133 (191)
Q Consensus 54 ~~~~sW~~A~~~C~~~gg~LasI~s~~E~~~i~~~l~~~~~~~~WIGl~~~~~~gc~~~~~~~~~~~~w~W~~dGs~~~~ 133 (191)
.++++|.+|+.+|+++||+||+|+|++|++||.+++. ..+||||++...+| .|.|+ ||+++
T Consensus 8 ~~~~tw~~A~~~C~~~g~~La~i~s~~e~~~l~~~~~----~~~WiGl~~~~~~g------------~~~w~-dg~~~-- 68 (112)
T d2msba_ 8 HERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAK----TSAFLGITDEVTEG------------QFMYV-TGGRL-- 68 (112)
T ss_dssp EEEECHHHHHHHHHHTTCEECCCSSHHHHHHHHHHHS----SCEEEEEECSSSTT------------CCEET-TSSBC--
T ss_pred CcEeCHHHHHHHHHhCCCEEeeEcCHHHhhhhhhccc----ceEEEEEeecCccc------------ccccc-ccccc--
Confidence 4789999999999999999999999999999999875 36999999887766 99998 99998
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCccCCC-----------cCcCCCCCcceEEeec
Q psy4323 134 TTQRNTGDWSATGGFGQAQPDNREAAQ-----------HDVACHHLKPFVCEDS 176 (191)
Q Consensus 134 ~~~~~y~nW~~~~~~~~~qP~~~~~~~-----------~d~~C~~~~~FICe~~ 176 (191)
.|.+|.+ +||++....+ .|.+|+.+++||||+|
T Consensus 69 ----~y~~W~~------~eP~~~~~~~~Cv~~~~~~~W~~~~C~~~~~fICe~P 112 (112)
T d2msba_ 69 ----TYSNWKK------DEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCEFP 112 (112)
T ss_dssp ----CSCCBCT------TCCCCCTTCCCEEEECTTSCEEEECTTSCEEEEEEEC
T ss_pred ----ccccccc------CCCCCCCCCCCEEEEeCCCEEEEeCCCCcEEEEEecC
Confidence 5679999 8998654332 8899999999999986
|
| >d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qdda_ d.169.1.1 (A:) Lithostathine, inhibitor of stone formation {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r13a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz2a_ d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v7pa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} | Back information, alignment and structure |
|---|
| >d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jwia_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} | Back information, alignment and structure |
|---|
| >d1c3aa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} | Back information, alignment and structure |
|---|
| >d1jzna_ d.169.1.1 (A:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]} | Back information, alignment and structure |
|---|
| >d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1umrc_ d.169.1.1 (C:) Snake coagglutinin beta chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} | Back information, alignment and structure |
|---|
| >d1dv8a_ d.169.1.1 (A:) H1 subunit of the asialoglycoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oz7b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} | Back information, alignment and structure |
|---|
| >d1umra_ d.169.1.1 (A:) Snake coagglutinin alpha chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} | Back information, alignment and structure |
|---|
| >d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus) [TaxId: 8094]} | Back information, alignment and structure |
|---|
| >d1j34a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} | Back information, alignment and structure |
|---|
| >d1c3ab_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} | Back information, alignment and structure |
|---|
| >d1fvub_ d.169.1.1 (B:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} | Back information, alignment and structure |
|---|
| >d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwib_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} | Back information, alignment and structure |
|---|
| >d1v7pb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} | Back information, alignment and structure |
|---|
| >d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} | Back information, alignment and structure |
|---|
| >d1j34b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} | Back information, alignment and structure |
|---|
| >d1sb2b1 d.169.1.1 (B:2-128) Snake coagglutinin beta chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1t8da1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3c8ja1 d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d3bdwa1 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa1 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sb2a1 d.169.1.1 (A:1-132) Snake coagglutinin alpha chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1oz7a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} | Back information, alignment and structure |
|---|
| >d1byfa_ d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]} | Back information, alignment and structure |
|---|
| >d1kg0c_ d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId: 10376]} | Back information, alignment and structure |
|---|
| >d2pf5a1 d.169.1.4 (A:1-95) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uuha_ d.169.1.4 (A:) CD44, hyaluronan binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|