Psyllid ID: psy4420


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MLRSTDTPSKLICSFCLEEVDNSALKMFEHNCDGVLNARKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKHTGEKPFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNLNYNCEVCEKVFDKIEEFENHLSDNHIFTYDHGTKDDKLEKLSAEMLYQEERDTIVFFPCRV
ccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHcccccccccccccccccccHHHHHHHcccccccccccccccccHHHHHHHccccccccccccccc
ccEEcccccccccccccccccccHHHHHHHHHHHccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccccccccccccccEccccHHHHHHHHccccEEccHccccEccccHHHHHHHHcccccccEccccccEccccHHHHHHHHccccccEEccc
mlrstdtpskLICSFCLEEVDNSALKMFEHNCDGVLNARKYTCLLCKQKESQAWKIKRHYLKHTQekffacshcdyksayINDVKKHtrkhtgekpfkcqicpyaaadsksLRVHYKTHakengrrvyhcticskrfytkskLDFHVNLHNLNYNCEVCEKVFDKIEEFEnhlsdnhiftydhgtkddkLEKLSAEMLYQEErdtivffpcrv
mlrstdtpskliCSFCLEEVDNSALKMFEHNCDGVLNARKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKhtgekpfkcqICPYAAADSKSLRVHYKthakengrrvyhcTICSKRFYTKSKLDFHVNLHNLNYNCEVCEKVFDKIEEFENHLSDNHIFTYDHGTKDDKLEKLSAEMlyqeerdtivffpcrv
MLRSTDTPSKLICSFCLEEVDNSALKMFEHNCDGVLNARKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKHTGEKPFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNLNYNCEVCEKVFDKIEEFENHLSDNHIFTYDHGTKDDKLEKLSAEMLYQEERDTIVFFPCRV
**********LICSFCLEEVDNSALKMFEHNCDGVLNARKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKHTGEKPFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNLNYNCEVCEKVFDKIEEFENHLSDNHIFTYDHGTKDDKLEKLSAEMLYQEERDTIVFFPC**
MLRSTDTPSKLICSFCLEEVDNSALKMFEHNCDGVLNARKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKHTGEKPFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNLNYNCEVCEKVFDKIEEFENHLSDNHIFTYDHGTKDDKLE***************VFFPCRV
********SKLICSFCLEEVDNSALKMFEHNCDGVLNARKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKHTGEKPFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNLNYNCEVCEKVFDKIEEFENHLSDNHIFTYDHGTKDDKLEKLSAEMLYQEERDTIVFFPCRV
MLRSTDTPSKLICSFCLEEVDNSALKMFEHNCDGVLNARKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKHTGEKPFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNLNYNCEVCEKVFDKIEEFENHLSDNHIFTYDHGTKDDKLEKLSAEMLYQEERDTIVFFPCR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRSTDTPSKLICSFCLEEVDNSALKMFEHNCDGVLNARKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKHTGEKPFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNLNYNCEVCEKVFDKIEEFENHLSDNHIFTYDHGTKDDKLEKLSAEMLYQEERDTIVFFPCRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query213 2.2.26 [Sep-21-2011]
Q08705 728 Transcriptional repressor yes N/A 0.657 0.192 0.344 2e-18
Q9R1D1 737 Transcriptional repressor yes N/A 0.657 0.189 0.344 2e-18
P49711 727 Transcriptional repressor yes N/A 0.657 0.192 0.344 2e-18
Q61164 736 Transcriptional repressor yes N/A 0.657 0.190 0.344 2e-18
Q8VIG1 1082 RE1-silencing transcripti no N/A 0.704 0.138 0.269 2e-17
Q60821 794 Zinc finger and BTB domai no N/A 0.769 0.206 0.316 8e-17
Q8NI51 663 Transcriptional repressor no N/A 0.769 0.247 0.304 8e-17
Q13127 1097 RE1-silencing transcripti no N/A 0.704 0.136 0.264 9e-17
Q8BJ90317 Zinc finger protein 771 O no N/A 0.615 0.413 0.352 3e-16
Q7L3S4317 Zinc finger protein 771 O no N/A 0.615 0.413 0.352 3e-16
>sp|Q08705|CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus GN=CTCF PE=1 SV=1 Back     alignment and function desciption
 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 76/148 (51%), Gaps = 8/148 (5%)

Query: 37  NARKYTCLLCKQKESQAWKIKRHY-LKHTQEKFFACSHCDYKSAYINDVKKHTRKHTGEK 95
             R + C  C      + ++ RH   KHT EK F CS CDY S  ++ +K+H R HTGE+
Sbjct: 318 GTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGER 377

Query: 96  PFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHV-NLHNLN- 153
           PF+C +C YA+ D+  L+ H +TH+   G + Y C IC  RF     +  H+   H  N 
Sbjct: 378 PFQCSLCSYASRDTYKLKRHMRTHS---GEKPYECYICHARFTQSGTMKMHILQKHTENV 434

Query: 154 --YNCEVCEKVFDKIEEFENHLSDNHIF 179
             ++C  C+ V  +  +   HL   H +
Sbjct: 435 AKFHCPHCDTVIARKSDLGVHLRKQHSY 462




Acts as both a transcriptional activator and repressor of the MYC gene.
Gallus gallus (taxid: 9031)
>sp|Q9R1D1|CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus GN=Ctcf PE=2 SV=1 Back     alignment and function description
>sp|P49711|CTCF_HUMAN Transcriptional repressor CTCF OS=Homo sapiens GN=CTCF PE=1 SV=1 Back     alignment and function description
>sp|Q61164|CTCF_MOUSE Transcriptional repressor CTCF OS=Mus musculus GN=Ctcf PE=1 SV=2 Back     alignment and function description
>sp|Q8VIG1|REST_MOUSE RE1-silencing transcription factor OS=Mus musculus GN=Rest PE=2 SV=2 Back     alignment and function description
>sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 Back     alignment and function description
>sp|Q8NI51|CTCFL_HUMAN Transcriptional repressor CTCFL OS=Homo sapiens GN=CTCFL PE=1 SV=2 Back     alignment and function description
>sp|Q13127|REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 Back     alignment and function description
>sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 Back     alignment and function description
>sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
395517547 638 PREDICTED: zinc finger protein 26-like [ 0.563 0.188 0.424 7e-20
291223509 852 PREDICTED: enhancer binding protein-like 0.788 0.197 0.335 1e-19
260819188 409 hypothetical protein BRAFLDRAFT_185156 [ 0.638 0.332 0.368 6e-19
432959345 833 PREDICTED: transcriptional repressor CTC 0.647 0.165 0.356 7e-19
260794579 1068 hypothetical protein BRAFLDRAFT_119633 [ 0.629 0.125 0.374 8e-19
345328258 766 PREDICTED: zinc finger protein 64 homolo 0.558 0.155 0.395 2e-18
395506841 934 PREDICTED: zinc finger protein 64 homolo 0.558 0.127 0.387 2e-18
170585154 764 Zinc finger, C2H2 type family protein [B 0.859 0.239 0.304 3e-18
72028083 939 PREDICTED: uncharacterized protein LOC59 0.638 0.144 0.342 3e-18
18539217 939 enhancer binding protein [Paracentrotus 0.638 0.144 0.335 6e-18
>gi|395517547|ref|XP_003762937.1| PREDICTED: zinc finger protein 26-like [Sarcophilus harrisii] Back     alignment and taxonomy information
 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (57%), Gaps = 5/125 (4%)

Query: 37  NARKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKHTGEKP 96
           NA ++TC +C +K S    ++RH   H   K F C HCDYK+     + +H R HTGEKP
Sbjct: 489 NADEFTCKICNRKCSSKLALQRHMGIHAGVKPFHCQHCDYKTRLKASLIQHMRIHTGEKP 548

Query: 97  FKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNLN--Y 154
           FKC++C YA+ D+ SLR H++TH +E   R Y C +CS     K  LD HV  H+    +
Sbjct: 549 FKCEVCSYASIDASSLRRHFRTHTRE---RPYKCQLCSYSSIQKKSLDLHVRRHHTGETF 605

Query: 155 NCEVC 159
            C  C
Sbjct: 606 GCSFC 610




Source: Sarcophilus harrisii

Species: Sarcophilus harrisii

Genus: Sarcophilus

Family: Dasyuridae

Order: Dasyuromorphia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|291223509|ref|XP_002731752.1| PREDICTED: enhancer binding protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|260819188|ref|XP_002604919.1| hypothetical protein BRAFLDRAFT_185156 [Branchiostoma floridae] gi|229290248|gb|EEN60929.1| hypothetical protein BRAFLDRAFT_185156 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|432959345|ref|XP_004086251.1| PREDICTED: transcriptional repressor CTCF-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|260794579|ref|XP_002592286.1| hypothetical protein BRAFLDRAFT_119633 [Branchiostoma floridae] gi|229277502|gb|EEN48297.1| hypothetical protein BRAFLDRAFT_119633 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|345328258|ref|XP_001509158.2| PREDICTED: zinc finger protein 64 homolog, isoforms 1 and 2-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|395506841|ref|XP_003757738.1| PREDICTED: zinc finger protein 64 homolog, isoforms 1 and 2 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|170585154|ref|XP_001897351.1| Zinc finger, C2H2 type family protein [Brugia malayi] gi|158595226|gb|EDP33795.1| Zinc finger, C2H2 type family protein [Brugia malayi] Back     alignment and taxonomy information
>gi|72028083|ref|XP_797592.1| PREDICTED: uncharacterized protein LOC593001 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|18539217|emb|CAD22532.1| enhancer binding protein [Paracentrotus lividus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
ZFIN|ZDB-GENE-050913-134436 zgc:113443 "zgc:113443" [Danio 0.727 0.355 0.359 1.3e-23
ZFIN|ZDB-GENE-120214-29 518 si:ch73-367f21.5 "si:ch73-367f 0.619 0.254 0.379 1.1e-22
ZFIN|ZDB-GENE-071004-66346 zgc:173816 "zgc:173816" [Danio 0.769 0.473 0.337 3.4e-22
UNIPROTKB|I3LDG5 722 CTCF "Uncharacterized protein" 0.676 0.199 0.352 4.1e-22
UNIPROTKB|E1BZC3 733 CTCF "Transcriptional represso 0.690 0.200 0.346 5.3e-22
ZFIN|ZDB-GENE-031118-80 666 zfp64 "zinc finger protein 64 0.727 0.232 0.337 5.7e-22
UNIPROTKB|A5GFN3 647 CTCFL "CCCTC-binding factor (Z 0.798 0.262 0.320 6.8e-22
UNIPROTKB|B2CML0 631 BORIS "Uncharacterized protein 0.802 0.270 0.311 8.2e-22
UNIPROTKB|K7GSK6 711 CTCFL "Uncharacterized protein 0.798 0.239 0.320 8.3e-22
UNIPROTKB|E2RST2 643 CTCFL "Uncharacterized protein 0.765 0.253 0.312 8.5e-22
ZFIN|ZDB-GENE-050913-134 zgc:113443 "zgc:113443" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 274 (101.5 bits), Expect = 1.3e-23, P = 1.3e-23
 Identities = 59/164 (35%), Positives = 86/164 (52%)

Query:    12 ICSFCLEEVDNSALKMFEHNCDGVLNARK-YTCLLCKQKESQAWKIKRHYLKHTQEKFFA 70
             +C  C E+  ++A+K+  H  + V    K Y C +C +  SQ   +K H   HT EK + 
Sbjct:   186 MCFEC-EKTFHTAVKLKIH--ERVHTGEKPYICSVCSKGFSQFETMKMHERIHTGEKPYK 242

Query:    71 CSHCDYKSAYINDVKKHTRKHTGEKPFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHC 130
             CSHCD + +   D++KH R HTGEKP+KC  C     D   L++H +TH    G + Y C
Sbjct:   243 CSHCDMRCSKSGDLRKHERTHTGEKPYKCSHCEKRCRDLGHLKIHERTHT---GEKPYTC 299

Query:   131 TICSKRFYTKSKLDFHVNLHNLN--YNCEVCEKVFDKIEEFENH 172
             ++C+KRF     L  H  +H     Y C  CEK F+     ++H
Sbjct:   300 SLCNKRFGYSGSLKKHERIHTGEKPYKCSHCEKRFNSSGHLKSH 343


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-120214-29 si:ch73-367f21.5 "si:ch73-367f21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-66 zgc:173816 "zgc:173816" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDG5 CTCF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZC3 CTCF "Transcriptional repressor CTCF" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031118-80 zfp64 "zinc finger protein 64 homolog (mouse)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A5GFN3 CTCFL "CCCTC-binding factor (Zinc finger protein)-like" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B2CML0 BORIS "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|K7GSK6 CTCFL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RST2 CTCFL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 213
KOG2462|consensus279 99.96
KOG2462|consensus279 99.94
KOG3608|consensus467 99.9
KOG1074|consensus 958 99.87
KOG3608|consensus467 99.84
KOG1074|consensus 958 99.78
KOG3623|consensus 1007 99.76
KOG3576|consensus267 99.7
KOG3576|consensus267 99.66
KOG3623|consensus1007 99.46
PLN03086567 PRLI-interacting factor K; Provisional 99.42
PHA00733128 hypothetical protein 99.38
PHA0276855 hypothetical protein; Provisional 99.12
PLN03086567 PRLI-interacting factor K; Provisional 99.12
KOG3993|consensus500 99.09
PHA00733128 hypothetical protein 99.02
KOG3993|consensus500 98.93
PHA0276855 hypothetical protein; Provisional 98.79
PHA0073279 hypothetical protein 98.65
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.57
PHA0061644 hypothetical protein 98.55
PHA0061644 hypothetical protein 98.51
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.44
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.33
PHA0073279 hypothetical protein 98.14
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.13
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.06
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.03
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.96
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.95
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.84
COG5189423 SFP1 Putative transcriptional repressor regulating 97.84
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.62
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.57
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.51
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.39
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.27
smart0035526 ZnF_C2H2 zinc finger. 97.25
COG5189423 SFP1 Putative transcriptional repressor regulating 97.12
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.11
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.07
KOG2231|consensus 669 96.76
smart0035526 ZnF_C2H2 zinc finger. 96.71
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.58
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.47
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.24
KOG2231|consensus 669 96.23
PRK04860160 hypothetical protein; Provisional 96.13
KOG2785|consensus 390 95.58
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.56
PRK04860160 hypothetical protein; Provisional 95.3
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.24
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.19
KOG2482|consensus423 95.07
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.99
KOG1146|consensus 1406 94.86
COG404965 Uncharacterized protein containing archaeal-type C 94.6
KOG4173|consensus253 94.5
KOG2482|consensus423 94.31
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.89
KOG1146|consensus 1406 93.67
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 93.38
COG5048467 FOG: Zn-finger [General function prediction only] 93.16
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 92.98
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.76
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 91.07
KOG2893|consensus 341 90.96
COG404965 Uncharacterized protein containing archaeal-type C 90.52
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.47
KOG2893|consensus 341 89.63
PF1371937 zinc_ribbon_5: zinc-ribbon domain 89.07
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 88.96
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 88.58
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 88.5
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.08
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 87.3
KOG4173|consensus253 86.83
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 86.79
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.76
PHA0062659 hypothetical protein 86.71
COG5048467 FOG: Zn-finger [General function prediction only] 86.16
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 85.63
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 85.07
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 84.79
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 84.41
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 83.51
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 83.32
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 82.99
PRK06266178 transcription initiation factor E subunit alpha; V 82.73
PRK06266178 transcription initiation factor E subunit alpha; V 82.61
smart00531147 TFIIE Transcription initiation factor IIE. 82.49
smart00531147 TFIIE Transcription initiation factor IIE. 82.14
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 82.08
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 81.75
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 81.34
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 80.09
>KOG2462|consensus Back     alignment and domain information
Probab=99.96  E-value=2e-30  Score=187.86  Aligned_cols=135  Identities=28%  Similarity=0.530  Sum_probs=126.6

Q ss_pred             CceecccccccccCHHHHHHHHHHhcC---CCceecccCcccccCHHHHHHHHHhccCCCCeecCCCCcccCChhHHHHH
Q psy4420          39 RKYTCLLCKQKESQAWKIKRHYLKHTQ---EKFFACSHCDYKSAYINDVKKHTRKHTGEKPFKCQICPYAAADSKSLRVH  115 (213)
Q Consensus        39 ~~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H  115 (213)
                      ..|+|+.|++.+.+..+|.+|..+|..   .+.+.|+.||+.+.+...|.+|+++|+  -+.+|.+||+.|...|.|+.|
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGH  206 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGH  206 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcc
Confidence            579999999999999999999999864   567999999999999999999999998  579999999999999999999


Q ss_pred             HHHhhccCCCeeeecCccccccCCHHHHHHHHhhCCC--CccccccccccCChHHHHhHHhhcCC
Q psy4420         116 YKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNL--NYNCEVCEKVFDKIEEFENHLSDNHI  178 (213)
Q Consensus       116 ~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~--~~~C~~C~~~f~~~~~L~~H~~~~h~  178 (213)
                      +++|++   ++||.|+.|+++|...++|+.|+++|..  +|+|..|+|.|+..+.|.+|.+....
T Consensus       207 iRTHTG---EKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~C~  268 (279)
T KOG2462|consen  207 IRTHTG---EKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESACL  268 (279)
T ss_pred             cccccC---CCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhccc
Confidence            999996   9999999999999999999999999954  99999999999999999999987643



>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-13
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-13
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-08
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-09
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-08
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-08
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-08
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-08
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-08
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 5e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-04
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 6e-08
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 6e-08
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 8e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-08
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-04
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-04
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 6e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-04
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-04
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 43/136 (31%), Positives = 61/136 (44%), Gaps = 5/136 (3%) Query: 39 RKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKHTGEKPFK 98 + Y C C + S++ + H HT EK + C C + D+ +H R HTGEKP+K Sbjct: 20 KPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYK 79 Query: 99 CQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNLN--YNC 156 C C + + +LR H +TH G + Y C C K F + L H H Y C Sbjct: 80 CPECGKSFSQRANLRAHQRTH---TGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKC 136 Query: 157 EVCEKVFDKIEEFENH 172 C K F + + H Sbjct: 137 PECGKSFSREDNLHTH 152
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-11
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-07
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-10
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-09
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 8e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 6e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 3e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 8e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 7e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-04
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
 Score = 68.2 bits (167), Expect = 1e-15
 Identities = 15/60 (25%), Positives = 24/60 (40%)

Query: 91  HTGEKPFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLH 150
            +G    +C+IC +      SL  H + HA+      + C  C KRF     +  H +  
Sbjct: 2   SSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKS 61


>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.8
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.8
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.78
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.77
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.76
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.76
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.76
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.76
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.75
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.75
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.72
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.72
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.69
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.68
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.68
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.67
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.67
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.66
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.64
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.62
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.61
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.6
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.6
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.59
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.57
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.54
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.54
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.53
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.49
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.49
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.48
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.48
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.47
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.47
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.46
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.46
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.46
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.45
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.44
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.44
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.44
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.44
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.42
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.42
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.4
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.39
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.37
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.35
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.32
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.31
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.3
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.26
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.24
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.21
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.19
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.19
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.17
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.16
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.15
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.14
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.14
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.12
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.12
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.03
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.0
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.0
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.99
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.99
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.98
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.97
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.96
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.95
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.94
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.93
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.92
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.91
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.9
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.9
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.89
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.88
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.88
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.87
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.86
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.84
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.84
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.84
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.82
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.82
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.82
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.81
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.78
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.74
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.68
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.57
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.54
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.53
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.51
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.51
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.47
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.47
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.45
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.43
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.42
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.39
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.39
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.38
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.38
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.35
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.34
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.31
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.29
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.28
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.28
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.27
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.26
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.26
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.25
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.25
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.24
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.21
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.2
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.19
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.5
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.18
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.18
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.18
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.18
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.18
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.17
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.15
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.44
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.14
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.14
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.1
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.36
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.08
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.07
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.07
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.07
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.06
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.06
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.04
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.29
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.0
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.99
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.98
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.2
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.92
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.89
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.88
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.08
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.72
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.48
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.38
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.29
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.28
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.9
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.61
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.5
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.48
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.43
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.4
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.83
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.57
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.56
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 89.51
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 89.5
2k5c_A95 Uncharacterized protein PF0385; structural genomic 89.37
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 89.32
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 87.05
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 86.67
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 85.53
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 84.87
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 81.09
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=8.1e-38  Score=225.90  Aligned_cols=170  Identities=27%  Similarity=0.517  Sum_probs=144.7

Q ss_pred             CCCCCCCccccCcc---chhhhhhhhhhhhcccccccCCCceecccccccccCHHHHHHHHHHhcCCCceecccCccccc
Q psy4420           3 RSTDTPSKLICSFC---LEEVDNSALKMFEHNCDGVLNARKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSA   79 (213)
Q Consensus         3 ~~~~~~~~~~C~~C---f~~~~~l~~h~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~   79 (213)
                      +.+.++++|.|++|   |.....|..|++.|...     ++|.|+.|++.|.....|..|++.|.++++|.|+.|++.|.
T Consensus        14 ~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-----~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~   88 (190)
T 2i13_A           14 ALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGE-----KPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFS   88 (190)
T ss_dssp             -----------------CCSSHHHHHGGGCC--------CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEES
T ss_pred             hhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCC-----CCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccC
Confidence            45678899999999   88899999999999877     89999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHhccCCCCeecCCCCcccCChhHHHHHHHHhhccCCCeeeecCccccccCCHHHHHHHHhhCCC--Ccccc
Q psy4420          80 YINDVKKHTRKHTGEKPFKCQICPYAAADSKSLRVHYKTHAKENGRRVYHCTICSKRFYTKSKLDFHVNLHNL--NYNCE  157 (213)
Q Consensus        80 ~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~--~~~C~  157 (213)
                      ....|..|+..|+++++|.|+.|++.|.+...|..|++.|++   +++|.|+.|++.|.....|..|+++|++  +|.|+
T Consensus        89 ~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~  165 (190)
T 2i13_A           89 QRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTG---EKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCP  165 (190)
T ss_dssp             CHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHC---CCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECT
T ss_pred             CHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCC---CCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECC
Confidence            999999999999999999999999999999999999999985   8999999999999999999999999954  99999


Q ss_pred             ccccccCChHHHHhHHhhcCCCC
Q psy4420         158 VCEKVFDKIEEFENHLSDNHIFT  180 (213)
Q Consensus       158 ~C~~~f~~~~~L~~H~~~~h~~~  180 (213)
                      +|++.|.+...|..|++.|+++.
T Consensus       166 ~C~~~f~~~~~L~~H~~~H~~~k  188 (190)
T 2i13_A          166 ECGKSFSRRDALNVHQRTHTGKK  188 (190)
T ss_dssp             TTCCEESSHHHHHHHHTTC----
T ss_pred             CCCCccCCHHHHHHHHHhcCCCC
Confidence            99999999999999999998875



>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 213
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 7e-06
d2dmda329 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 { 2e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.004
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.004
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Kruppel-like factor 3, Bklf
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 44.3 bits (105), Expect = 1e-07
 Identities = 14/33 (42%), Positives = 18/33 (54%)

Query: 87  HTRKHTGEKPFKCQICPYAAADSKSLRVHYKTH 119
            TR  TG KPF+C  C  + + S  L +H K H
Sbjct: 2   STRGSTGIKPFQCPDCDRSFSRSDHLALHRKRH 34


>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.58
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.57
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.15
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.08
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.07
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.06
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.03
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.02
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.0
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.95
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.92
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.91
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.91
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.89
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.88
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.86
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.86
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.84
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.79
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.77
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.75
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.73
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.7
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.69
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.66
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.63
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.62
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.6
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.58
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.55
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.53
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.51
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.48
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.44
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.3
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.27
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.19
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.13
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.1
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.08
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.06
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.02
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.99
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.95
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.89
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.83
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.76
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.74
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.7
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.64
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.59
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.58
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.58
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.53
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.48
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.41
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.37
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.35
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.33
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.33
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.33
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.31
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.3
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.19
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.14
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.13
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.11
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.11
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.09
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.07
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.07
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.02
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.0
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.63
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.6
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.44
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.4
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.33
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.28
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.26
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.25
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.24
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.18
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.01
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.01
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.97
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.96
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.91
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.72
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.62
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.61
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.48
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.35
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 95.1
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.98
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.94
d1y0jb136 U-shaped transcription factor, different fingers { 94.39
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 93.96
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 93.87
d1y0jb136 U-shaped transcription factor, different fingers { 93.86
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.83
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.78
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.53
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.06
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 92.92
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.96
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 91.3
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.02
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.48
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.23
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 88.4
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 86.8
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 86.78
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 85.93
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 85.44
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 82.72
d1fu9a_36 U-shaped transcription factor, different fingers { 82.26
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 80.62
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.58  E-value=9.7e-16  Score=84.91  Aligned_cols=52  Identities=21%  Similarity=0.432  Sum_probs=36.4

Q ss_pred             CceecccccccccCHHHHHHHHHHhcCCCceecccCcccccCHHHHHHHHHhc
Q psy4420          39 RKYTCLLCKQKESQAWKIKRHYLKHTQEKFFACSHCDYKSAYINDVKKHTRKH   91 (213)
Q Consensus        39 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~~   91 (213)
                      +||+| .||+.|....+|..|+++|.+++||.|.+||+.|...+.|..|+++|
T Consensus         2 K~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           2 KLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             cCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            56777 37777777777777777777777777777777777777777776554



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure