Psyllid ID: psy4323


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
VRHSTYRDARGVTHSYFFSWEHAPTRRVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQHDVACHHLKPFVCEDSDELLNFVRSRNPGIR
ccccccccccccEEEEEEcccccccccccccccccccccccEEEEcccccccccccccHHHHHHHHHHccccEEEEccHHHHHHHHHHHHccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccEEEcccHHHHHHHHHcccccc
cccccccccccccccEEEEccccccccEEEEEcccccccccEEEEcccccccccccccHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEccccccccccEEEcccHHHHHHHHHcccccc
vrhstyrdargvthsyffswehaptrrvrhstyrdargvthsyffswehaptrslevdWLDARNICRRHCmdavsletpqeneFVKQRITRGNVRYIWTsgrkcnfngcdrpdlqpanvngwfwsgsgakigpttqrntgdwsatggfgqaqpdnreaaqhdvachhlkpfvcedsDELLNFVRSRNPGIR
vrhstyrdargvthsyffswehaptrrvrHSTYRDARGVTHSyffswehaptrSLEVDWLDARNICRRHCMDavsletpqenefvkqritrgnvRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQHDVACHHLKpfvcedsdellnfvrsrnpgir
VRHSTYRDARGVTHSYFFSWEHAPTRRVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQHDVACHHLKPFVCEDSDELLNFVRSRNPGIR
*********RGVTHSYFFSWEHAPTRRVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKI******************************DVACHHLKPFVCEDSDELLNF*********
*****Y**ARGVTHSYFFSWEHAPTRRVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQHDVACHHLKPFVCEDSDELLNFVRSRN****
VRHSTYRDARGVTHSYFFSWEHAPTRRVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQHDVACHHLKPFVCEDSDELLNFVRSRNPGIR
***********VTHSYFFSWEHAPTRRVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSAT*GFGQAQPDNREAAQHDVACHHLKPFVCEDSDELLNFVRSRN****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRHSTYRDARGVTHSYFFSWEHAPTRRVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQHDVACHHLKPFVCEDSDELLNFVRSRNPGIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
242007933 450 conserved hypothetical protein [Pediculu 0.863 0.366 0.832 9e-87
240848649217 C-type lectin-like precursor [Acyrthosip 0.874 0.769 0.823 2e-85
347973243219 AGAP010196-PA [Anopheles gambiae str. PE 0.863 0.753 0.827 5e-85
357617272271 C-type lectin 4 [Danaus plexippus] 0.863 0.608 0.816 7e-85
380017281219 PREDICTED: uncharacterized protein LOC10 0.863 0.753 0.827 8e-85
284813583221 C-type lectin 4 precursor [Bombyx mori] 0.863 0.746 0.837 8e-85
290578550217 conserved hypothetical protein [Apis mel 0.863 0.760 0.827 1e-84
339717139217 C-type lectin 5 precursor [Apis mellifer 0.863 0.760 0.827 1e-84
340729763217 PREDICTED: l-selectin-like [Bombus terre 0.863 0.760 0.816 3e-84
332029555216 hypothetical protein G5I_01734 [Acromyrm 0.863 0.763 0.816 4e-84
>gi|242007933|ref|XP_002424769.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508292|gb|EEB12031.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  324 bits (831), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 160/185 (86%), Gaps = 20/185 (10%)

Query: 27  RVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVK 86
           RVRHSTYRDARGV H+YFFSWEH PTR+LEVDWLDARNICRRHCMDAVSLETPQENEFVK
Sbjct: 265 RVRHSTYRDARGVAHAYFFSWEHGPTRNLEVDWLDARNICRRHCMDAVSLETPQENEFVK 324

Query: 87  QRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATG 146
           QRI RG VRYIWTSGRKCNFNGCDRPDLQP N+NGWFWSGSGAKIGPTTQRNTGDWS+TG
Sbjct: 325 QRIARGGVRYIWTSGRKCNFNGCDRPDLQPPNINGWFWSGSGAKIGPTTQRNTGDWSSTG 384

Query: 147 GFGQAQPDNREAAQ--------------------HDVACHHLKPFVCEDSDELLNFVRSR 186
           G+GQAQPDNREAAQ                    HDVACHH+KPFVCEDSDELLNFVRSR
Sbjct: 385 GYGQAQPDNREAAQGNDESCLSILNNFYNDGIKWHDVACHHVKPFVCEDSDELLNFVRSR 444

Query: 187 NPGIR 191
           NPGIR
Sbjct: 445 NPGIR 449




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|240848649|ref|NP_001155798.1| C-type lectin-like precursor [Acyrthosiphon pisum] gi|239788217|dbj|BAH70797.1| ACYPI009411 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|347973243|ref|XP_319374.4| AGAP010196-PA [Anopheles gambiae str. PEST] gi|333469652|gb|EAA13809.5| AGAP010196-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|357617272|gb|EHJ70690.1| C-type lectin 4 [Danaus plexippus] Back     alignment and taxonomy information
>gi|380017281|ref|XP_003692588.1| PREDICTED: uncharacterized protein LOC100869862 [Apis florea] Back     alignment and taxonomy information
>gi|284813583|ref|NP_001165397.1| C-type lectin 4 precursor [Bombyx mori] gi|283139166|gb|ADB12588.1| C-type lectin 11 [Bombyx mori] Back     alignment and taxonomy information
>gi|290578550|gb|ADD51171.1| conserved hypothetical protein [Apis mellifera] Back     alignment and taxonomy information
>gi|339717139|ref|NP_001229926.1| C-type lectin 5 precursor [Apis mellifera] Back     alignment and taxonomy information
>gi|340729763|ref|XP_003403165.1| PREDICTED: l-selectin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|332029555|gb|EGI69444.1| hypothetical protein G5I_01734 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
FB|FBgn0031918219 CG6055 [Drosophila melanogaste 0.727 0.634 0.878 2.8e-84
FB|FBgn0038017220 CG4115 [Drosophila melanogaste 0.691 0.6 0.595 2.9e-54
FB|FBgn0031629231 Clect27 "C-type lectin 27kD" [ 0.591 0.489 0.470 4.6e-25
FB|FBgn0259958175 Sfp24F "Seminal fluid protein 0.591 0.645 0.267 0.00064
FB|FBgn0031918 CG6055 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 698 (250.8 bits), Expect = 2.8e-84, Sum P(2) = 2.8e-84
 Identities = 123/140 (87%), Positives = 132/140 (94%)

Query:    27 RVRHSTYRDARGVTHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVK 86
             RVRH++YRDARGV+HSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQEN+FVK
Sbjct:    34 RVRHASYRDARGVSHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENDFVK 93

Query:    87 QRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATG 146
             QRI RGNVRYIWTSGRKCNF GCDRPDLQP N NGWFWSGSGAKIGPT+QRNTGDWS+TG
Sbjct:    94 QRIARGNVRYIWTSGRKCNFAGCDRPDLQPPNENGWFWSGSGAKIGPTSQRNTGDWSSTG 153

Query:   147 GFGQAQPDNREAAQ-HDVAC 165
             G+ Q QPDNREAAQ +D +C
Sbjct:   154 GYQQPQPDNREAAQGNDESC 173


GO:0030246 "carbohydrate binding" evidence=ISS
FB|FBgn0038017 CG4115 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031629 Clect27 "C-type lectin 27kD" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0259958 Sfp24F "Seminal fluid protein 24F" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
cd00037116 cd00037, CLECT, C-type lectin (CTL)/C-type lectin- 3e-08
pfam00059108 pfam00059, Lectin_C, Lectin C-type domain 5e-07
smart00034124 smart00034, CLECT, C-type lectin (CTL) or carbohyd 2e-04
cd03602108 cd03602, CLECT_1, C-type lectin (CTL)/C-type lecti 0.003
>gnl|CDD|153057 cd00037, CLECT, C-type lectin (CTL)/C-type lectin-like (CTLD) domain Back     alignment and domain information
 Score = 49.9 bits (119), Expect = 3e-08
 Identities = 24/120 (20%), Positives = 47/120 (39%), Gaps = 14/120 (11%)

Query: 56  EVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQ 115
           ++ W +A+  CR       S+ + +EN+F+   + + +   +W      +  G       
Sbjct: 9   KLTWEEAQEYCRSLGGHLASIHSEEENDFLASLLKKSSSSDVWIGLNDLSSEG------- 61

Query: 116 PANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQ-HDVACHHLKPFVCE 174
                 W WS  G+ +   T    G+ +  G        +    + +DV+C    PF+CE
Sbjct: 62  -----TWKWS-DGSPLVDYTNWAPGEPNPGGSEDCVVLSSSSDGKWNDVSCSSKLPFICE 115


CLECT: C-type lectin (CTL)/C-type lectin-like (CTLD) domain; protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins. This group is chiefly comprised of eukaryotic CTLDs, but contains some, as yet functionally uncharacterized, bacterial CTLDs. Many CTLDs are calcium-dependent carbohydrate binding modules; other CTLDs bind protein ligands, lipids, and inorganic surfaces, including CaCO3 and ice. Animal C-type lectins are involved in such functions as extracellular matrix organization, endocytosis, complement activation, pathogen recognition, and cell-cell interactions. For example: mannose-binding lectin and lung surfactant proteins A and D bind carbohydrates on surfaces (e.g. pathogens, allergens, necrotic, and apoptotic cells) and mediate functions associated with killing and phagocytosis; P (platlet)-, E (endothelial)-, and L (leukocyte)- selectins (sels) mediate the initial attachment, tethering, and rolling of lymphocytes on inflamed vascular walls enabling subsequent lymphocyte adhesion and transmigration. CTLDs may bind a variety of carbohydrate ligands including mannose, N-acetylglucosamine, galactose, N-acetylgalactosamine, and fucose. Several CTLDs bind to protein ligands, and only some of these binding interactions are Ca2+-dependent; including the CTLDs of Coagulation Factors IX/X (IX/X) and Von Willebrand Factor (VWF) binding proteins, and natural killer cell receptors. C-type lectins, such as lithostathine, and some type II antifreeze glycoproteins function in a Ca2+-independent manner to bind inorganic surfaces. Many proteins in this group contain a single CTLD; these CTLDs associate with each other through several different surfaces to form dimers, trimers, or tetramers, from which ligand-binding sites project in different orientations. Various vertebrate type 1 transmembrane proteins including macrophage mannose receptor, endo180, phospholipase A2 receptor, and dendritic and epithelial cell receptor (DEC205) have extracellular domains containing 8 or more CTLDs; these CTLDs remain in the parent model. In some members (IX/X and VWF binding proteins), a loop extends to the adjoining domain to form a loop-swapped dimer. A similar conformation is seen in the macrophage mannose receptor CRD4's putative non-sugar bound form of the domain in the acid environment of the endosome. Lineage specific expansions of CTLDs have occurred in several animal lineages including Drosophila melanogaster and Caenorhabditis elegans; these CTLDs also remain in the parent model. Length = 116

>gnl|CDD|215684 pfam00059, Lectin_C, Lectin C-type domain Back     alignment and domain information
>gnl|CDD|214480 smart00034, CLECT, C-type lectin (CTL) or carbohydrate-recognition domain (CRD) Back     alignment and domain information
>gnl|CDD|153072 cd03602, CLECT_1, C-type lectin (CTL)/C-type lectin-like (CTLD) domain subgroup 1; a subgroup of protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
cd03591114 CLECT_collectin_like C-type lectin-like domain (CT 99.9
cd03598117 CLECT_EMBP_like C-type lectin-like domain (CTLD) o 99.9
cd03603118 CLECT_VCBS A bacterial subgroup of the C-type lect 99.9
cd03592115 CLECT_selectins_like C-type lectin-like domain (CT 99.9
cd03596129 CLECT_tetranectin_like C-type lectin-like domain ( 99.89
cd03601119 CLECT_TC14_like C-type lectin-like domain (CTLD) o 99.89
cd03588124 CLECT_CSPGs C-type lectin-like domain (CTLD) of th 99.89
cd03597129 CLECT_attractin_like C-type lectin-like domain (CT 99.88
cd03589137 CLECT_CEL-1_like C-type lectin-like domain (CTLD) 99.88
cd03590126 CLECT_DC-SIGN_like C-type lectin-like domain (CTLD 99.87
cd03602108 CLECT_1 C-type lectin (CTL)/C-type lectin-like (CT 99.87
cd03594129 CLECT_REG-1_like C-type lectin-like domain (CTLD) 99.86
cd03599153 CLECT_DGCR2_like C-type lectin-like domain (CTLD) 99.86
cd03593116 CLECT_NK_receptors_like C-type lectin-like domain 99.85
cd03595149 CLECT_chondrolectin_like C-type lectin-like domain 99.84
cd03600141 CLECT_thrombomodulin_like C-type lectin-like domai 99.82
smart00034126 CLECT C-type lectin (CTL) or carbohydrate-recognit 99.79
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 99.78
PHA02642216 C-type lectin-like protein; Provisional 99.78
PHA02953170 IEV and EEV membrane glycoprotein; Provisional 99.73
PHA03097157 C-type lectin-like protein; Provisional 99.7
cd00037116 CLECT C-type lectin (CTL)/C-type lectin-like (CTLD 99.67
PF00059105 Lectin_C: Lectin C-type domain; InterPro: IPR00130 99.67
PHA02867167 C-type lectin protein; Provisional 99.53
PHA02911213 C-type lectin-like protein; Provisional 99.2
PF05473200 Herpes_UL45: UL45 protein; InterPro: IPR008646 Thi 97.7
cd0351991 Link_domain_HAPLN_module_2 Link_domain_HAPLN_modul 94.09
cd0110292 Link_Domain The link domain is a hyaluronan (HA)-b 91.59
cd0352096 Link_domain_CSPGs_modules_2_4 Link_domain_CSPGs_mo 91.54
smart0044594 LINK Link (Hyaluronan-binding). 91.12
cd0351895 Link_domain_HAPLN_module_1 Link_domain_HAPLN_modul 90.21
cd0352195 Link_domain_KIAA0527_like Link_domain_KIAA0527_lik 90.13
PF0019392 Xlink: Extracellular link domain; InterPro: IPR000 89.96
cd0351593 Link_domain_TSG_6_like This is the extracellular l 89.66
PHA03093185 EEV glycoprotein; Provisional 88.81
cd0351795 Link_domain_CSPGs_modules_1_3 Link_domain_CSPGs_mo 88.72
PHA02673161 ORF109 EEV glycoprotein; Provisional 87.17
KOG4297|consensus207 85.37
cd03516144 Link_domain_CD44_like This domain is a hyaluronan 84.29
>cd03591 CLECT_collectin_like C-type lectin-like domain (CTLD) of the type found in human collectins including lung surfactant proteins A and D, mannose- or mannan binding lectin (MBL), and CL-L1 (collectin liver 1) Back     alignment and domain information
Probab=99.90  E-value=1.4e-23  Score=155.54  Aligned_cols=96  Identities=21%  Similarity=0.434  Sum_probs=84.0

Q ss_pred             CcccCHHHHHHHHHHCCCeEeEecCHHHHHHHHHHHHcCCCCcEEEceeeCCCCCCCCCCCCCCCCCceEEccCCCcccc
Q psy4323          54 SLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGP  133 (191)
Q Consensus        54 ~~~~sW~~A~~~C~~~gg~LasI~s~~E~~~i~~~l~~~~~~~~WIGl~~~~~~gc~~~~~~~~~~~~w~W~~dGs~~~~  133 (191)
                      .++++|.+|+.+|+.+||+||+|+|++|+++|..++.+ ....+||||++...++            .|.|+ ||+++  
T Consensus         8 ~~~~~w~~A~~~C~~~g~~La~i~s~~e~~~l~~~~~~-~~~~~WiGl~~~~~~~------------~~~w~-dg~~~--   71 (114)
T cd03591           8 GEEKNFDDAQKLCSEAGGTLAMPRNAAENAAIASYVKK-GNTYAFIGITDLETEG------------QFVYL-DGGPL--   71 (114)
T ss_pred             CceeCHHHHHHHHhhcCCEEecCCCHHHHHHHHHHHhc-CCccEEEecccCCcCC------------cEEeC-CCCCc--
Confidence            57899999999999999999999999999999999986 3457999999987766            99997 99998  


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCccCCC-----------cCcCCCCCcceEEee
Q psy4323         134 TTQRNTGDWSATGGFGQAQPDNREAAQ-----------HDVACHHLKPFVCED  175 (191)
Q Consensus       134 ~~~~~y~nW~~~~~~~~~qP~~~~~~~-----------~d~~C~~~~~FICe~  175 (191)
                          .|.+|.+      ++|++....+           .|.+|+.+++||||+
T Consensus        72 ----~y~~W~~------~ep~~~~~~~~Cv~~~~~~~W~~~~C~~~~~fICe~  114 (114)
T cd03591          72 ----TYTNWKP------GEPNNAGGGEDCVEMYTSGKWNDVACNLTRLFVCEF  114 (114)
T ss_pred             ----ccCCcCC------CCCCCCCCCCCeEEECCCCcCcCccCCCCeeEEeeC
Confidence                5779999      8898654211           789999999999985



CLECT_collectin_like: C-type lectin-like domain (CTLD) of the type found in human collectins including lung surfactant proteins A and D, mannose- or mannan binding lectin (MBL), and CL-L1 (collectin liver 1). CTLD refers to a domain homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins. The CTLDs of these collectins bind carbohydrates on surfaces (e.g. pathogens, allergens, necrotic, or apoptotic cells) and mediate functions associated with killing and phagocytosis. MBPs recognize high mannose oligosaccharides in a calcium dependent manner, bind to a broad range of pathogens, and trigger cell killing by activating the complement pathway. MBP also acts directly as an opsonin. SP-A and SP-D in addition to functioning as host defense components, a

>cd03598 CLECT_EMBP_like C-type lectin-like domain (CTLD) of the type found in the human proteins, eosinophil major basic protein (EMBP) and prepro major basic protein homolog (MBPH) Back     alignment and domain information
>cd03603 CLECT_VCBS A bacterial subgroup of the C-type lectin-like (CTLD) domain; a subgroup of bacterial protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins Back     alignment and domain information
>cd03592 CLECT_selectins_like C-type lectin-like domain (CTLD) of the type found in the type 1 transmembrane proteins: P(platlet)-, E(endothelial)-, and L(leukocyte)- selectins (sels) Back     alignment and domain information
>cd03596 CLECT_tetranectin_like C-type lectin-like domain (CTLD) of the type found in the tetranectin (TN), cartilage derived C-type lectin (CLECSF1), and stem cell growth factor (SCGF) Back     alignment and domain information
>cd03601 CLECT_TC14_like C-type lectin-like domain (CTLD) of the type found in lectins TC14, TC14-2, TC14-3, and TC14-4 from the budding tunicate Polyandrocarpa misakiensis and PfG6 from the Acorn worm Back     alignment and domain information
>cd03588 CLECT_CSPGs C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins Back     alignment and domain information
>cd03597 CLECT_attractin_like C-type lectin-like domain (CTLD) of the type found in human and mouse attractin (AtrN) and attractin-like protein (ALP) Back     alignment and domain information
>cd03589 CLECT_CEL-1_like C-type lectin-like domain (CTLD) of the type found in CEL-1 from Cucumaria echinata and Echinoidin from Anthocidaris crassispina Back     alignment and domain information
>cd03590 CLECT_DC-SIGN_like C-type lectin-like domain (CTLD) of the type found in human dendritic cell (DC)-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) and the related receptor, DC-SIGN receptor (DC-SIGNR) Back     alignment and domain information
>cd03602 CLECT_1 C-type lectin (CTL)/C-type lectin-like (CTLD) domain subgroup 1; a subgroup of protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins Back     alignment and domain information
>cd03594 CLECT_REG-1_like C-type lectin-like domain (CTLD) of the type found in Human REG-1 (lithostathine), REG-4, and avian eggshell-specific proteins: ansocalcin, structhiocalcin-1(SCA-1), and -2(SCA-2) Back     alignment and domain information
>cd03599 CLECT_DGCR2_like C-type lectin-like domain (CTLD) of the type found in DGCR2, an integral membrane protein deleted in DiGeorge Syndrome (DGS) Back     alignment and domain information
>cd03593 CLECT_NK_receptors_like C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs) Back     alignment and domain information
>cd03595 CLECT_chondrolectin_like C-type lectin-like domain (CTLD) of the type found in the human type-1A transmembrane proteins chondrolectin (CHODL) and layilin Back     alignment and domain information
>cd03600 CLECT_thrombomodulin_like C-type lectin-like domain (CTLD) of the type found in human thrombomodulin(TM), Endosialin, C14orf27, and C1qR Back     alignment and domain information
>smart00034 CLECT C-type lectin (CTL) or carbohydrate-recognition domain (CRD) Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PHA02642 C-type lectin-like protein; Provisional Back     alignment and domain information
>PHA02953 IEV and EEV membrane glycoprotein; Provisional Back     alignment and domain information
>PHA03097 C-type lectin-like protein; Provisional Back     alignment and domain information
>cd00037 CLECT C-type lectin (CTL)/C-type lectin-like (CTLD) domain Back     alignment and domain information
>PF00059 Lectin_C: Lectin C-type domain; InterPro: IPR001304 Lectins occur in plants, animals, bacteria and viruses Back     alignment and domain information
>PHA02867 C-type lectin protein; Provisional Back     alignment and domain information
>PHA02911 C-type lectin-like protein; Provisional Back     alignment and domain information
>PF05473 Herpes_UL45: UL45 protein; InterPro: IPR008646 This family consists several UL45 proteins and homologues found in the herpes simplex virus family Back     alignment and domain information
>cd03519 Link_domain_HAPLN_module_2 Link_domain_HAPLN_module_2; this link domain is found in the second link module of proteins similar to the vertebrate HAPLN (hyaluronan/HA and proteoglycan binding link) protein family which includes cartilage link protein Back     alignment and domain information
>cd01102 Link_Domain The link domain is a hyaluronan (HA)-binding domain Back     alignment and domain information
>cd03520 Link_domain_CSPGs_modules_2_4 Link_domain_CSPGs_modules_2_4; this link domain is found in the second and fourth link modules of the chondroitin sulfate proteoglycan core protein (CSPG) aggrecan and, in the second link module of three other CSPGs: versican, neurocan, and brevican Back     alignment and domain information
>smart00445 LINK Link (Hyaluronan-binding) Back     alignment and domain information
>cd03518 Link_domain_HAPLN_module_1 Link_domain_HAPLN_module_1; this link domain is found in the first link module of proteins similar to the vertebrate HAPLN (hyaluronan/HA and proteoglycan binding link) protein family which includes cartilage link protein Back     alignment and domain information
>cd03521 Link_domain_KIAA0527_like Link_domain_KIAA0527_like; this domain is found in the human protein KIAA0527 Back     alignment and domain information
>PF00193 Xlink: Extracellular link domain; InterPro: IPR000538 The link domain [] is a hyaluronan(HA)-binding region found in proteins of vertebrates that are involved in the assembly of extracellular matrix, cell adhesion, and migration Back     alignment and domain information
>cd03515 Link_domain_TSG_6_like This is the extracellular link domain of the type found in human TSG-6 Back     alignment and domain information
>PHA03093 EEV glycoprotein; Provisional Back     alignment and domain information
>cd03517 Link_domain_CSPGs_modules_1_3 Link_domain_CSPGs_modules_1_3; this extracellular link domain is found in the first and third link modules of the chondroitin sulfate proteoglycan core protein (CSPG) aggrecan Back     alignment and domain information
>PHA02673 ORF109 EEV glycoprotein; Provisional Back     alignment and domain information
>KOG4297|consensus Back     alignment and domain information
>cd03516 Link_domain_CD44_like This domain is a hyaluronan (HA)-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 4e-06
1egg_A147 Macrophage mannose receptor; C-type lectin, sugar 5e-06
1pwb_A177 SP-D, PSP-D, pulmonary surfactant-associated prote 8e-06
2ox9_A140 Collectin placenta 1; C-type lectin, sugar binding 8e-06
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 1e-05
2vuv_A129 Codakine; sugar-binding protein, C-type, lectin, m 2e-05
1ukm_A134 EMS16 A chain, EMS16 subunit A; domain swapping, C 2e-05
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 2e-05
3kqg_A182 Langerin, C-type lectin domain family 4 member K; 5e-05
3c22_A156 C-type lectin domain family 4 member K; coiled coi 1e-04
1j34_A129 Coagulation factor IX-binding protein A chain; mag 1e-04
1jzn_A135 Galactose-specific lectin; C-type lectin, protein- 1e-04
1h8u_A117 MBP, eosinophil granule major basic protein 1; lec 1e-04
1jwi_A131 Bitiscetin; domain swapping, C-type lectin, toxin; 2e-04
1oz7_A131 Echicetin A-chain; platelet aggregation, dimer, to 3e-04
1sl6_A184 C-type lectin DC-signr; sugar binding protein; HET 3e-04
1byf_A125 TC14, protein (polyandrocarpa lectin); C-type lect 4e-04
2b6b_D175 CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe 5e-04
2py2_A136 Antifreeze protein type II; type II antifreeze pro 5e-04
3gpr_C134 Rhodocetin subunit gamma; disulfide bond, lectin, 5e-04
1umr_A135 Convulxin alpha, CVX alpha; lectin, C-type lectin, 5e-04
2h2t_B175 Low affinity immunoglobulin epsilon FC receptor ( 6e-04
2xr6_A170 CD209 antigen; sugar binding protein, carbohydrate 6e-04
1rdl_1113 SUB-MBP-C, mannose-binding protein-C; C-type lecti 9e-04
1hup_A141 Mannose-binding protein; alpha-helical coiled-coil 9e-04
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Length = 164 Back     alignment and structure
 Score = 44.0 bits (104), Expect = 4e-06
 Identities = 29/148 (19%), Positives = 51/148 (34%), Gaps = 48/148 (32%)

Query: 43  YFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGR 102
           Y +S +        ++W  AR  CR +  D V+++   E E++++ +      Y W   R
Sbjct: 3   YHYSEK-------PMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYY-WIGIR 54

Query: 103 KCNFNGCDRPDLQPANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQH- 161
           K                  W W G+      +      +W   G     +P+N++  +  
Sbjct: 55  KIG--------------GIWTWVGT----NKSLTEEAENW-GDG-----EPNNKKNKEDC 90

Query: 162 ---------------DVACHHLKPFVCE 174
                          D ACH LK  +C 
Sbjct: 91  VEIYIKRNKDAGKWNDDACHKLKAALCY 118


>1egg_A Macrophage mannose receptor; C-type lectin, sugar binding protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1egi_A Length = 147 Back     alignment and structure
>1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... Length = 177 Back     alignment and structure
>2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A Length = 140 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* Length = 129 Back     alignment and structure
>1ukm_A EMS16 A chain, EMS16 subunit A; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_A* Length = 134 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} Length = 182 Back     alignment and structure
>3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* Length = 156 Back     alignment and structure
>1j34_A Coagulation factor IX-binding protein A chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_A* 1j35_A* 1x2t_A* 1x2w_A 1ixx_A 1y17_A 1wt9_A 1iod_A* Length = 129 Back     alignment and structure
>1jzn_A Galactose-specific lectin; C-type lectin, protein-disaccharide complex, sugar binding P; HET: BGC GAL; 2.20A {Crotalus atrox} SCOP: d.169.1.1 PDB: 1muq_A* Length = 135 Back     alignment and structure
>1h8u_A MBP, eosinophil granule major basic protein 1; lectin, eosinophil granule protein, EMBP; 1.8A {Homo sapiens} SCOP: d.169.1.1 PDB: 2brs_A* Length = 117 Back     alignment and structure
>1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A Length = 131 Back     alignment and structure
>1oz7_A Echicetin A-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Length = 131 Back     alignment and structure
>1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A Length = 184 Back     alignment and structure
>1byf_A TC14, protein (polyandrocarpa lectin); C-type lectin, galactose-specific, sugar binding protein; 2.00A {Polyandrocarpa misakiensis} SCOP: d.169.1.1 PDB: 1tlg_A* Length = 125 Back     alignment and structure
>2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 Length = 175 Back     alignment and structure
>2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} Length = 136 Back     alignment and structure
>3gpr_C Rhodocetin subunit gamma; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Length = 134 Back     alignment and structure
>1umr_A Convulxin alpha, CVX alpha; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_A Length = 135 Back     alignment and structure
>2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A Length = 175 Back     alignment and structure
>2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* Length = 170 Back     alignment and structure
>1rdl_1 SUB-MBP-C, mannose-binding protein-C; C-type lectin, calcium-binding protein; HET: MMA; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1rdj_1* 1rdk_1* 1rdi_1* 1rdm_1* 1rdn_1* 1rdo_1 1bv4_A 1kza_1* 1kzb_1* 1kzc_1* 1kzd_1* 1kze_1* Length = 113 Back     alignment and structure
>1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Length = 141 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
2msb_A115 Mannose-binding protein-A; lectin; HET: BMA MAN; 1 99.91
1rdl_1113 SUB-MBP-C, mannose-binding protein-C; C-type lecti 99.91
1h8u_A117 MBP, eosinophil granule major basic protein 1; lec 99.9
2py2_A136 Antifreeze protein type II; type II antifreeze pro 99.9
1ypq_A135 Oxidised low density lipoprotein (lectin-like) rec 99.9
3vpp_A132 C-type lectin domain family 9 member A; dendritic 99.9
2zib_A133 Type II antifreeze protein; thermal hysteresis, le 99.9
1qdd_A144 Lithostathine; pancreatic stone inhibitor, metal b 99.9
1tn3_A137 Tetranectin; plasminogen binding, kringle 4, C-typ 99.9
2kv3_A131 Regenerating islet-derived protein 4; GISP, C-type 99.89
1rtm_1149 Mannose-binding protein-A; lectin; 1.80A {Rattus n 99.89
1egg_A147 Macrophage mannose receptor; C-type lectin, sugar 99.89
1byf_A125 TC14, protein (polyandrocarpa lectin); C-type lect 99.89
1hup_A141 Mannose-binding protein; alpha-helical coiled-coil 99.89
2ox9_A140 Collectin placenta 1; C-type lectin, sugar binding 99.89
3kqg_A182 Langerin, C-type lectin domain family 4 member K; 99.89
3alu_A157 Lectin CEL-IV, C-type; C-type lectin, raffinose, s 99.89
3pbf_A148 Pulmonary surfactant-associated protein A; collect 99.89
1gz2_A142 Ovocleidin-17, OC-17 ovocleidin; structural protei 99.89
1tdq_B130 Aggrecan core protein; extracellular matrix, lecti 99.89
1wmz_A140 Lectin CEL-I, N-acetyl-D-galactosamine-specific C- 99.89
1jzn_A135 Galactose-specific lectin; C-type lectin, protein- 99.89
2bpd_A142 Dectin-1; receptor, beta-glucan, fungal recognitio 99.89
1buu_A168 Protein (mannose-binding protein A); lectin, HOST 99.89
3ubu_A131 Agglucetin subunit alpha-1; platelet inhibiting, a 99.89
3bx4_A136 Aggretin alpha chain; toxin; 1.70A {Agkistrodon rh 99.89
1ukm_A134 EMS16 A chain, EMS16 subunit A; domain swapping, C 99.88
3gpr_C134 Rhodocetin subunit gamma; disulfide bond, lectin, 99.88
1dv8_A128 Asialoglycoprotein receptor 1; C-type lectin CRD, 99.88
1fvu_B125 Botrocetin beta chain; VON WILLBRAND factor modula 99.88
1uv0_A149 Pancreatitis-associated protein 1; lectin, C-type, 99.88
2c6u_A122 CLEC1B protein; lectin, rhodocytin, aggretin, C-ty 99.88
1jwi_B125 Platelet aggregation inducer; domain swapping, C-t 99.88
2b6b_D175 CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe 99.88
1umr_A135 Convulxin alpha, CVX alpha; lectin, C-type lectin, 99.88
1c3a_A135 Flavocetin-A: alpha subunit; C-type lectin-like do 99.88
2vuv_A129 Codakine; sugar-binding protein, C-type, lectin, m 99.88
3g8k_A130 Lectin-related NK cell receptor LY49L1; natural ki 99.88
2yhf_A118 C-type lectin domain family 5 member A; immune sys 99.87
1sl6_A184 C-type lectin DC-signr; sugar binding protein; HET 99.87
3c22_A156 C-type lectin domain family 4 member K; coiled coi 99.87
2afp_A129 Protein (SEA raven type II antifreeze protein); re 99.87
1wk1_A150 Hypothetical protein YK1067A12; lectin C-type doma 99.87
1j34_A129 Coagulation factor IX-binding protein A chain; mag 99.87
1htn_A182 Tetranectin; plasminogen binding, kringle 4, alpha 99.87
3rs1_A122 C-type lectin domain family 2 member I; C-type lec 99.87
2xr6_A170 CD209 antigen; sugar binding protein, carbohydrate 99.87
2e3x_B134 Coagulation factor X-activating enzyme light CHAI; 99.87
1hq8_A123 NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A { 99.87
3bdw_A123 Natural killer cells antigen CD94; NK cells, recep 99.87
1sb2_B129 Rhodocetin beta subunit; C-type lectin, domain swa 99.87
2h2t_B175 Low affinity immunoglobulin epsilon FC receptor ( 99.87
1mpu_A138 NKG2-D type II integral membrane protein; C-type l 99.87
1pwb_A177 SP-D, PSP-D, pulmonary surfactant-associated prote 99.87
1jwi_A131 Bitiscetin; domain swapping, C-type lectin, toxin; 99.87
2ls8_A156 C-type lectin domain family 4 member D; structural 99.78
3ff7_C112 Killer cell lectin-like receptor subfamily G membe 99.86
1umr_C125 Convulxin beta, CVX beta; lectin, C-type lectin, p 99.85
1oz7_A131 Echicetin A-chain; platelet aggregation, dimer, to 99.85
3gpr_D124 Rhodocetin subunit delta; disulfide bond, lectin, 99.85
1oz7_B123 Echicetin B-chain; platelet aggregation, dimer, to 99.85
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 99.85
3m9z_A139 Killer cell lectin-like receptor subfamily B MEMB; 99.85
1j34_B123 Coagulation factor IX-binding protein B chain; mag 99.85
1fvu_A133 Botrocetin alpha chain; VON WILLBRAND factor modul 99.85
3ubu_B126 Agglucetin subunit beta-2; platelet inhibiting, ag 99.85
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 99.85
2e3x_C122 Coagulation factor X-activating enzyme light CHAI; 99.84
1c3a_B125 Flavocetin-A: beta subunit; C-type lectin-like dom 99.84
3bdw_B120 NKG2-A/NKG2-B type II integral membrane protein; N 99.84
3ff9_A115 Killer cell lectin-like receptor subfamily G membe 99.84
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 99.84
1ukm_B128 EMS16 B chain, EMS16 subunit B; domain swapping, C 99.84
1sb2_A133 Rhodocetin alpha subunit; C-type lectin, domain sw 99.84
3g8l_A190 Lectin-related NK cell receptor LY49L1; natural ki 99.84
3hup_A130 Early activation antigen CD69; C-type lectin-like 99.84
3bx4_B146 Aggretin beta chain; toxin; 1.70A {Agkistrodon rho 99.83
3c8j_A203 Natural killer cell receptor LY49C; MHC, virus, im 99.83
1fm5_A199 Early activation antigen CD69; C-type lectin-like 99.77
3k7b_A96 Protein A33; C-type lectin-like domain, homodimer, 98.27
1o7b_T98 Tumor necrosis factor-inducible protein TSG-6; hya 88.87
2jcq_A154 CD44 antigen; sugar-binding protein, hyauronan, LI 81.91
>2msb_A Mannose-binding protein-A; lectin; HET: BMA MAN; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1msb_A 1ytt_A* Back     alignment and structure
Probab=99.91  E-value=1.6e-24  Score=158.70  Aligned_cols=102  Identities=12%  Similarity=0.333  Sum_probs=86.6

Q ss_pred             ceeEEEeccCCCCCCcccCHHHHHHHHHHCCCeEeEecCHHHHHHHHHHHHcCCCCcEEEceeeCCCCCCCCCCCCCCCC
Q psy4323          40 THSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANV  119 (191)
Q Consensus        40 ~~~Y~fs~~~~~~~~~~~sW~~A~~~C~~~gg~LasI~s~~E~~~i~~~l~~~~~~~~WIGl~~~~~~gc~~~~~~~~~~  119 (191)
                      ++||+++       ..+++|.+|+..|+.+||+||+|+|++|++||.+++.    ..+||||++...++           
T Consensus         3 ~~Cy~~~-------~~~~~w~~A~~~C~~~g~~La~i~s~~e~~~l~~~~~----~~~WiGl~~~~~~~-----------   60 (115)
T 2msb_A            3 KKFFVTN-------HERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAK----TSAFLGITDEVTEG-----------   60 (115)
T ss_dssp             -CEEEEE-------EEEECHHHHHHHHHHTTCEECCCSSHHHHHHHHHHHS----SCEEEEEECSSSTT-----------
T ss_pred             CEEEEEe-------CCCcCHHHHHHHHHhCCCEEeccCCHHHHHHHHHhhc----CCEEEeeEcCCCCC-----------
Confidence            4568886       3689999999999999999999999999999999884    57999999887766           


Q ss_pred             CceEEccCCCccccCCCCCCCCCCCCCCCCCCCCCCccCCC-----------cCcCCCCCcceEEeecc
Q psy4323         120 NGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQ-----------HDVACHHLKPFVCEDSD  177 (191)
Q Consensus       120 ~~w~W~~dGs~~~~~~~~~y~nW~~~~~~~~~qP~~~~~~~-----------~d~~C~~~~~FICe~~~  177 (191)
                       .|+|+ ||+++      .|.+|.+      ++|++....+           +|.+|..+++||||+++
T Consensus        61 -~w~W~-dg~~~------~~~~W~~------~~P~~~~~~~~C~~~~~~g~W~~~~C~~~~~fiCe~~a  115 (115)
T 2msb_A           61 -QFMYV-TGGRL------TYSNWKK------DEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCEFPA  115 (115)
T ss_dssp             -CCEET-TSSBC------CSCCBCT------TCCCCCTTCCCEEEECTTSCEEEECTTSCEEEEEEEC-
T ss_pred             -cEEEC-CCCEe------eecCcCC------CCCCCCCCCCCeEEECCCCCEECcCCCCCeEEEEeEcC
Confidence             99997 99998      4779999      9998732211           89999999999999864



>1rdl_1 SUB-MBP-C, mannose-binding protein-C; C-type lectin, calcium-binding protein; HET: MMA; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1rdj_1* 1rdk_1* 1rdi_1* 1rdm_1* 1rdn_1* 1rdo_1 1bv4_A 1kza_1* 1kzb_1* 1kzc_1* 1kzd_1* 1kze_1* Back     alignment and structure
>1h8u_A MBP, eosinophil granule major basic protein 1; lectin, eosinophil granule protein, EMBP; 1.8A {Homo sapiens} SCOP: d.169.1.1 PDB: 2brs_A* Back     alignment and structure
>2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} Back     alignment and structure
>1ypq_A Oxidised low density lipoprotein (lectin-like) receptor 1; oxidized low density lipoprotein receptor, LOX-1, CTLD, C- type lectin like domain; 1.40A {Homo sapiens} SCOP: d.169.1.1 PDB: 1ypu_A 1yxk_A 3vlg_A 1ypo_A 1yxj_A Back     alignment and structure
>3vpp_A C-type lectin domain family 9 member A; dendritic cell, C-type lectin-like domain, membrane, immune; 1.64A {Homo sapiens} Back     alignment and structure
>2zib_A Type II antifreeze protein; thermal hysteresis, lectin; 1.34A {Brachyopsis rostratus} Back     alignment and structure
>1qdd_A Lithostathine; pancreatic stone inhibitor, metal binding protein; HET: SIA NDG GAL; 1.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1lit_A Back     alignment and structure
>1tn3_A Tetranectin; plasminogen binding, kringle 4, C-type lectin, carbohydrate recognition domain; 2.00A {Homo sapiens} SCOP: d.169.1.1 PDB: 1rjh_A 3l9j_C Back     alignment and structure
>2kv3_A Regenerating islet-derived protein 4; GISP, C-type lectin, REG IV, disulfide bond, glycoPro lectin, secreted, sugar binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rtm_1 Mannose-binding protein-A; lectin; 1.80A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 PDB: 1kwu_A* 1kwv_A* 1kwt_A* 1kwx_A* 1kwy_A* 1kx1_A* 1kww_A 1kwz_A* 1kx0_A* 3kmb_1* 1kmb_1* 2kmb_1* 4kmb_1* 1afb_1* 1afa_1* 1afd_1 1bch_1* 1bcj_1* 1fif_A 1fih_A* Back     alignment and structure
>1egg_A Macrophage mannose receptor; C-type lectin, sugar binding protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1egi_A Back     alignment and structure
>1byf_A TC14, protein (polyandrocarpa lectin); C-type lectin, galactose-specific, sugar binding protein; 2.00A {Polyandrocarpa misakiensis} SCOP: d.169.1.1 PDB: 1tlg_A* Back     alignment and structure
>1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Back     alignment and structure
>2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A Back     alignment and structure
>3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} Back     alignment and structure
>3alu_A Lectin CEL-IV, C-type; C-type lectin, raffinose, sugar binding protein; HET: RAF; 1.65A {Cucumaria echinata} PDB: 3als_A* 3alt_A* Back     alignment and structure
>3pbf_A Pulmonary surfactant-associated protein A; collectin, carbohydrate binding, lectin, mannose, sugar BIND protein; 1.80A {Rattus norvegicus} PDB: 1r14_A* 1r13_A* 3paq_A* 3par_A 3pak_A Back     alignment and structure
>1gz2_A Ovocleidin-17, OC-17 ovocleidin; structural protein, CTLD, eggshell structural protein, phosphoprotein, sugar-binding protein, glycoprotein; HET: SEP; 1.5A {Gallus gallus} SCOP: d.169.1.1 Back     alignment and structure
>1tdq_B Aggrecan core protein; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: d.169.1.1 Back     alignment and structure
>1wmz_A Lectin CEL-I, N-acetyl-D-galactosamine-specific C-type; C-type lectin, N-acetylgalactosamine, invertebrate, sugar binding protein; HET: NGA A2G; 1.70A {Cucumaria echinata} SCOP: d.169.1.1 PDB: 1wmy_A* Back     alignment and structure
>1jzn_A Galactose-specific lectin; C-type lectin, protein-disaccharide complex, sugar binding P; HET: BGC GAL; 2.20A {Crotalus atrox} SCOP: d.169.1.1 PDB: 1muq_A* Back     alignment and structure
>2bpd_A Dectin-1; receptor, beta-glucan, fungal recognition, C-type lectin-like domain, CTLD, carbohydrate; 1.5A {Mus musculus} PDB: 2bph_A 2bpe_A 2cl8_A* Back     alignment and structure
>1buu_A Protein (mannose-binding protein A); lectin, HOST defense, metalloprotein, sugar binding protein; 1.90A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 Back     alignment and structure
>3ubu_A Agglucetin subunit alpha-1; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Back     alignment and structure
>3bx4_A Aggretin alpha chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_A Back     alignment and structure
>1ukm_A EMS16 A chain, EMS16 subunit A; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_A* Back     alignment and structure
>3gpr_C Rhodocetin subunit gamma; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Back     alignment and structure
>1dv8_A Asialoglycoprotein receptor 1; C-type lectin CRD, signaling protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 Back     alignment and structure
>1fvu_B Botrocetin beta chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_C 1u0n_C 1u0o_B Back     alignment and structure
>1uv0_A Pancreatitis-associated protein 1; lectin, C-type, secreted, inflammatory response, acute phase; 1.78A {Homo sapiens} SCOP: d.169.1.1 PDB: 2go0_A Back     alignment and structure
>2c6u_A CLEC1B protein; lectin, rhodocytin, aggretin, C-type lectin-like, platelets, thrombosis; 1.6A {Homo sapiens} Back     alignment and structure
>1jwi_B Platelet aggregation inducer; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_B Back     alignment and structure
>2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 Back     alignment and structure
>1umr_A Convulxin alpha, CVX alpha; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_A Back     alignment and structure
>1c3a_A Flavocetin-A: alpha subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_A Back     alignment and structure
>2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* Back     alignment and structure
>2yhf_A C-type lectin domain family 5 member A; immune system; 1.90A {Homo sapiens} Back     alignment and structure
>1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A Back     alignment and structure
>3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* Back     alignment and structure
>2afp_A Protein (SEA raven type II antifreeze protein); recombinant SEA raven protein, solution backbone fold, C- type lectin; NMR {Hemitripterus americanus} SCOP: d.169.1.1 Back     alignment and structure
>1wk1_A Hypothetical protein YK1067A12; lectin C-type domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Caenorhabditis elegans} SCOP: d.169.1.1 Back     alignment and structure
>1j34_A Coagulation factor IX-binding protein A chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_A* 1j35_A* 1x2t_A* 1x2w_A 1ixx_A 1y17_A 1wt9_A 1iod_A* Back     alignment and structure
>1htn_A Tetranectin; plasminogen binding, kringle 4, alpha-helical coiled coil, C-type lectin, carbohydrate recognition domain; 2.80A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Back     alignment and structure
>3rs1_A C-type lectin domain family 2 member I; C-type lectin-like, ligand of NK receptor, natural killer CE receptors, surface of activated T lymphocytes; 1.94A {Mus musculus} Back     alignment and structure
>2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* Back     alignment and structure
>2e3x_B Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>1hq8_A NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A {Mus musculus} SCOP: d.169.1.1 PDB: 1jsk_A 1kcg_A* Back     alignment and structure
>3bdw_A Natural killer cells antigen CD94; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 3cdg_J 1b6e_A 3cii_G Back     alignment and structure
>1sb2_B Rhodocetin beta subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_B Back     alignment and structure
>2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A Back     alignment and structure
>1mpu_A NKG2-D type II integral membrane protein; C-type lectin-like domain, immune system; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 1hyr_B Back     alignment and structure
>1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... Back     alignment and structure
>1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A Back     alignment and structure
>2ls8_A C-type lectin domain family 4 member D; structural genomics, NEW YORK structural genomics research consortium, nysgrc, PSI-biology, immune system; NMR {Homo sapiens} Back     alignment and structure
>3ff7_C Killer cell lectin-like receptor subfamily G member 1; KLRG1-cadherin complex, calcium, cell adhesion, cell junction, cell membrane; 1.80A {Homo sapiens} SCOP: d.169.1.0 Back     alignment and structure
>1umr_C Convulxin beta, CVX beta; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_B Back     alignment and structure
>1oz7_A Echicetin A-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Back     alignment and structure
>3gpr_D Rhodocetin subunit delta; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Back     alignment and structure
>1oz7_B Echicetin B-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3m9z_A Killer cell lectin-like receptor subfamily B MEMB; C-type lectin-like domain, domain swapping, disulfide bond, transmembrane protein; 1.70A {Mus musculus} SCOP: d.169.1.0 PDB: 3t3a_A Back     alignment and structure
>1j34_B Coagulation factor IX-binding protein B chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_B 1ixx_B* 1j35_B* 1x2t_B* 1x2w_B 1wt9_B 1iod_B 1y17_B Back     alignment and structure
>1fvu_A Botrocetin alpha chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_B 1u0n_B 1u0o_A Back     alignment and structure
>3ubu_B Agglucetin subunit beta-2; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>2e3x_C Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>1c3a_B Flavocetin-A: beta subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_B Back     alignment and structure
>3bdw_B NKG2-A/NKG2-B type II integral membrane protein; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} PDB: 3cdg_K 3cii_H Back     alignment and structure
>3ff9_A Killer cell lectin-like receptor subfamily G member 1; natural killer cell receptor KLTG1, glycoprotein, membrane, phosphoprotein, signal-anchor; 1.80A {Mus musculus} SCOP: d.169.1.0 PDB: 3ff8_C Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1ukm_B EMS16 B chain, EMS16 subunit B; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_B* Back     alignment and structure
>1sb2_A Rhodocetin alpha subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_A Back     alignment and structure
>3g8l_A Lectin-related NK cell receptor LY49L1; natural killer cell receptor, immune system; 2.50A {Mus musculus} Back     alignment and structure
>3hup_A Early activation antigen CD69; C-type lectin-like domain, disulfide bond, glycoprotein, LEC membrane, phosphoprotein, signal-anchor, transmembrane; 1.37A {Homo sapiens} SCOP: d.169.1.1 PDB: 1e87_A 1e8i_A 3cck_A Back     alignment and structure
>3bx4_B Aggretin beta chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_B Back     alignment and structure
>3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D Back     alignment and structure
>1fm5_A Early activation antigen CD69; C-type lectin-like domain, natural killer cell receptor, lectin, C-type lectin, immune system; 2.27A {Homo sapiens} SCOP: d.169.1.1 Back     alignment and structure
>3k7b_A Protein A33; C-type lectin-like domain, homodimer, poxvirus, EEV, EV, VIR protein; 2.10A {Vaccinia virus WR} Back     alignment and structure
>1o7b_T Tumor necrosis factor-inducible protein TSG-6; hyaluronan-binding domain, carbohydrate-binding domain, LINK module, cell adhesion, glycoprotein; NMR {Homo sapiens} SCOP: d.169.1.4 PDB: 1o7c_T 2pf5_A* Back     alignment and structure
>2jcq_A CD44 antigen; sugar-binding protein, hyauronan, LINK-domain, proteoglycan, polymorphism, blood group antigen, alternative splicing, lectin; HET: NAG GCU 5AX GOL; 1.25A {Mus musculus} PDB: 2jcr_A* 2jcp_A 2i83_A 1poz_A 1uuh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1wk1a_150 d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caeno 3e-06
d1byfa_123 d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocar 2e-04
d1hupa1117 d.169.1.1 (A:112-228) Mannose-binding protein A, C 7e-04
d1h8ua_115 d.169.1.1 (A:) Eosinophil major basic protein {Hum 9e-04
>d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 150 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: C-type lectin-like
superfamily: C-type lectin-like
family: C-type lectin domain
domain: Hypothetical protein F28B4.3
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 43.1 bits (100), Expect = 3e-06
 Identities = 16/119 (13%), Positives = 28/119 (23%), Gaps = 7/119 (5%)

Query: 56  EVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQ 115
            +    ARN C              +N F             W    K +         Q
Sbjct: 17  ILSMPQARNFCASAGGYLADDLGDDKNNFYSSIAANT---QFWIGLFKNSDGQFYWDRGQ 73

Query: 116 PANVNGWFWSGSGAKIGPTTQRNTGDWSATGGFGQAQPDNREAAQHDVACHHLKPFVCE 174
             N +      +    G  +   T            +  ++        C   +PF+C+
Sbjct: 74  GINPDLLNQPITYWANGEPSNDPTRQCVYF----DGRSGDKSKVWTTDTCATPRPFICQ 128


>d1byfa_ d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]} Length = 123 Back     information, alignment and structure
>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d2msba_112 Mannose-binding protein A, C-lectin domain {Rat (R 99.91
d1rdl1_111 Mannose-binding protein A, C-lectin domain {Rat (R 99.9
d1qdda_144 Lithostathine, inhibitor of stone formation {Human 99.89
d1r13a1119 Surfactant protein, lectin domain {Rat (Rattus nor 99.89
d1pwba1121 Surfactant protein, lectin domain {Human (Homo sap 99.89
d1hupa1117 Mannose-binding protein A, C-lectin domain {Human 99.89
d1h8ua_115 Eosinophil major basic protein {Human (Homo sapien 99.89
d1xpha1130 DC-SIGNR (DC-SIGN related receptor) {Human (Homo s 99.89
d1gz2a_139 Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 903 99.89
d1tn3a_137 Tetranectin {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1v7pa_134 Snake coagglutinin alpha chain {Snake (Echis multi 99.89
d1tdqb_126 Aggrecan core protein {Rat (Rattus norvegicus) [Ta 99.88
d1jwia_124 Snake coagglutinin alpha chain {Puff adder (Bitis 99.88
d1c3aa_135 Snake coagglutinin alpha chain {Habu snake (Trimer 99.88
d1jzna_135 Galactose-specific C-type lectin {Western diamondb 99.88
d1wmza_140 Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} 99.88
d1umrc_125 Snake coagglutinin beta chain {South american ratt 99.87
d1dv8a_128 H1 subunit of the asialoglycoprotein receptor {Hum 99.87
d1egga_136 Macrophage mannose receptor, CRD4 {Human (Homo sap 99.87
d1oz7b_123 Snake coagglutinin beta chain {Saw-scaled viper (E 99.87
d1umra_135 Snake coagglutinin alpha chain {South american rat 99.87
d2afpa_129 Type II antifreeze protein {Sea raven (Hemitripter 99.87
d1j34a_129 Snake coagglutinin alpha chain {Habu snake (Trimer 99.87
d1c3ab_125 Snake coagglutinin beta chain {Habu snake (Trimere 99.87
d1fvub_125 Snake coagglutinin beta chain {Jararaca (Bothrops 99.87
d1ypqa1131 Oxidised low density lipoprotein {Human (Homo sapi 99.87
d1jwib_123 Snake coagglutinin beta chain {Puff adder (Bitis a 99.86
d1v7pb_127 Snake coagglutinin beta chain {Snake (Echis multis 99.86
d1hq8a_123 NK cell-activating receptor nkg2d {Mouse (Mus musc 99.86
d1fvua_133 Snake coagglutinin alpha chain {Jararaca (Bothrops 99.86
d1j34b_123 Snake coagglutinin beta chain {Habu snake (Trimere 99.86
d1sb2b1127 Snake coagglutinin beta chain {Malayan pit viper ( 99.86
d1t8da1143 Low affinity immunoglobulin epsilon Fc receptor {H 99.86
d1qo3c_133 NK cell receptor {Mouse (Mus musculus), ly49-a [Ta 99.85
d3c8ja1122 NK cell receptor {Mouse (Mus musculus), ly49-c [Ta 99.85
d1uv0a_140 Pancreatitis-associated protein 1 {Human (Homo sap 99.85
d1g1ta1118 E-selectin, C-lectin domain {Human (Homo sapiens) 99.85
d1wk1a_150 Hypothetical protein F28B4.3 {Caenorhabditis elega 99.85
d3bdwa1121 CD94 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1g1sa1118 P-selectin, C-lectin domain {Human (Homo sapiens) 99.84
d1e87a_117 CD69 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1sb2a1132 Snake coagglutinin alpha chain {Malayan pit viper 99.84
d1oz7a_131 Snake coagglutinin alpha chain {Saw-scaled viper ( 99.83
d1byfa_123 Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) 99.81
d1kg0c_136 EBV gp42 {Epstein-Barr virus [TaxId: 10376]} 99.71
d2pf5a195 TSG-6, Link module {Human (Homo sapiens) [TaxId: 9 91.63
d1uuha_150 CD44, hyaluronan binding domain {Human (Homo sapie 83.06
>d2msba_ d.169.1.1 (A:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: C-type lectin-like
superfamily: C-type lectin-like
family: C-type lectin domain
domain: Mannose-binding protein A, C-lectin domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.91  E-value=8.5e-25  Score=159.12  Aligned_cols=94  Identities=13%  Similarity=0.356  Sum_probs=82.6

Q ss_pred             CcccCHHHHHHHHHHCCCeEeEecCHHHHHHHHHHHHcCCCCcEEEceeeCCCCCCCCCCCCCCCCCceEEccCCCcccc
Q psy4323          54 SLEVDWLDARNICRRHCMDAVSLETPQENEFVKQRITRGNVRYIWTSGRKCNFNGCDRPDLQPANVNGWFWSGSGAKIGP  133 (191)
Q Consensus        54 ~~~~sW~~A~~~C~~~gg~LasI~s~~E~~~i~~~l~~~~~~~~WIGl~~~~~~gc~~~~~~~~~~~~w~W~~dGs~~~~  133 (191)
                      .++++|.+|+.+|+++||+||+|+|++|++||.+++.    ..+||||++...+|            .|.|+ ||+++  
T Consensus         8 ~~~~tw~~A~~~C~~~g~~La~i~s~~e~~~l~~~~~----~~~WiGl~~~~~~g------------~~~w~-dg~~~--   68 (112)
T d2msba_           8 HERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAK----TSAFLGITDEVTEG------------QFMYV-TGGRL--   68 (112)
T ss_dssp             EEEECHHHHHHHHHHTTCEECCCSSHHHHHHHHHHHS----SCEEEEEECSSSTT------------CCEET-TSSBC--
T ss_pred             CcEeCHHHHHHHHHhCCCEEeeEcCHHHhhhhhhccc----ceEEEEEeecCccc------------ccccc-ccccc--
Confidence            4789999999999999999999999999999999875    36999999887766            99998 99998  


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCccCCC-----------cCcCCCCCcceEEeec
Q psy4323         134 TTQRNTGDWSATGGFGQAQPDNREAAQ-----------HDVACHHLKPFVCEDS  176 (191)
Q Consensus       134 ~~~~~y~nW~~~~~~~~~qP~~~~~~~-----------~d~~C~~~~~FICe~~  176 (191)
                          .|.+|.+      +||++....+           .|.+|+.+++||||+|
T Consensus        69 ----~y~~W~~------~eP~~~~~~~~Cv~~~~~~~W~~~~C~~~~~fICe~P  112 (112)
T d2msba_          69 ----TYSNWKK------DEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCEFP  112 (112)
T ss_dssp             ----CSCCBCT------TCCCCCTTCCCEEEECTTSCEEEECTTSCEEEEEEEC
T ss_pred             ----ccccccc------CCCCCCCCCCCEEEEeCCCEEEEeCCCCcEEEEEecC
Confidence                5679999      8998654332           8899999999999986



>d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qdda_ d.169.1.1 (A:) Lithostathine, inhibitor of stone formation {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r13a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A [TaxId: 10116]} Back     information, alignment and structure
>d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} Back     information, alignment and structure
>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz2a_ d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v7pa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Back     information, alignment and structure
>d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwia_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Back     information, alignment and structure
>d1c3aa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} Back     information, alignment and structure
>d1jzna_ d.169.1.1 (A:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]} Back     information, alignment and structure
>d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1umrc_ d.169.1.1 (C:) Snake coagglutinin beta chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} Back     information, alignment and structure
>d1dv8a_ d.169.1.1 (A:) H1 subunit of the asialoglycoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz7b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} Back     information, alignment and structure
>d1umra_ d.169.1.1 (A:) Snake coagglutinin alpha chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} Back     information, alignment and structure
>d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus) [TaxId: 8094]} Back     information, alignment and structure
>d1j34a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} Back     information, alignment and structure
>d1c3ab_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} Back     information, alignment and structure
>d1fvub_ d.169.1.1 (B:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} Back     information, alignment and structure
>d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwib_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Back     information, alignment and structure
>d1v7pb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Back     information, alignment and structure
>d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} Back     information, alignment and structure
>d1j34b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} Back     information, alignment and structure
>d1sb2b1 d.169.1.1 (B:2-128) Snake coagglutinin beta chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} Back     information, alignment and structure
>d1t8da1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a [TaxId: 10090]} Back     information, alignment and structure
>d3c8ja1 d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]} Back     information, alignment and structure
>d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3bdwa1 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa1 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb2a1 d.169.1.1 (A:1-132) Snake coagglutinin alpha chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} Back     information, alignment and structure
>d1oz7a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} Back     information, alignment and structure
>d1byfa_ d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]} Back     information, alignment and structure
>d1kg0c_ d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId: 10376]} Back     information, alignment and structure
>d2pf5a1 d.169.1.4 (A:1-95) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uuha_ d.169.1.4 (A:) CD44, hyaluronan binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure