Psyllid ID: psy4440

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MKELSFAFKPRQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFMAYYEVSHRQTTPA
cHHHHHHHcccccEEEEEccccHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEcccccccEEEcccccccccccccccccccccccccccHHHHHHHHHccccc
cHHHHHHHcHcccHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHccccHHHHHHHHcHHHHHEEccccccccccccccccccccccccHHHHccccccccccccccccccHHHHHHHHHHccccHHHEEEEEEcEEEEEEEccccccccccEEEEEcccccccccccEEEHHHHHHHHHccc
mkelsfafkprqlslsavvspsqtiiDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFdysgywdgatghvaplyqsqddqyhsvntivpvcrcsqshidnhhllNSNINYWIskgmparkvimGMPLYAQTFILadsnshglnaltvgpglpgpftqspgfmaYYEVSHRQTTPA
mkelsfafkprqlslsavvspsqtiIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFMAYYEVSHRQTTPA
MKELSFAFKPRQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFMAYYEVSHRQTTPA
***************SAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFMAYYE*********
MKELSFAFKPRQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFMAYYEVSHRQT***
MKELSFAFKPRQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFMAYYEV********
MKELSFAFKPRQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFMAYYEVSHRQTT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKELSFAFKPRQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFMAYYEVSHRQTTPA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q9W5U2 2286 Probable chitinase 3 OS=D yes N/A 0.751 0.062 0.396 3e-35
Q13231 466 Chitotriosidase-1 OS=Homo yes N/A 0.693 0.281 0.315 6e-20
Q28990 527 Oviduct-specific glycopro no N/A 0.708 0.254 0.327 2e-19
Q95M17 472 Acidic mammalian chitinas no N/A 0.624 0.25 0.350 2e-19
Q12889 678 Oviduct-specific glycopro no N/A 0.576 0.160 0.353 3e-19
P36718 623 Oviduct-specific glycopro N/A N/A 0.576 0.174 0.353 4e-19
P36222383 Chitinase-3-like protein no N/A 0.687 0.339 0.298 5e-19
Q91XA9 473 Acidic mammalian chitinas yes N/A 0.624 0.249 0.358 7e-19
Q60557 671 Oviduct-specific glycopro N/A N/A 0.714 0.201 0.333 7e-19
Q15782390 Chitinase-3-like protein no N/A 0.608 0.294 0.380 7e-19
>sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 Back     alignment and function desciption
 Score =  147 bits (372), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 104/184 (56%), Gaps = 42/184 (22%)

Query: 1    MKELSFAFKPRQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLA 60
            ++ELS AF+PR L LS  VSPS+ IID                        + Y++  L+
Sbjct: 1111 VQELSEAFRPRGLMLSTAVSPSRKIID------------------------AGYDIPQLS 1146

Query: 61   KYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNS 120
            +Y DW+ V+++D+ G+WD  TGHVAPLY   DD +   N                  +N 
Sbjct: 1147 RYFDWIAVMTYDFHGHWDKKTGHVAPLYHHPDDDFEYFN------------------VNY 1188

Query: 121  NINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFMAYYE 180
            +INYW+ KG P++K++MG+PLY Q+F L ++NS GLNA    PG  G FT++ GF+AYYE
Sbjct: 1189 SINYWMEKGAPSQKLVMGIPLYGQSFTLENTNSSGLNAKAPAPGEAGEFTRAAGFLAYYE 1248

Query: 181  VSHR 184
            +  R
Sbjct: 1249 ICER 1252

Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 4
>sp|Q13231|CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1 Back     alignment and function description
>sp|Q28990|OVGP1_PIG Oviduct-specific glycoprotein OS=Sus scrofa GN=OVGP1 PE=2 SV=1 Back     alignment and function description
>sp|Q95M17|CHIA_BOVIN Acidic mammalian chitinase OS=Bos taurus GN=CHIA PE=1 SV=1 Back     alignment and function description
>sp|Q12889|OVGP1_HUMAN Oviduct-specific glycoprotein OS=Homo sapiens GN=OVGP1 PE=2 SV=1 Back     alignment and function description
>sp|P36718|OVGP1_PAPAN Oviduct-specific glycoprotein OS=Papio anubis GN=OVGP1 PE=2 SV=2 Back     alignment and function description
>sp|P36222|CH3L1_HUMAN Chitinase-3-like protein 1 OS=Homo sapiens GN=CHI3L1 PE=1 SV=2 Back     alignment and function description
>sp|Q91XA9|CHIA_MOUSE Acidic mammalian chitinase OS=Mus musculus GN=Chia PE=1 SV=2 Back     alignment and function description
>sp|Q60557|OVGP1_MESAU Oviduct-specific glycoprotein OS=Mesocricetus auratus GN=OVGP1 PE=1 SV=1 Back     alignment and function description
>sp|Q15782|CH3L2_HUMAN Chitinase-3-like protein 2 OS=Homo sapiens GN=CHI3L2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
242011547 2710 conserved hypothetical protein [Pediculu 0.751 0.052 0.445 2e-36
195116183 2466 GI11661 [Drosophila mojavensis] gi|19391 0.751 0.057 0.418 6e-36
195476481 2311 GE17254 [Drosophila yakuba] gi|194185813 0.751 0.061 0.402 9e-36
195434503 2431 GK14769 [Drosophila willistoni] gi|19416 0.751 0.058 0.423 1e-35
195385214 1387 GJ13003 [Drosophila virilis] gi|19414775 0.751 0.102 0.423 2e-35
158299726 2402 AGAP009022-PA [Anopheles gambiae str. PE 0.751 0.059 0.429 3e-35
198476020 2487 GA25359 [Drosophila pseudoobscura pseudo 0.751 0.057 0.418 3e-35
195030460 1696 GH10759 [Drosophila grimshawi] gi|193904 0.751 0.083 0.418 6e-35
170049630 2473 acidic mammalian chitinase [Culex quinqu 0.751 0.057 0.429 7e-35
312375269 1657 hypothetical protein AND_14365 [Anophele 0.751 0.085 0.418 2e-34
>gi|242011547|ref|XP_002426510.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510636|gb|EEB13772.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/184 (44%), Positives = 110/184 (59%), Gaps = 42/184 (22%)

Query: 1    MKELSFAFKPRQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLA 60
            +KEL  AFKPR L LSA VSPS+T++D                        + Y+V +L 
Sbjct: 1488 VKELHDAFKPRGLLLSAAVSPSKTVVD------------------------AGYDVPTLG 1523

Query: 61   KYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNS 120
            +YLDWV+V+++D+ G WD  TGHVAPLY  +DD++   N                   N 
Sbjct: 1524 EYLDWVSVMTYDFHGQWDKRTGHVAPLYYHEDDEFFFFNA------------------NY 1565

Query: 121  NINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFMAYYE 180
            +INYWIS+G+P RK+IMGMPLY Q+F LA+ +S+GLNA   GPG  G FT++ GF+AYYE
Sbjct: 1566 SINYWISQGVPRRKIIMGMPLYGQSFRLANPSSNGLNANAPGPGKAGEFTKAAGFLAYYE 1625

Query: 181  VSHR 184
            +  R
Sbjct: 1626 ICDR 1629

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195116183|ref|XP_002002635.1| GI11661 [Drosophila mojavensis] gi|193913210|gb|EDW12077.1| GI11661 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195476481|ref|XP_002086146.1| GE17254 [Drosophila yakuba] gi|194185813|gb|EDW99424.1| GE17254 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195434503|ref|XP_002065242.1| GK14769 [Drosophila willistoni] gi|194161327|gb|EDW76228.1| GK14769 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195385214|ref|XP_002051301.1| GJ13003 [Drosophila virilis] gi|194147758|gb|EDW63456.1| GJ13003 [Drosophila virilis] Back     alignment and taxonomy information
>gi|158299726|ref|XP_001238192.2| AGAP009022-PA [Anopheles gambiae str. PEST] gi|157013656|gb|EAU75925.2| AGAP009022-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|198476020|ref|XP_002132239.1| GA25359 [Drosophila pseudoobscura pseudoobscura] gi|198137511|gb|EDY69641.1| GA25359 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195030460|ref|XP_001988086.1| GH10759 [Drosophila grimshawi] gi|193904086|gb|EDW02953.1| GH10759 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|170049630|ref|XP_001857861.1| acidic mammalian chitinase [Culex quinquefasciatus] gi|167871385|gb|EDS34768.1| acidic mammalian chitinase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312375269|gb|EFR22674.1| hypothetical protein AND_14365 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
FB|FBgn02509072286 Cht3 "Chitinase 3" [Drosophila 0.380 0.031 0.513 2.7e-35
UNIPROTKB|F1S632392 CHI3L2 "Uncharacterized protei 0.597 0.288 0.401 3.2e-20
UNIPROTKB|E1BZP3 473 CHIA "Uncharacterized protein" 0.624 0.249 0.373 3.4e-20
UNIPROTKB|F1NM31 479 CHIA "Uncharacterized protein" 0.624 0.246 0.373 3.5e-20
UNIPROTKB|E1BZP6 480 CHIA "Uncharacterized protein" 0.624 0.245 0.373 3.5e-20
UNIPROTKB|E2R8B1 483 CHIA "Uncharacterized protein" 0.624 0.244 0.358 7.7e-20
UNIPROTKB|F6UUW9 538 OVGP1 "Uncharacterized protein 0.317 0.111 0.466 7.9e-20
UNIPROTKB|E2QSE0 547 OVGP1 "Uncharacterized protein 0.317 0.109 0.466 8.3e-20
UNIPROTKB|F1S637 527 OVGP1 "Oviduct-specific glycop 0.317 0.113 0.466 1e-19
UNIPROTKB|Q28990 527 OVGP1 "Oviduct-specific glycop 0.317 0.113 0.466 1e-19
FB|FBgn0250907 Cht3 "Chitinase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 209 (78.6 bits), Expect = 2.7e-35, Sum P(3) = 2.7e-35
 Identities = 38/74 (51%), Positives = 51/74 (68%)

Query:   113 DNHHLLNSN--INYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFT 170
             D +  LN N  I+YW+ +G+P  K++MGMP+Y QTF LAD N   LN  TVGPG  G FT
Sbjct:  2122 DENLYLNGNFSIHYWLERGIPNDKLVMGMPMYGQTFTLADQNRRSLNDKTVGPGKAGTFT 2181

Query:   171 QSPGFMAYYEVSHR 184
             ++ GF+AYYE+  +
Sbjct:  2182 RADGFLAYYEICEK 2195
GO:0006036 "cuticle chitin catabolic process" evidence=ISS
GO:0004568 "chitinase activity" evidence=ISS;NAS
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0005576 "extracellular region" evidence=IEA
GO:0008061 "chitin binding" evidence=IEA
UNIPROTKB|F1S632 CHI3L2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZP3 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NM31 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZP6 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8B1 CHIA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6UUW9 OVGP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSE0 OVGP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S637 OVGP1 "Oviduct-specific glycoprotein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q28990 OVGP1 "Oviduct-specific glycoprotein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
cd02872362 cd02872, GH18_chitolectin_chitotriosidase, This co 2e-47
smart00636334 smart00636, Glyco_18, Glyco_18 domain 4e-32
pfam00704325 pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam 4e-19
cd02873413 cd02873, GH18_IDGF, The IDGF's (imaginal disc grow 7e-16
cd06548322 cd06548, GH18_chitinase, The GH18 (glycosyl hydrol 6e-13
cd02879299 cd02879, GH18_plant_chitinase_class_V, The class V 8e-13
COG3325441 COG3325, ChiA, Chitinase [Carbohydrate transport a 3e-06
cd02874313 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm 3e-05
cd00598210 cd00598, GH18_chitinase-like, The GH18 (glycosyl h 4e-05
cd02878345 cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni 3e-04
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information 
 Score =  158 bits (401), Expect = 2e-47
 Identities = 60/193 (31%), Positives = 95/193 (49%), Gaps = 46/193 (23%)

Query: 1   MKELSFAFKP--RQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKS 58
           +KEL  AF+P   +L L+A VS  +  ID                        ++Y++  
Sbjct: 140 LKELREAFEPEAPRLLLTAAVSAGKETID------------------------AAYDIPE 175

Query: 59  LAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLL 118
           ++KYLD++ V+++D+ G W+G TGH +PLY    D                        L
Sbjct: 176 ISKYLDFINVMTYDFHGSWEGVTGHNSPLYAGSADTGDQKY------------------L 217

Query: 119 NSN--INYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSPGFM 176
           N +  I YW+SKG P  K+++G+P Y ++F LA  ++ G+ A   GPG  GP+T+  GF+
Sbjct: 218 NVDYAIKYWLSKGAPPEKLVLGIPTYGRSFTLASPSNTGVGAPASGPGTAGPYTREAGFL 277

Query: 177 AYYEVSHRQTTPA 189
           AYYE+     +  
Sbjct: 278 AYYEICEFLKSGW 290

The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens. Length = 362
>gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain Back     alignment and domain information
>gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 Back     alignment and domain information
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
cd02872362 GH18_chitolectin_chitotriosidase This conserved do 99.97
cd02873413 GH18_IDGF The IDGF's (imaginal disc growth factors 99.97
smart00636334 Glyco_18 Glycosyl hydrolase family 18. 99.97
cd02878345 GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin 99.96
KOG2806|consensus432 99.95
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 99.92
cd06548322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 99.92
COG3325441 ChiA Chitinase [Carbohydrate transport and metabol 99.91
cd02879299 GH18_plant_chitinase_class_V The class V plant chi 99.91
PF00704343 Glyco_hydro_18: Glycosyl hydrolases family 18; Int 99.91
cd02876318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 99.87
cd02874313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 99.85
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 99.81
cd06549298 GH18_trifunctional GH18 domain of an uncharacteriz 99.77
COG3858423 Predicted glycosyl hydrolase [General function pre 99.56
KOG2091|consensus392 98.92
cd06544253 GH18_narbonin Narbonin is a plant 2S protein from 98.7
cd00598210 GH18_chitinase-like The GH18 (glycosyl hydrolase, 98.36
cd02871312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 98.36
cd06542255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 98.15
cd06546256 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 98.02
cd02877280 GH18_hevamine_XipI_class_III This conserved domain 97.64
cd06543294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 97.61
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information 
Probab=99.97  E-value=4.3e-32  Score=239.63  Aligned_cols=145  Identities=41%  Similarity=0.858  Sum_probs=128.0

Q ss_pred             ChhHHhhcCCC--CcEEEEEeCCCcchhhhhhchhhhhhhhhhHHHhhhcccccccchhhhcccCcEEEEeeccCCCCCC
Q psy4440           1 MKELSFAFKPR--QLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDYSGYWD   78 (189)
Q Consensus         1 lkeLr~al~~~--~~~Ls~av~~~~~~~~~~y~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~vD~invMtYD~~g~w~   78 (189)
                      |+|||++|++.  +++||++||+.+......||++.|.                        ++||+|||||||+||+|+
T Consensus       140 l~~lr~~l~~~~~~~~ls~av~~~~~~~~~~~d~~~l~------------------------~~vD~v~vmtYD~~~~~~  195 (362)
T cd02872         140 LKELREAFEPEAPRLLLTAAVSAGKETIDAAYDIPEIS------------------------KYLDFINVMTYDFHGSWE  195 (362)
T ss_pred             HHHHHHHHHhhCcCeEEEEEecCChHHHhhcCCHHHHh------------------------hhcceEEEecccCCCCCC
Confidence            58999999987  8999999999876555567777666                        999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCcccccccccCCCCcchhhHHHHHHHHHHcCCCCCceeeeccceeeeeeeccCCCCCCCC
Q psy4440          79 GATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNA  158 (189)
Q Consensus        79 ~~tg~~apL~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~v~~~v~~~~~~Gvp~~KlvlGip~YGr~~~l~~~~~~~~~~  158 (189)
                      +.+||+|||++.+.++..                ...++++.+|++|+++|+|++||+||||||||.|++++..++++++
T Consensus       196 ~~~g~~spl~~~~~~~~~----------------~~~~~v~~~v~~~~~~gvp~~KlvlGlp~YG~~~~~~~~~~~~~g~  259 (362)
T cd02872         196 GVTGHNSPLYAGSADTGD----------------QKYLNVDYAIKYWLSKGAPPEKLVLGIPTYGRSFTLASPSNTGVGA  259 (362)
T ss_pred             CCCCCCCCCCCCCCCccc----------------cccccHHHHHHHHHHcCCCHHHeEeccccccceeeecCCccCCCCC
Confidence            999999999986654321                1123499999999999999999999999999999999888899999


Q ss_pred             cccCCCCCCCCCCCCcceeHHHHHhhc
Q psy4440         159 LTVGPGLPGPFTQSPGFMAYYEVSHRQ  185 (189)
Q Consensus       159 ~~~g~g~~g~~t~~~G~~~Y~eIc~~l  185 (189)
                      |+.|+|.+|.++.++|+++|.|||+++
T Consensus       260 ~~~g~~~~g~~~~~~g~~~y~ei~~~~  286 (362)
T cd02872         260 PASGPGTAGPYTREAGFLAYYEICEFL  286 (362)
T ss_pred             ccCCCCCCCCCcCCCccchHHHHHHhh
Confidence            999999999999999999999999987

The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the la
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit Back     alignment and domain information
>KOG2806|consensus Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information
>COG3858 Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>KOG2091|consensus Back     alignment and domain information
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L Back     alignment and domain information
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii Back     alignment and domain information
>cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1guv_A366 Structure Of Human Chitotriosidase Length = 366 4e-21
1waw_A 445 Specificity And Affinity Of Natural Product Cyclope 5e-21
1lg1_A365 Crystal Structure Of Human Chitotriosidase In Compl 5e-21
1hkk_A364 High Resoultion Crystal Structure Of Human Chitinas 6e-21
1hki_A365 Crystal Structure Of Human Chitinase In Complex Wit 7e-21
1hjv_A362 Crystal Structure Of Hcgp-39 In Complex With Chitin 6e-20
4ay1_A365 Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch 7e-20
3fxy_A 395 Acidic Mammalian Chinase, Catalytic Domain Length = 4e-18
2ybt_A381 Crystal Structure Of Human Acidic Chitinase In Comp 5e-18
1xhg_A361 Crystal Structure Of A 40 Kda Signalling Protein Fr 9e-18
2pi6_A361 Crystal Structure Of The Sheep Signalling Glycoprot 4e-17
1syt_A361 Crystal Structure Of Signalling Protein From Goat S 7e-17
2esc_A361 Crystal Structure Of A 40 Kda Protective Signalling 7e-17
1ljy_A361 Crystal Structure Of A Novel Regulatory 40 Kda Mamm 9e-17
1sr0_A361 Crystal Structure Of Signalling Protein From Sheep( 1e-16
1zbv_A361 Crystal Structure Of The Goat Signalling Protein (S 3e-16
1owq_A361 Crystal Structure Of A 40 Kda Signalling Protein (S 3e-16
1e9l_A377 The Crystal Structure Of Novel Mammalian Lectin Ym1 4e-16
1tfv_A361 Crystal Structure Of A Buffalo Signaling Glycoprote 1e-15
3alg_A353 Crystal Structure Of Class V Chitinase (E115q Mutan 7e-09
3alf_A353 Crystal Structure Of Class V Chitinase From Nicotia 7e-09
1ll7_A392 Structure Of The E171q Mutant Of C. Immitis Chitina 6e-08
1d2k_A392 C. Immitis Chitinase 1 At 2.2 Angstroms Resolution 6e-08
1ll6_A392 Structure Of The D169n Mutant Of C. Immitis Chitina 6e-08
3g6l_A406 The Crystal Structure Of A Chitinase Crchi1 From Th 9e-08
3aqu_A356 Crystal Structure Of A Class V Chitinase From Arabi 3e-06
1jnd_A420 Crystal Structure Of Imaginal Disc Growth Factor-2 9e-06
1itx_A419 Catalytic Domain Of Chitinase A1 From Bacillus Circ 8e-05
1wno_A395 Crystal Structure Of A Native Chitinase From Asperg 1e-04
1w9p_A433 Specificity And Affinity Of Natural Product Cyclope 1e-04
>pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 Back     alignment and structure 
Iteration: 1

 Score = 97.4 bits (241), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 74/130 (56%), Gaps = 16/130 (12%)
Query: 52  SSYNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSH 111
           + Y V  +A+ LD+V ++++D+ G W+  TGH +PLY+ Q++   + +  V         
Sbjct: 172 AGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNV--------- 222
Query: 112 IDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQ 171
                  ++ +  W+ KG PA K+I+GMP Y ++F LA S+   + A   G G PGPFT+
Sbjct: 223 -------DAAVQQWLEKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTK 275
Query: 172 SPGFMAYYEV 181
             G +AYYEV
Sbjct: 276 EGGMLAYYEV 285
>pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 Back     alignment and structure
>pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 Back     alignment and structure
>pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 Back     alignment and structure
>pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 Back     alignment and structure
>pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 Back     alignment and structure
>pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 Back     alignment and structure
>pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 Back     alignment and structure
>pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 Back     alignment and structure
>pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 Back     alignment and structure
>pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 Back     alignment and structure
>pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 Back     alignment and structure
>pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 Back     alignment and structure
>pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 Back     alignment and structure
>pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 Back     alignment and structure
>pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 Back     alignment and structure
>pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 Back     alignment and structure
>pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 Back     alignment and structure
>pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 Back     alignment and structure
>pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 Back     alignment and structure
>pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 Back     alignment and structure
>pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 Back     alignment and structure
>pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 Back     alignment and structure
>pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 Back     alignment and structure
>pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 Back     alignment and structure
>pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 Back     alignment and structure
>pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1wb0_A 445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 7e-42
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 4e-41
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 6e-41
3fy1_A 395 Amcase, TSA1902, acidic mammalian chitinase; struc 9e-41
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 1e-39
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 6e-38
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 2e-34
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 2e-34
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 2e-31
1goi_A 499 Chitinase B; chitin degradation, hydrolase, glycos 2e-30
3oa5_A 574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 8e-30
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 1e-28
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 1e-28
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 2e-28
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 2e-28
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 2e-28
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 7e-27
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 3e-25
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 6e-20
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 5e-18
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 1e-17
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 1e-14
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 2e-04
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 Back     alignment and structure
 Score =  144 bits (366), Expect = 7e-42
 Identities = 57/188 (30%), Positives = 92/188 (48%), Gaps = 47/188 (25%)

Query: 1   MKELSFAFKPR-------QLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSS 53
           +++L+ AF+         +L LSA V   QT +D                        + 
Sbjct: 138 VQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVD------------------------AG 173

Query: 54  YNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHID 113
           Y V  +A+ LD+V ++++D+ G W+  TGH +PLY+ Q++   + +  V           
Sbjct: 174 YEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNV----------- 222

Query: 114 NHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNSHGLNALTVGPGLPGPFTQSP 173
                ++ +  W+ KG PA K+I+GMP Y ++F LA S+   + A   G G PGPFT+  
Sbjct: 223 -----DAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEG 277

Query: 174 GFMAYYEV 181
           G +AYYEV
Sbjct: 278 GMLAYYEV 285
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 100.0
3fy1_A 395 Amcase, TSA1902, acidic mammalian chitinase; struc 100.0
1wb0_A 445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 100.0
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 100.0
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 100.0
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 100.0
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 99.97
1goi_A 499 Chitinase B; chitin degradation, hydrolase, glycos 99.97
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 99.97
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 99.97
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 99.97
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 99.97
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 99.97
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 99.96
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 99.95
3oa5_A 574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 99.95
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 99.95
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 99.95
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 99.91
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 99.91
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 99.89
1nar_A290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 99.68
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 99.39
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 99.28
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 99.22
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 99.12
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 99.07
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 99.04
2hvm_A273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 98.97
2gsj_A271 Protein PPL-2; mimosoideae, chimerolectin, endochi 98.85
2xtk_A310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 98.8
2uy2_A294 Endochitinase; carbohydrate metabolism, polysaccha 98.71
1eok_A290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 98.62
1cnv_A299 Concanavalin B; plant chitinase, chitin binding pr 98.31
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 98.28
1ta3_A274 XIP-1, xylanase inhibitor protein I; beta alpha ba 97.86
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 97.74
2ebn_A289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 96.53
3mu7_A273 XAIP-II, xylanase and alpha-amylase inhibitor prot 96.38
2dsk_A311 Chitinase; catalytic domain, active domain, crysta 95.66
3poh_A451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 91.22
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
Probab=100.00  E-value=2.1e-35  Score=261.34  Aligned_cols=148  Identities=34%  Similarity=0.609  Sum_probs=130.0

Q ss_pred             ChhHHhhcC-------CCCcEEEEEeCCCcchhhhhhchhhhhhhhhhHHHhhhcccccccchhhhcccCcEEEEeeccC
Q psy4440           1 MKELSFAFK-------PRQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDY   73 (189)
Q Consensus         1 lkeLr~al~-------~~~~~Ls~av~~~~~~~~~~y~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~vD~invMtYD~   73 (189)
                      |+|||++|+       +.+++||+|+|+.+..++.+||++.|.                        ++|||||||||||
T Consensus       138 l~eLr~~l~~~~~~~~~~~~~Ls~a~~~~~~~~~~~~d~~~l~------------------------~~vD~inlMtYD~  193 (377)
T 1vf8_A          138 VKEMRKAFEEESVEKDIPRLLLTSTGAGIIDVIKSGYKIPELS------------------------QSLDYIQVMTYDL  193 (377)
T ss_dssp             HHHHHHHHHHHHHHHTSCCCEEEEEECSSHHHHHHHCCHHHHH------------------------HHCSEEEECCCCC
T ss_pred             HHHHHHHHHhhhhccCCCceEEEEEccCCHHHHhccCCHHHHH------------------------hhCcEEEEEeecc
Confidence            589999998       568999999999887666567777766                        9999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCcccccccccCCCCcchhhHHHHHHHHHHcCCCCCceeeeccceeeeeeeccCCC
Q psy4440          74 SGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADSNS  153 (189)
Q Consensus        74 ~g~w~~~tg~~apL~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~v~~~v~~~~~~Gvp~~KlvlGip~YGr~~~l~~~~~  153 (189)
                      ||+|+..+||+|||+..+.++..                ...++++.+|++|+++|+|++||+||||||||+|++.++.+
T Consensus       194 ~g~w~~~~g~~apl~~~~~~~~~----------------~~~~~v~~~v~~~~~~gvp~~KlvlGip~YGr~~~~~~~~~  257 (377)
T 1vf8_A          194 HDPKDGYTGENSPLYKSPYDIGK----------------SADLNVDSIISYWKDHGAASEKLIVGFPAYGHTFILSDPSK  257 (377)
T ss_dssp             SCGGGSBCCCSSCSSCCTTCCGG----------------GGGCSHHHHHHHHHHTTCCGGGEEEEEESEEEEEEESCTTC
T ss_pred             cCCCCCCCCCCCCCCCCCCCccc----------------cccccHHHHHHHHHHcCCCHHHEEEEecccceeeEcccCCC
Confidence            99999999999999987655321                11223999999999999999999999999999999999888


Q ss_pred             CCCCCcccCCCCCCCCCCCCcceeHHHHHhhccCC
Q psy4440         154 HGLNALTVGPGLPGPFTQSPGFMAYYEVSHRQTTP  188 (189)
Q Consensus       154 ~~~~~~~~g~g~~g~~t~~~G~~~Y~eIc~~l~~~  188 (189)
                      +++++|+.|++.+|++|.++|+++|.|||++++++
T Consensus       258 ~~~g~p~~g~~~~g~~t~~~G~~~y~ei~~~~~~g  292 (377)
T 1vf8_A          258 TGIGAPTISTGPPGKYTDESGLLAYYEVCTFLNEG  292 (377)
T ss_dssp             CSTTCBEEEECCCCTTTCCTTEEEHHHHHHHHHTT
T ss_pred             CCCCCcCCCCCCCCCccCcCceecHHHHHHHHhcC
Confidence            99999999999999999999999999999987643
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Back     alignment and structure
>2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Back     alignment and structure
>3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Back     alignment and structure
>2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1ll7a1330 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( 3e-23
d1w9pa1333 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil 2e-15
d1edqa2358 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt 1e-14
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 8e-13
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 1e-12
d1wb0a268 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo 4e-12
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 7e-12
d2pi6a268 d.26.3.1 (A:240-307) Signal processing protein (SP 1e-11
d1vf8a270 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo 4e-11
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 3e-10
d1jnda1327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 5e-10
d1kfwa1374 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina 7e-10
d1jnda292 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 2e-09
d1goia2356 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic 4e-07
d1nara_289 c.1.8.5 (A:) Seed storage protein {Vicia narbonens 4e-06
d2ebna_285 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 0.001
d1itxa272 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul 0.001
d1edta_265 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St 0.002
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Chitinase 1
species: Fungus (Coccidioides immitis) [TaxId: 5501]

 Score = 92.2 bits (228), Expect = 3e-23
 Identities = 31/166 (18%), Positives = 58/166 (34%), Gaps = 39/166 (23%)

Query: 37  KYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFDYSGYWDGATGHVAPLYQSQDDQYH 96
           K+L  +        Y+   +  + KYLD+  ++++D+SG WD  +GH++ ++ S      
Sbjct: 170 KFLLTIASPAGPQNYNKLKLAEMDKYLDFWNLMAYDFSGSWDKVSGHMSNVFPSTTKPE- 228

Query: 97  SVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFIL-------- 148
                                 +  +  +I  G+PA K+++GMPL               
Sbjct: 229 ----------------STPFSSDKAVKDYIKAGVPANKIVLGMPLDTVKIAGKKAEYITK 272

Query: 149 --------------ADSNSHGLNALTVGPGLPGPFTQSPGFMAYYE 180
                            N   +  +  G G  G   Q    ++Y E
Sbjct: 273 NGMGGGMWWESSSDKTGNESLVGTVVNGLGGTGKLEQRENELSYPE 318
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 Back     information, alignment and structure
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 Back     information, alignment and structure
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 Back     information, alignment and structure
>d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1ll7a1330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 99.95
d1w9pa1333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 99.92
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 99.89
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 99.87
d1vf8a1302 Chitinase-like lectin ym1, saccharide binding doma 99.83
d2pi6a1292 Signal processing protein (SPC-40, MGP-40) {Sheep 99.82
d1wb0a1297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 99.82
d1itxa1347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 99.8
d1jnda1327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 99.79
d1vf8a270 Chitinase-like lectin ym1 {Mouse (Mus musculus) [T 99.49
d1wb0a268 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 99.43
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 99.42
d2pi6a268 Signal processing protein (SPC-40, MGP-40) {Sheep 99.41
d1jnda292 Imaginal disc growth factor-2 {Fruit fly (Drosophi 99.34
d1nara_289 Seed storage protein {Vicia narbonensis, Narbonin 99.24
d2hvma_273 Hevamine A (chitinase/lysozyme) {Para rubber tree 98.82
d1itxa272 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 98.8
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 98.56
d1edqa373 Chitinase A {Serratia marcescens [TaxId: 615]} 98.47
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 98.21
d1ta3a_274 Xylanase inhibitor protein I, XIP-I {Wheat (Tritic 98.16
d1cnva_283 Seed storage protein {Jack bean (Canavalia ensifor 98.12
d1kfwa261 Psychrophilic chitinase B {Arthrobacter sp., tad20 98.07
d1ll7a262 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 96.5
d1w9pa262 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 96.46
d1goia388 Chitinase B {Serratia marcescens [TaxId: 615]} 96.15
d1eoka_282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 94.71
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Chitinase 1
species: Fungus (Coccidioides immitis) [TaxId: 5501]

Probab=99.95  E-value=3.8e-30  Score=221.93  Aligned_cols=146  Identities=22%  Similarity=0.420  Sum_probs=117.9

Q ss_pred             ChhHHhhcC--------CCCcEEEEEeCCCcchhhhhhchhhhhhhhhhHHHhhhcccccccchhhhcccCcEEEEeecc
Q psy4440           1 MKELSFAFK--------PRQLSLSAVVSPSQTIIDQAYNVKSLAKYLDWVTVLLKSSAYSSYNVKSLAKYLDWVTVLSFD   72 (189)
Q Consensus         1 lkeLr~al~--------~~~~~Ls~av~~~~~~~~~~y~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~vD~invMtYD   72 (189)
                      |+|||++|+        .+.++||+++|+.+...+ .|+++++.                        ++||||||||||
T Consensus       151 l~~lr~~l~~~~~~~~~g~~~~lt~a~~~~~~~~~-~~~~~~l~------------------------~~vD~invmtYD  205 (330)
T d1ll7a1         151 LKACREALDAYSAKHPNGKKFLLTIASPAGPQNYN-KLKLAEMD------------------------KYLDFWNLMAYD  205 (330)
T ss_dssp             HHHHHHHHHHHHHTSTTSCCCEEEEEEECSHHHHT-TSCHHHHH------------------------TTCSEEEEECCC
T ss_pred             HHHHHHHHHHHHHHhhcCCceeEEEeccCChHhhc-cccHHHHh------------------------hcCCEEEEEEee
Confidence            478888884        356899999999877553 46666666                        999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCcccccccccCCCCcchhhHHHHHHHHHHcCCCCCceeeeccceeeeeeeccC-
Q psy4440          73 YSGYWDGATGHVAPLYQSQDDQYHSVNTIVPVCRCSQSHIDNHHLLNSNINYWISKGMPARKVIMGMPLYAQTFILADS-  151 (189)
Q Consensus        73 ~~g~w~~~tg~~apL~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~v~~~v~~~~~~Gvp~~KlvlGip~YGr~~~l~~~-  151 (189)
                      |||.|++.+||+|||+..+.++..                 ..++++.+|++|+++|+|++||+||||||||.|..... 
T Consensus       206 ~~g~w~~~tg~~s~l~~~~~~~~~-----------------~~~sv~~av~~~~~~Gvp~~KlvlGiP~ygr~~~~~k~~  268 (330)
T d1ll7a1         206 FSGSWDKVSGHMSNVFPSTTKPES-----------------TPFSSDKAVKDYIKAGVPANKIVLGMPLDTVKIAGKKAE  268 (330)
T ss_dssp             SSSTTSSBCCCSSCSSCCSSCGGG-----------------CSCCHHHHHHHHHHTTCCGGGEEEEEESCCHHHHHHHHH
T ss_pred             ccCCCCCCCCcCcccCCCcCCCCC-----------------CCccHHHHHHHHHHCCCCHHHeEEEecCCCchhhhhhhH
Confidence            999999999999999987655421                 12339999999999999999999999999999865421 


Q ss_pred             ---------------------CCCCCCCcccCCCCCCCCCCCCcceeHHH-HHhhccCC
Q psy4440         152 ---------------------NSHGLNALTVGPGLPGPFTQSPGFMAYYE-VSHRQTTP  188 (189)
Q Consensus       152 ---------------------~~~~~~~~~~g~g~~g~~t~~~G~~~Y~e-Ic~~l~~~  188 (189)
                                           +.+-+++.+.++|.+|++|.++|.++|+| +|+.++++
T Consensus       269 ~~~~~g~gG~m~We~~~D~~g~~sl~~a~~~~~g~~g~~~~~~~~l~y~~~~~~~~~~g  327 (330)
T d1ll7a1         269 YITKNGMGGGMWWESSSDKTGNESLVGTVVNGLGGTGKLEQRENELSYPESVYDNLKNG  327 (330)
T ss_dssp             HHHHTTCCEEEEECTTSCCCGGGCHHHHHHHHTTCGGGBCCCCCCCCCTTCSCHHHHTT
T ss_pred             hHhhcCCCceEEEeeccCCCCCcccccccccCCCCCCcccccCCeecccHHHhHHHHcC
Confidence                                 11112345668888999999999999999 99999875
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure