Psyllid ID: psy4476


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MELPVGHTCVELHALDAGDELKLAATSYDASTPGSGPRSRGLRFRIILPVTEVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGMNQRSNGLHHQPGGAGIGNSANTNRLRNKSNLNHRPSGANKLSQGHLSQGNNSQEITQPYSQVMSQGGGFSLSQADLSQDSLMMSQLDGMLSQESAYLDHRPPYSNTHYSQ
cccccccccccccccccccEEEEEEEccccccccccccEEEEEEEEcccccEEEEEEccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccc
ccccccccHHHHHHHccccEEEEEEcccccccccccccccEEEEEEEccccEEEEEEEcccccccccccccEEEEEEEEcccHHHHHHHHHHHccccccHHHHHHHHHccccccccEEcccccccccccccccccHHHHHHHHHHHHcccEEEccccccccccccccccccccccccccEEEcccccccccccccccccccEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccc
melpvghtcvelhaldagdELKLAATsydastpgsgprsrglrfriILPVTEVGLelkssagaptesyhglfcgpsfwkstsFDRMQLALRKFAVDDQSVSAYIYHRLLGhnvdevlfrchlpkhfsapnlpdlnrsqVYAVKHAIQRPLSLIQgmnqrsnglhhqpggagignsantnrlrnksnlnhrpsganklsqghlsqgnnsqeitqpysqvmsqgggfslsqadlsqDSLMMSQLDGmlsqesayldhrppysnthysq
MELPVGHTCVELHALDAGDELKLAATSydastpgsgprsrglrFRIILPVTEVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGMNQRSNGLHHQPGGAGIGNSANTNRLRNKSNLNHRPSGANKLSQGHLSQGNNSQEITQPYSQVMSQGGGFSLSQADLSQDSLMMSQLDGMLSQEsayldhrppysnthysq
MELPVGHTCVELHALDAGDELKLAATSYDASTPGSGPRSRGLRFRIILPVTEVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGMNQRSNGLHHQPGGAGIGNSANTNRLRNKSNLNHRPSGANKLSQGHLSQGNNSQEITQPYSQVMSQGGGFslsqadlsqdslMMSQLDGMLSQESAYLDHRPPYSNTHYSQ
******HTCVELHALDAGD*L*******************GLRFRIILPVTEVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLI*****************************************************************************************************************
**LP*G*TCVELHALDAGDELKLAATSYDASTPGSGPRSRGLRFRIILPVTEVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGMNQR***********************************************************************************************************
MELPVGHTCVELHALDAGDELKLAATS************RGLRFRIILPVTEVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGMNQRSNGLHHQPGGAGIGNSANTNRLRNKSNLNHRPSG*************NSQEITQPYSQVMSQGGGFSLSQADLSQDSLMMSQLDGMLSQESAYLDHRPP********
***PVGHTCVELHALDAGDELKLAATSYDASTPGSGPRSRGLRFRIILPVTEVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGMNQRSNGLHHQPGGAGIGNSANTN**R*********************************************************S*L***LSQE*AYLDHRPPYS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELPVGHTCVELHALDAGDELKLAATSYDASTPGSGPRSRGLRFRIILPVTEVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGMNQRSNGLHHQPGGAGIGNSANTNRLRNKSNLNHRPSGANKLSQGHLSQGNNSQEITQPYSQVMSQGGGFSLSQADLSQDSLMMSQLDGMLSQESAYLDHRPPYSNTHYSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query266 2.2.26 [Sep-21-2011]
Q92900 1129 Regulator of nonsense tra yes N/A 0.447 0.105 0.577 3e-33
Q9EPU0 1124 Regulator of nonsense tra yes N/A 0.447 0.105 0.577 4e-33
Q98TR3 1097 Putative regulator of non N/A N/A 0.447 0.108 0.560 8e-32
Q9VYS3 1180 Regulator of nonsense tra yes N/A 0.387 0.087 0.657 6e-30
Q9FJR0 1254 Regulator of nonsense tra yes N/A 0.511 0.108 0.496 4e-27
Q9HEH1 1093 Regulator of nonsense tra N/A N/A 0.503 0.122 0.442 1e-24
Q09820 925 ATP-dependent helicase up yes N/A 0.511 0.147 0.471 6e-24
P30771 971 ATP-dependent helicase NA yes N/A 0.379 0.104 0.524 3e-23
O76512 1069 Regulator of nonsense tra yes N/A 0.511 0.127 0.361 1e-17
Q54I89 1331 Regulator of nonsense tra yes N/A 0.545 0.108 0.356 2e-13
>sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 Back     alignment and function desciption
 Score =  142 bits (357), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/123 (57%), Positives = 86/123 (69%), Gaps = 4/123 (3%)

Query: 36  GPRSRGLRFRIILPVT---EVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRK 92
            P  +G+   I +P     E+ +EL+SS GAP E  H  F     WKSTSFDRMQ AL+ 
Sbjct: 382 APLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHN-FQVDFVWKSTSFDRMQSALKT 440

Query: 93  FAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSL 152
           FAVD+ SVS YIYH+LLGH V++V+ +C LPK F+A  LPDLN SQVYAVK  +QRPLSL
Sbjct: 441 FAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSL 500

Query: 153 IQG 155
           IQG
Sbjct: 501 IQG 503




RNA-dependent helicase and ATPase required for nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD. Recruited by release factors to stalled ribosomes together with the SMG1C protein kinase complex to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) (located 50-55 or more nucleotides downstream from the termination codon) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Phosphorylated UPF1 is recognized by EST1B/SMG5, SMG6 and SMG7 which are thought to provide a link to the mRNA degradation machinery involving exonucleolytic and endonucleolytic pathways, and to serve as adapters to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation and allowing the recycling of NMD factors. UPF1 can also activate NMD without UPF2 or UPF3, and in the absence of the NMD-enhancing downstream EJC indicative for alternative NMD pathways. Plays a role in replication-dependent histone mRNA degradation at the end of phase S; the function is independent of UPF2. For the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. The ATPase activity of UPF1 is required for disassembly of mRNPs undergoing NMD. Essential for embryonic viability.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 Back     alignment and function description
>sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 Back     alignment and function description
>sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 Back     alignment and function description
>sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 Back     alignment and function description
>sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 Back     alignment and function description
>sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 Back     alignment and function description
>sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 Back     alignment and function description
>sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 Back     alignment and function description
>sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query266
345491348 1121 PREDICTED: regulator of nonsense transcr 0.387 0.091 0.836 2e-43
345491346 1127 PREDICTED: regulator of nonsense transcr 0.387 0.091 0.836 2e-43
345491350 1105 PREDICTED: regulator of nonsense transcr 0.387 0.093 0.836 2e-43
332029845 838 Putative regulator of nonsense transcrip 0.387 0.122 0.826 7e-43
350406738 1106 PREDICTED: regulator of nonsense transcr 0.387 0.093 0.817 9e-43
340721325 1106 PREDICTED: regulator of nonsense transcr 0.387 0.093 0.817 9e-43
340721321 1119 PREDICTED: regulator of nonsense transcr 0.387 0.092 0.817 1e-42
66553048 1119 PREDICTED: regulator of nonsense transcr 0.387 0.092 0.817 1e-42
383847285 1119 PREDICTED: regulator of nonsense transcr 0.387 0.092 0.817 1e-42
383847287 1106 PREDICTED: regulator of nonsense transcr 0.387 0.093 0.817 1e-42
>gi|345491348|ref|XP_003426578.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/104 (83%), Positives = 92/104 (88%), Gaps = 1/104 (0%)

Query: 52  EVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGH 111
           EVG+ELK+++GAPTE     F     WKSTSFDRMQLALRKFAVDD SVSAYIYHRLLGH
Sbjct: 375 EVGIELKNNSGAPTECTSN-FVVDFIWKSTSFDRMQLALRKFAVDDTSVSAYIYHRLLGH 433

Query: 112 NVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQG 155
            V+EVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQG
Sbjct: 434 EVEEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQG 477




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345491346|ref|XP_003426577.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345491350|ref|XP_001604124.2| PREDICTED: regulator of nonsense transcripts 1-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332029845|gb|EGI69714.1| Putative regulator of nonsense transcripts 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350406738|ref|XP_003487866.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721325|ref|XP_003399073.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340721321|ref|XP_003399071.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|66553048|ref|XP_393330.2| PREDICTED: regulator of nonsense transcripts 1 [Apis mellifera] gi|380015761|ref|XP_003691864.1| PREDICTED: regulator of nonsense transcripts 1-like [Apis florea] Back     alignment and taxonomy information
>gi|383847285|ref|XP_003699285.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383847287|ref|XP_003699286.1| PREDICTED: regulator of nonsense transcripts 1-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query266
ZFIN|ZDB-GENE-040426-2836 1100 upf1 "upf1 regulator of nonsen 0.387 0.093 0.653 1.2e-33
UNIPROTKB|E1C0J4 1117 UPF1 "Uncharacterized protein" 0.387 0.092 0.644 3.3e-33
UNIPROTKB|E1BEK9 1127 UPF1 "Uncharacterized protein" 0.387 0.091 0.644 3.4e-33
UNIPROTKB|E1C0J3 1128 UPF1 "Uncharacterized protein" 0.387 0.091 0.644 3.4e-33
UNIPROTKB|Q92900 1129 UPF1 "Regulator of nonsense tr 0.387 0.091 0.644 3.4e-33
UNIPROTKB|E2RL81 1130 UPF1 "Uncharacterized protein" 0.387 0.091 0.644 3.4e-33
MGI|MGI:107995 1124 Upf1 "UPF1 regulator of nonsen 0.387 0.091 0.644 5.5e-33
FB|FBgn0030354 1180 Upf1 "Upf1" [Drosophila melano 0.387 0.087 0.657 5.4e-27
UNIPROTKB|G4ND47 1105 MGG_00976 "Regulator-nonsense 0.503 0.121 0.462 2e-26
TAIR|locus:2171007 1254 LBA1 "LOW-LEVEL BETA-AMYLASE 1 0.5 0.106 0.5 1.1e-25
ZFIN|ZDB-GENE-040426-2836 upf1 "upf1 regulator of nonsense transcripts homolog (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 346 (126.9 bits), Expect = 1.2e-33, Sum P(2) = 1.2e-33
 Identities = 68/104 (65%), Positives = 80/104 (76%)

Query:    52 EVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGH 111
             E+ +EL+SSAGAP E  H  F     WKSTSFDRMQ AL+ FAVD+ SVS YIYH+LLGH
Sbjct:   370 EIAIELRSSAGAPVEVPHN-FQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGH 428

Query:   112 NVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQG 155
              V++V+ +C LPK F+A  LPDLN SQVYAVK  +QRPLSLIQG
Sbjct:   429 EVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQG 472


GO:0003677 "DNA binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000184 "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay" evidence=IEA;IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0009790 "embryo development" evidence=IMP
UNIPROTKB|E1C0J4 UPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BEK9 UPF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0J3 UPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q92900 UPF1 "Regulator of nonsense transcripts 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RL81 UPF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:107995 Upf1 "UPF1 regulator of nonsense transcripts homolog (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0030354 Upf1 "Upf1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G4ND47 MGG_00976 "Regulator-nonsense transcripts 1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2171007 LBA1 "LOW-LEVEL BETA-AMYLASE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q92900RENT1_HUMAN3, ., 6, ., 4, ., -0.57720.44730.1054yesN/A
Q9EPU0RENT1_MOUSE3, ., 6, ., 4, ., -0.57720.44730.1058yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 266
KOG1802|consensus 935 100.0
TIGR00376 637 DNA helicase, putative. The gene product may repre 99.92
KOG1803|consensus 649 99.9
PRK10875 615 recD exonuclease V subunit alpha; Provisional 99.87
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 99.76
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 99.69
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 99.56
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 99.52
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 99.39
PF1324576 AAA_19: Part of AAA domain 99.34
PRK13889 988 conjugal transfer relaxase TraA; Provisional 99.31
KOG1805|consensus 1100 99.22
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 99.2
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 99.19
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 99.15
PRK13826 1102 Dtr system oriT relaxase; Provisional 99.14
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 98.88
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 98.8
COG0507 696 RecD ATP-dependent exoDNAse (exonuclease V), alpha 98.57
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 98.43
KOG1807|consensus 1025 98.43
PRK11054 684 helD DNA helicase IV; Provisional 98.38
smart00487201 DEXDc DEAD-like helicases superfamily. 98.21
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 98.19
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 98.12
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 98.09
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 98.09
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 97.95
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.79
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.68
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.66
PRK10536262 hypothetical protein; Provisional 97.66
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 97.48
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.44
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 97.4
KOG0989|consensus 346 97.38
smart00382148 AAA ATPases associated with a variety of cellular 97.36
PTZ00424 401 helicase 45; Provisional 97.14
PRK08181269 transposase; Validated 97.03
PRK12377248 putative replication protein; Provisional 97.02
PRK07952244 DNA replication protein DnaC; Validated 97.0
COG0507 696 RecD ATP-dependent exoDNAse (exonuclease V), alpha 96.94
PF00004132 AAA: ATPase family associated with various cellula 96.93
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 96.93
KOG0744|consensus 423 96.91
PHA02558 501 uvsW UvsW helicase; Provisional 96.86
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 96.78
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 96.76
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 96.74
KOG1806|consensus 1320 96.67
KOG1804|consensus 775 96.66
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 96.65
PRK06526254 transposase; Provisional 96.63
PLN03025 319 replication factor C subunit; Provisional 96.62
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.59
PRK06851 367 hypothetical protein; Provisional 96.54
KOG2028|consensus 554 96.5
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.46
PRK05580 679 primosome assembly protein PriA; Validated 96.42
PRK09183259 transposase/IS protein; Provisional 96.39
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 96.39
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.37
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.36
PRK13833323 conjugal transfer protein TrbB; Provisional 96.3
PRK12402 337 replication factor C small subunit 2; Reviewed 96.29
PRK06893229 DNA replication initiation factor; Validated 96.28
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.27
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 96.24
PRK08084235 DNA replication initiation factor; Provisional 96.22
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 96.21
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 96.2
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.18
KOG0991|consensus 333 96.17
PRK04296190 thymidine kinase; Provisional 96.12
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.11
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 96.11
PRK01172 674 ski2-like helicase; Provisional 96.09
PRK04195 482 replication factor C large subunit; Provisional 96.08
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.04
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 96.04
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.03
TIGR02533 486 type_II_gspE general secretory pathway protein E. 96.0
COG2256 436 MGS1 ATPase related to the helicase subunit of the 95.99
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.95
cd03115173 SRP The signal recognition particle (SRP) mediates 95.95
PRK08116268 hypothetical protein; Validated 95.94
PRK00411 394 cdc6 cell division control protein 6; Reviewed 95.94
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 95.93
COG1936180 Predicted nucleotide kinase (related to CMP and AM 95.91
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.91
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.91
KOG0743|consensus 457 95.89
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.87
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.87
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.86
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.84
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.83
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 95.82
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 95.8
PRK03992 389 proteasome-activating nucleotidase; Provisional 95.76
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 95.74
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.72
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.71
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.69
PF05729166 NACHT: NACHT domain 95.66
PRK00440 319 rfc replication factor C small subunit; Reviewed 95.65
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.65
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.62
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 95.61
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.6
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 95.6
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 95.59
PRK10436 462 hypothetical protein; Provisional 95.56
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 95.54
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 95.54
CHL00181 287 cbbX CbbX; Provisional 95.53
PRK08727233 hypothetical protein; Validated 95.52
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 95.51
COG3973 747 Superfamily I DNA and RNA helicases [General funct 95.49
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 95.47
PRK02362 737 ski2-like helicase; Provisional 95.45
PHA00729226 NTP-binding motif containing protein 95.43
PRK06835329 DNA replication protein DnaC; Validated 95.4
PTZ00110 545 helicase; Provisional 95.38
PRK06921266 hypothetical protein; Provisional 95.37
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 95.36
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 95.34
PTZ00112 1164 origin recognition complex 1 protein; Provisional 95.34
PRK14974336 cell division protein FtsY; Provisional 95.33
PRK00254 720 ski2-like helicase; Provisional 95.32
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 95.32
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.31
PHA02653 675 RNA helicase NPH-II; Provisional 95.31
PRK10689 1147 transcription-repair coupling factor; Provisional 95.28
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.28
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.26
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 95.26
PRK13342 413 recombination factor protein RarA; Reviewed 95.25
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.24
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 95.22
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 95.21
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 95.19
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 95.19
PRK06851367 hypothetical protein; Provisional 95.18
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.18
PRK13531 498 regulatory ATPase RavA; Provisional 95.17
PHA02544 316 44 clamp loader, small subunit; Provisional 95.16
PRK06620214 hypothetical protein; Validated 95.16
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 95.16
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 95.14
KOG0651|consensus 388 95.1
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 95.08
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 95.05
PRK13767 876 ATP-dependent helicase; Provisional 95.03
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 95.03
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexame 95.0
cd01394218 radB RadB. The archaeal protein radB shares simila 94.99
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.98
PRK09401 1176 reverse gyrase; Reviewed 94.96
PRK09361225 radB DNA repair and recombination protein RadB; Pr 94.95
PF1355562 AAA_29: P-loop containing region of AAA domain 94.94
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 94.91
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 94.91
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 94.89
TIGR00064272 ftsY signal recognition particle-docking protein F 94.87
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.86
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 94.84
PRK10867 433 signal recognition particle protein; Provisional 94.83
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 94.82
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 94.81
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 94.78
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 94.78
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 94.78
PRK10416318 signal recognition particle-docking protein FtsY; 94.75
PRK05973237 replicative DNA helicase; Provisional 94.75
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 94.7
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 94.68
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.65
PRK00771 437 signal recognition particle protein Srp54; Provisi 94.63
PRK13341 725 recombination factor protein RarA/unknown domain f 94.62
KOG1801|consensus 827 94.62
PRK08939306 primosomal protein DnaI; Reviewed 94.6
PRK04328 249 hypothetical protein; Provisional 94.59
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 94.59
KOG0741|consensus 744 94.57
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 94.57
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.54
TIGR02237209 recomb_radB DNA repair and recombination protein R 94.53
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.52
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 94.52
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 94.52
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 94.5
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 94.5
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 94.46
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 94.43
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.42
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 94.41
PRK14088 440 dnaA chromosomal replication initiation protein; P 94.41
COG0552340 FtsY Signal recognition particle GTPase [Intracell 94.41
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.41
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 94.39
KOG0987|consensus 540 94.37
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 94.35
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.34
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.34
PHA02624 647 large T antigen; Provisional 94.33
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 94.32
KOG1970|consensus 634 94.26
PRK00149 450 dnaA chromosomal replication initiation protein; R 94.25
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 94.2
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 94.16
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 94.16
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 94.15
PRK06067234 flagellar accessory protein FlaH; Validated 94.13
PRK14701 1638 reverse gyrase; Provisional 94.13
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 94.12
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 94.12
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.11
CHL00195 489 ycf46 Ycf46; Provisional 94.1
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 94.1
COG0714 329 MoxR-like ATPases [General function prediction onl 94.07
TIGR02773 1158 addB_Gpos ATP-dependent nuclease subunit B. DNA re 94.06
PF07726131 AAA_3: ATPase family associated with various cellu 94.05
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 94.03
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 94.02
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 94.02
PHA02244 383 ATPase-like protein 94.02
PRK05642234 DNA replication initiation factor; Validated 93.97
PRK14531183 adenylate kinase; Provisional 93.91
KOG3347|consensus176 93.91
TIGR00959 428 ffh signal recognition particle protein. This mode 93.89
PF13173128 AAA_14: AAA domain 93.85
COG1198 730 PriA Primosomal protein N' (replication factor Y) 93.84
KOG0738|consensus 491 93.84
PF01443 234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 93.79
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 93.77
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 93.75
PRK13768 253 GTPase; Provisional 93.75
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 93.74
PHA00547 337 hypothetical protein 93.74
KOG0731|consensus 774 93.74
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.71
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 93.71
KOG1533|consensus 290 93.7
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 93.69
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 93.67
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 93.66
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 93.58
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 93.57
PRK08233182 hypothetical protein; Provisional 93.56
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 93.5
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 93.5
PRK14532188 adenylate kinase; Provisional 93.5
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 93.5
PRK09435 332 membrane ATPase/protein kinase; Provisional 93.49
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 93.48
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 93.47
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 93.47
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 93.46
PRK03839180 putative kinase; Provisional 93.45
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.44
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.43
KOG0733|consensus 802 93.38
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 93.34
KOG0727|consensus 408 93.33
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 93.31
PRK08118167 topology modulation protein; Reviewed 93.3
PRK01184184 hypothetical protein; Provisional 93.28
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 93.25
CHL00176 638 ftsH cell division protein; Validated 93.25
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.16
PRK07940 394 DNA polymerase III subunit delta'; Validated 93.13
PRK13851344 type IV secretion system protein VirB11; Provision 93.12
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 93.11
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 93.07
PRK00131175 aroK shikimate kinase; Reviewed 93.05
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 93.03
PRK06762166 hypothetical protein; Provisional 93.01
PRK09087226 hypothetical protein; Validated 93.01
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 92.97
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 92.92
COG0606 490 Predicted ATPase with chaperone activity [Posttran 92.91
PRK14527191 adenylate kinase; Provisional 92.89
PLN02200234 adenylate kinase family protein 92.88
PRK14528186 adenylate kinase; Provisional 92.84
PRK04040188 adenylate kinase; Provisional 92.83
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 92.83
PRK13766 773 Hef nuclease; Provisional 92.81
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 92.81
PRK12422 445 chromosomal replication initiation protein; Provis 92.71
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 92.69
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 92.69
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 92.67
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 92.65
PRK14530215 adenylate kinase; Provisional 92.64
PF13479213 AAA_24: AAA domain 92.64
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 92.64
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 92.63
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 92.61
cd01393226 recA_like RecA is a bacterial enzyme which has rol 92.6
PRK13947171 shikimate kinase; Provisional 92.6
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 92.59
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 92.58
PRK02496184 adk adenylate kinase; Provisional 92.57
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 92.57
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 92.57
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 92.56
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 92.55
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 92.52
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 92.5
PRK14087 450 dnaA chromosomal replication initiation protein; P 92.48
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 92.48
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 92.47
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 92.42
PRK13765 637 ATP-dependent protease Lon; Provisional 92.42
cd03114148 ArgK-like The function of this protein family is u 92.4
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 92.37
KOG0962|consensus 1294 92.35
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 92.33
COG1618179 Predicted nucleotide kinase [Nucleotide transport 92.29
PRK07261171 topology modulation protein; Provisional 92.27
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 92.27
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 92.26
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 92.25
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 92.24
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 92.21
KOG0734|consensus 752 92.16
KOG0328|consensus 400 92.16
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 92.13
PRK11823 446 DNA repair protein RadA; Provisional 92.13
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 92.12
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 92.1
KOG0736|consensus 953 92.09
KOG0652|consensus 424 92.09
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 92.04
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 92.04
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 92.04
PRK00279215 adk adenylate kinase; Reviewed 92.03
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 91.97
PRK09302 509 circadian clock protein KaiC; Reviewed 91.92
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 91.83
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 91.81
TIGR02236310 recomb_radA DNA repair and recombination protein R 91.8
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 91.8
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 91.76
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 91.75
cd00983 325 recA RecA is a bacterial enzyme which has roles in 91.75
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 91.75
CHL00095 821 clpC Clp protease ATP binding subunit 91.74
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 91.74
PRK08154309 anaerobic benzoate catabolism transcriptional regu 91.71
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 91.67
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 91.65
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 91.63
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 91.58
PRK07667193 uridine kinase; Provisional 91.58
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 91.56
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 91.54
KOG0742|consensus 630 91.53
COG1137 243 YhbG ABC-type (unclassified) transport system, ATP 91.52
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 91.49
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 91.49
PRK12608 380 transcription termination factor Rho; Provisional 91.47
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 91.45
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 91.44
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 91.43
PRK13764 602 ATPase; Provisional 91.4
PRK04301317 radA DNA repair and recombination protein RadA; Va 91.38
PRK05541176 adenylylsulfate kinase; Provisional 91.37
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 91.34
PRK00625173 shikimate kinase; Provisional 91.33
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 91.31
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 91.3
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 91.3
PRK00889175 adenylylsulfate kinase; Provisional 91.29
PRK06547172 hypothetical protein; Provisional 91.28
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 91.26
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 91.25
KOG3928|consensus 461 91.25
PF12846 304 AAA_10: AAA-like domain 91.23
PHA02774613 E1; Provisional 91.21
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 91.19
PTZ00088 229 adenylate kinase 1; Provisional 91.13
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 91.11
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 91.08
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 91.07
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 90.99
PHA02530 300 pseT polynucleotide kinase; Provisional 90.99
PRK10865 857 protein disaggregation chaperone; Provisional 90.96
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 90.96
COG0410 237 LivF ABC-type branched-chain amino acid transport 90.96
PF03029 238 ATP_bind_1: Conserved hypothetical ATP binding pro 90.95
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 90.94
PHA03311 828 helicase-primase subunit BBLF4; Provisional 90.87
PRK14526211 adenylate kinase; Provisional 90.81
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 90.72
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 90.69
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 90.67
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 90.67
COG3911183 Predicted ATPase [General function prediction only 90.66
KOG0729|consensus 435 90.62
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 90.62
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 90.6
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 90.59
PRK09354 349 recA recombinase A; Provisional 90.58
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 90.58
PRK15455 644 PrkA family serine protein kinase; Provisional 90.57
PRK08356195 hypothetical protein; Provisional 90.54
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 90.53
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 90.52
cd03112158 CobW_like The function of this protein family is u 90.52
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 90.49
COG1112 767 Superfamily I DNA and RNA helicases and helicase s 90.46
PRK09376 416 rho transcription termination factor Rho; Provisio 90.41
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 90.36
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 90.35
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 90.32
PRK13949169 shikimate kinase; Provisional 90.32
PTZ00301210 uridine kinase; Provisional 90.32
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 90.3
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 90.27
KOG0990|consensus 360 90.22
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 90.08
PRK15453 290 phosphoribulokinase; Provisional 90.04
PRK10865 857 protein disaggregation chaperone; Provisional 90.01
PRK05480209 uridine/cytidine kinase; Provisional 90.0
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 89.93
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 89.91
PRK05439 311 pantothenate kinase; Provisional 89.88
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 89.86
cd02117 212 NifH_like This family contains the NifH (iron prot 89.85
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 89.84
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 89.84
cd01128 249 rho_factor Transcription termination factor rho is 89.82
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 89.76
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 89.74
cd01125 239 repA Hexameric Replicative Helicase RepA. RepA is 89.73
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 89.7
PRK06217183 hypothetical protein; Validated 89.64
cd00550 254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 89.64
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 89.61
cd02034116 CooC The accessory protein CooC, which contains a 89.59
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 89.58
PRK09302 509 circadian clock protein KaiC; Reviewed 89.52
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 89.49
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 89.49
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 89.44
PLN02674244 adenylate kinase 89.42
KOG0737|consensus 386 89.39
PRK14738206 gmk guanylate kinase; Provisional 89.38
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 89.36
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 89.34
PRK06761 282 hypothetical protein; Provisional 89.27
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 89.25
PLN02459 261 probable adenylate kinase 89.23
PRK12339197 2-phosphoglycerate kinase; Provisional 89.19
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 89.17
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 89.1
TIGR00665 434 DnaB replicative DNA helicase. This model describe 89.09
PRK14086 617 dnaA chromosomal replication initiation protein; P 88.95
KOG0739|consensus 439 88.93
PRK06696223 uridine kinase; Validated 88.93
PRK11608 326 pspF phage shock protein operon transcriptional ac 88.91
KOG1942|consensus 456 88.89
PRK14529 223 adenylate kinase; Provisional 88.89
COG4889 1518 Predicted helicase [General function prediction on 88.88
PTZ00202 550 tuzin; Provisional 88.83
PRK14737186 gmk guanylate kinase; Provisional 88.67
cd02035 217 ArsA ArsA ATPase functionas as an efflux pump loca 88.6
PF00005137 ABC_tran: ABC transporter This structure is on hol 88.57
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 88.54
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 88.52
cd02040 270 NifH NifH gene encodes component II (iron protein) 88.48
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 88.44
CHL00206 2281 ycf2 Ycf2; Provisional 88.43
PRK00300205 gmk guanylate kinase; Provisional 88.38
PF13304 303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 88.36
PTZ00035 337 Rad51 protein; Provisional 88.35
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 88.33
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 88.33
PRK13695174 putative NTPase; Provisional 88.32
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 88.3
TIGR02688 449 conserved hypothetical protein TIGR02688. Members 88.29
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 88.29
KOG2004|consensus 906 88.29
KOG0726|consensus 440 88.24
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 88.18
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 88.11
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 88.09
PRK05707 328 DNA polymerase III subunit delta'; Validated 88.03
PF01745 233 IPT: Isopentenyl transferase; InterPro: IPR002648 88.03
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 88.03
PF10412 386 TrwB_AAD_bind: Type IV secretion-system coupling p 87.99
PRK13975196 thymidylate kinase; Provisional 87.83
PF08433 270 KTI12: Chromatin associated protein KTI12 ; InterP 87.74
KOG0732|consensus 1080 87.71
PF10236 309 DAP3: Mitochondrial ribosomal death-associated pro 87.71
PRK00698205 tmk thymidylate kinase; Validated 87.71
TIGR00595 505 priA primosomal protein N'. All proteins in this f 87.55
PRK12678 672 transcription termination factor Rho; Provisional 87.54
>KOG1802|consensus Back     alignment and domain information
Probab=100.00  E-value=1.9e-33  Score=272.64  Aligned_cols=170  Identities=44%  Similarity=0.613  Sum_probs=154.4

Q ss_pred             CCCCCCCeEEEEecCCCCCCCCCCCCceeeEEEEEeeC---ceEEEEcCCCCCCCCCcCCCceeecccccchHHHHHHHH
Q psy4476          13 HALDAGDELKLAATSYDASTPGSGPRSRGLRFRIILPV---TEVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLA   89 (266)
Q Consensus        13 ~~l~~GD~V~l~~~~~~~~~~~~~~~~~~~G~V~kv~~---~~V~v~l~~~~~~p~~~~~~~~~v~~~~n~~t~~R~~~a   89 (266)
                      .++..||..++.+.+..      ...|...|.|.++.+   +|+.++++.+..+|.+...+ |.++++|+.++|+||+.|
T Consensus       294 ~kl~~GdE~~L~y~~~~------~~~w~~~g~v~~~pd~~~dE~~lEl~~~~~~p~e~~~~-Ftvd~vwk~ts~drm~~a  366 (935)
T KOG1802|consen  294 LKLAIGDEIRLTYSGGL------VLPWNGIGSVLKIPDNNGDEVKLELEFSQDPPIEVTHG-FTVDFVWKSTSFDRMQLA  366 (935)
T ss_pred             hccccCCeeEEEecCCc------CCcccccceEEecCCCCcceeEEEeecCCCCCcccccc-eEEEEEEcCccHHHHHHH
Confidence            45789999999988763      345999999999987   79999998776677777777 999999999999999999


Q ss_pred             HHHhHHhccchHHHHHHHHcCCCCchhhhhccCCCCCCCCCCCCCCHHHHHHHHHHHhCCCeEEEcCCCCCcceEeCccc
Q psy4476          90 LRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGMNQRSNGLHHQPGG  169 (266)
Q Consensus        90 L~~l~~~e~~~~~~L~~~l~g~~~~~~~~~~~~~~~~~~~~~~~LN~sQ~~AV~~aL~~~~tLIqGPPGTGKTtTiv~~i  169 (266)
                      |+.|+.++..++.|+|+.++|++..+......+|..|..+++++||.||..||+++|+++++|||||||||||.|    +
T Consensus       367 lk~la~D~~~vs~y~y~klLgh~~~~~~~k~~LP~~~s~~~lpkLN~SQ~~AV~~VL~rplsLIQGPPGTGKTvt----s  442 (935)
T KOG1802|consen  367 LKLLAVDEKKVSGYLYHKLLGHPVEDSSLKKLLPRRFSVPNLPKLNASQSNAVKHVLQRPLSLIQGPPGTGKTVT----S  442 (935)
T ss_pred             HHHhhhccccchhhhhhHHhcCcchhhhhcccCchhhcCCCchhhchHHHHHHHHHHcCCceeeecCCCCCceeh----h
Confidence            999999999999999999999987667777889999999999999999999999999999999999999999999    8


Q ss_pred             cccccchhhhhccCCceEecCCCCcc
Q psy4476         170 AGIGNSANTNRLRNKSNLNHRPSGAN  195 (266)
Q Consensus       170 ~~Ii~~~~~~~~~~~kiLvcAPSN~a  195 (266)
                      ++|+  |++.+....+||||||||.|
T Consensus       443 a~IV--yhl~~~~~~~VLvcApSNiA  466 (935)
T KOG1802|consen  443 ATIV--YHLARQHAGPVLVCAPSNIA  466 (935)
T ss_pred             HHHH--HHHHHhcCCceEEEcccchh
Confidence            9999  68888788999999999997



>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG1806|consensus Back     alignment and domain information
>KOG1804|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>KOG1801|consensus Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0987|consensus Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02773 addB_Gpos ATP-dependent nuclease subunit B Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PHA00547 hypothetical protein Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0962|consensus Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>KOG3928|consensus Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA03311 helicase-primase subunit BBLF4; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
2gjk_A 624 Structural And Functional Insights Into The Human U 2e-34
2xzo_A 623 Upf1 Helicase - Rna Complex Length = 623 2e-34
2wjv_A 800 Crystal Structure Of The Complex Between Human Nons 4e-34
2xzl_A 802 Upf1-Rna Complex Length = 802 3e-24
>pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 Back     alignment and structure

Iteration: 1

Score = 142 bits (358), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 67/104 (64%), Positives = 79/104 (75%), Gaps = 1/104 (0%) Query: 52 EVGLELKSSAGAPTESYHGLFCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGH 111 E+ +EL+SS GAP E H F WKSTSFDRMQ AL+ FAVD+ SVS YIYH+LLGH Sbjct: 100 EIAIELRSSVGAPVEVTHN-FQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGH 158 Query: 112 NVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQG 155 V++V+ +C LPK F+A LPDLN SQVYAVK +QRPLSLIQG Sbjct: 159 EVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQG 202
>pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 Back     alignment and structure
>pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 Back     alignment and structure
>pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 3e-27
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 8e-27
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 5e-26
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 Back     alignment and structure
 Score =  109 bits (274), Expect = 3e-27
 Identities = 60/145 (41%), Positives = 77/145 (53%), Gaps = 5/145 (3%)

Query: 13  HALDAGDELKLAATSYDASTPGSGPRSRGLRFRII-LPVTEVGLELKSSAGAPTESYHGL 71
             +  GDE+ L    + +         RG   R+         LELK S   P       
Sbjct: 243 LKVAIGDEMIL----WYSGMQHPDWEGRGYIVRLPNSFQDTFTLELKPSKTPPPTHLTTG 298

Query: 72  FCGPSFWKSTSFDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNL 131
           F     WK TS+DRMQ AL+KFA+D +S+S Y+Y+++LGH V ++ F   LPK FS PN 
Sbjct: 299 FTAEFIWKGTSYDRMQDALKKFAIDKKSISGYLYYKILGHQVVDISFDVPLPKEFSIPNF 358

Query: 132 PDLNRSQVYAVKHAIQRPLSLIQGM 156
             LN SQ  AV H +QRPLSLIQG 
Sbjct: 359 AQLNSSQSNAVSHVLQRPLSLIQGP 383


>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query266
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 99.95
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 99.93
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 99.92
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 99.91
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 99.69
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 99.61
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 99.22
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 98.78
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 98.14
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 98.08
3b6e_A216 Interferon-induced helicase C domain-containing P; 97.82
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.8
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 97.8
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.79
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.68
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 97.66
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.66
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.64
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.61
3bor_A237 Human initiation factor 4A-II; translation initiat 97.6
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.59
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.54
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.52
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 97.51
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.51
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.5
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.46
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.42
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.42
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 97.41
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.39
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.38
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.34
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.34
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.34
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.32
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.32
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.29
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.24
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 97.23
3h1t_A 590 Type I site-specific restriction-modification syst 97.19
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 97.11
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.04
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.03
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 96.98
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.95
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 96.93
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 96.93
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 96.92
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 96.9
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 96.9
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 96.89
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.89
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 96.87
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 96.8
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.74
3co5_A143 Putative two-component system transcriptional RES 96.72
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.72
3bos_A242 Putative DNA replication factor; P-loop containing 96.7
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.64
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 96.59
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 96.59
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 96.57
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.53
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.53
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 96.52
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.5
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 96.5
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 96.43
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.42
4gl2_A 699 Interferon-induced helicase C domain-containing P; 96.41
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 96.41
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 96.38
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 96.34
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 96.32
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 96.3
1tue_A212 Replication protein E1; helicase, replication, E1E 96.3
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 96.29
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 96.29
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.28
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.26
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 96.24
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 96.22
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 96.22
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.22
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 96.17
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 96.13
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 96.11
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 96.11
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 96.1
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 96.1
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.09
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.08
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 96.08
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 96.05
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.04
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 96.02
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 95.99
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 95.99
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 95.97
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 95.95
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 95.94
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 95.94
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.92
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.9
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 95.89
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.88
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 95.85
2r44_A 331 Uncharacterized protein; putative ATPase, structur 95.85
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 95.84
2qgz_A308 Helicase loader, putative primosome component; str 95.83
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 95.79
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.79
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 95.78
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.73
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.7
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.69
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 95.68
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.68
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.64
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 95.64
2chq_A 319 Replication factor C small subunit; DNA-binding pr 95.64
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 95.59
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 95.58
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 95.5
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 95.5
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 95.49
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 95.47
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 95.47
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.46
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.45
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 95.43
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 95.43
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 95.42
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 95.39
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 95.37
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 95.33
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 95.31
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 95.3
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 95.16
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 95.07
3pvs_A 447 Replication-associated recombination protein A; ma 95.04
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 95.0
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 94.98
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 94.98
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 94.95
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 94.94
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.89
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 94.84
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.8
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 94.79
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 94.72
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 94.71
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.53
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 94.52
2fna_A 357 Conserved hypothetical protein; structural genomic 94.48
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 94.42
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 94.41
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 94.37
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.34
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 94.32
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 94.32
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.31
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 94.26
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 94.25
1p9r_A 418 General secretion pathway protein E; bacterial typ 94.24
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.2
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.16
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 94.15
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 94.1
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 94.03
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 94.03
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.99
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 93.96
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 93.96
1yks_A 440 Genome polyprotein [contains: flavivirin protease 93.88
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 93.87
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.84
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 93.83
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.78
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 93.77
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 93.71
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 93.67
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.64
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 93.57
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.53
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 93.49
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.49
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 93.48
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.43
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.39
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.39
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 93.39
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.32
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.31
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 93.26
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.25
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 93.22
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 93.17
1via_A175 Shikimate kinase; structural genomics, transferase 93.11
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 93.1
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 93.07
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.05
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 92.96
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 92.89
3vaa_A199 Shikimate kinase, SK; structural genomics, center 92.86
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 92.81
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 92.79
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 92.78
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 92.76
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 92.75
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.75
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 92.71
2cvh_A220 DNA repair and recombination protein RADB; filamen 92.68
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 92.63
2vli_A183 Antibiotic resistance protein; transferase, tunica 92.62
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 92.58
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.54
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 92.54
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 92.52
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 92.51
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 92.5
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 92.45
1u94_A 356 RECA protein, recombinase A; homologous recombinat 92.45
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.44
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.43
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 92.37
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 92.32
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 92.29
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 92.28
1xjc_A169 MOBB protein homolog; structural genomics, midwest 92.25
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 92.23
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 92.2
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 92.18
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 92.12
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 92.12
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 92.09
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 92.09
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.07
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 91.97
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 91.96
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 91.96
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 91.95
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 91.93
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 91.9
2xxa_A 433 Signal recognition particle protein; protein trans 91.89
2r6a_A 454 DNAB helicase, replicative helicase; replication, 91.86
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 91.81
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 91.81
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 91.8
1xp8_A 366 RECA protein, recombinase A; recombination, radior 91.78
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 91.75
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 91.62
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 91.53
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 91.45
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 91.45
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 91.44
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 91.43
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 91.38
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 91.38
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 91.37
3tlx_A243 Adenylate kinase 2; structural genomics, structura 91.36
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.36
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 91.31
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 91.3
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 91.24
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 91.23
4a74_A231 DNA repair and recombination protein RADA; hydrola 91.22
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 91.19
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 91.17
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 91.17
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 91.12
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 91.09
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 91.07
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 91.06
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.05
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 90.97
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 90.89
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 90.83
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 90.81
2z43_A324 DNA repair and recombination protein RADA; archaea 90.79
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 90.69
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.67
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 90.64
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 90.64
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 90.6
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 90.56
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 90.53
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 90.35
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 90.25
3ug7_A 349 Arsenical pump-driving ATPase; tail-anchored, memb 90.08
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 90.08
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 90.04
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 89.98
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 89.92
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 89.91
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 89.87
3io5_A 333 Recombination and repair protein; storage dimer, i 89.77
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 89.73
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 89.64
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 89.55
2og2_A359 Putative signal recognition particle receptor; nuc 89.51
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 89.49
3kta_A182 Chromosome segregation protein SMC; structural mai 89.45
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 89.45
2ewv_A 372 Twitching motility protein PILT; pilus retraction 89.41
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 89.36
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 89.32
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 89.2
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 89.2
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 89.17
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 89.16
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 89.14
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 89.13
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 89.11
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 89.0
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 88.89
3zq6_A 324 Putative arsenical pump-driving ATPase; tail-ancho 88.87
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 88.79
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 88.74
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 88.65
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 88.58
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 88.51
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 88.47
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 88.38
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 88.34
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 88.34
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 88.3
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 88.28
2eyu_A 261 Twitching motility protein PILT; pilus retraction 88.28
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 88.27
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 88.23
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 88.14
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 88.12
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 87.92
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 87.72
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 87.55
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 87.3
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 87.24
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 86.93
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 86.93
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 86.88
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 86.88
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 86.85
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 86.79
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 86.72
3iqw_A 334 Tail-anchored protein targeting factor GET3; ATPas 86.71
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 86.47
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 86.39
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 86.34
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 86.21
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 86.1
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 86.06
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 86.01
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 85.96
2hf9_A226 Probable hydrogenase nickel incorporation protein 85.94
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 85.87
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 85.76
2woo_A 329 ATPase GET3; tail-anchored, membrane protein, targ 85.71
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 85.66
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 85.65
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 85.63
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 85.55
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 85.38
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 85.09
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 85.03
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 85.01
3l0o_A 427 Transcription termination factor RHO; helicase, RH 84.97
2woj_A 354 ATPase GET3; tail-anchored, membrane protein, targ 84.88
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 84.87
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 84.82
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 84.77
3io3_A 348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 84.66
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 84.65
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 84.55
1byi_A 224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 84.51
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 84.44
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 84.06
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 84.05
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 83.74
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 83.62
2oze_A 298 ORF delta'; para, walker type atpases, DNA segrega 83.52
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 83.4
3kjh_A 254 CO dehydrogenase/acetyl-COA synthase complex, acce 83.26
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 83.11
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 83.04
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 82.84
3ice_A 422 Transcription termination factor RHO; transcriptio 82.76
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 82.71
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 82.56
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 82.49
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 82.47
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 82.32
1hyq_A 263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 82.13
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 82.01
1nrj_B218 SR-beta, signal recognition particle receptor beta 81.21
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 81.17
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 81.14
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 81.1
3ea0_A 245 ATPase, para family; alpha-beta-alpha sandwich, st 80.97
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 80.89
2ph1_A 262 Nucleotide-binding protein; alpha-beta protein, st 80.74
3end_A 307 Light-independent protochlorophyllide reductase ir 80.73
1cp2_A 269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 80.7
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 80.6
2orv_A 234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 80.57
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 80.31
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 80.07
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
Probab=99.95  E-value=8.2e-28  Score=239.22  Aligned_cols=170  Identities=15%  Similarity=0.128  Sum_probs=125.9

Q ss_pred             ccccCCCCCCCCeEEEEecCCCCCCCCCCCCceeeEEEEEeeCceEEEEcCCCCCCC-CCcCCCceeecccccchHHHHH
Q psy4476           8 TCVELHALDAGDELKLAATSYDASTPGSGPRSRGLRFRIILPVTEVGLELKSSAGAP-TESYHGLFCGPSFWKSTSFDRM   86 (266)
Q Consensus         8 ~cl~~~~l~~GD~V~l~~~~~~~~~~~~~~~~~~~G~V~kv~~~~V~v~l~~~~~~p-~~~~~~~~~v~~~~n~~t~~R~   86 (266)
                      .++|.|.|.+||+|.++.....       ..+.+.|+|+++..++|+|.++...... .....+.|++++.+|+++|+||
T Consensus        74 ~~l~~~~~~~Gd~v~~~~~~~~-------~~~~~~g~v~~~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~  146 (646)
T 4b3f_X           74 AALPSNSFTSGDIVGLYDAANE-------GSQLATGILTRVTQKSVTVAFDESHDFQLSLDRENSYRLLKLANDVTYRRL  146 (646)
T ss_dssp             CCCCCCCCCTTCEEEEEETTTT-------SCCCEEEEEEEEETTEEEEECC-------CCCSSCCEEEEEECCHHHHHHH
T ss_pred             CCCccCCCCCCCEEEEEecCCC-------CCceEEEEEEEEeCCEEEEEECCccccccccCCCCcEEEEEeccchHHHHH
Confidence            3688999999999999865542       2345789999999999999998543211 1112235999999999999999


Q ss_pred             HHHHHHhHHhccchHHHHHHHHcCCCCchhhhhccCCCCCCCCCCCCCCHHHHHHHHHHHh-CCCeEEEcCCCCCcceEe
Q psy4476          87 QLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQ-RPLSLIQGMNQRSNGLHH  165 (266)
Q Consensus        87 ~~aL~~l~~~e~~~~~~L~~~l~g~~~~~~~~~~~~~~~~~~~~~~~LN~sQ~~AV~~aL~-~~~tLIqGPPGTGKTtTi  165 (266)
                      +.||..+..........+++.++|...+..... ..+..+   ....||++|++||..||. ++++|||||||||||+| 
T Consensus       147 ~~al~~l~~~~~~~~~~l~~~l~~~~~p~~~~~-~~~~~~---~~~~LN~~Q~~AV~~al~~~~~~lI~GPPGTGKT~t-  221 (646)
T 4b3f_X          147 KKALIALKKYHSGPASSLIEVLFGRSAPSPASE-IHPLTF---FNTCLDTSQKEAVLFALSQKELAIIHGPPGTGKTTT-  221 (646)
T ss_dssp             HHHHHHHHTCCSSTTHHHHHHHTTSSCCCCCCC-CCCCCC---SSTTCCHHHHHHHHHHHHCSSEEEEECCTTSCHHHH-
T ss_pred             HHHHHHhhhcccCchHHHHHHHcCCCCCCCccc-cCcccc---cCCCCCHHHHHHHHHHhcCCCceEEECCCCCCHHHH-
Confidence            999999987666667788999998743321111 111111   235799999999999997 57999999999999999 


Q ss_pred             CccccccccchhhhhccCCceEecCCCCcc
Q psy4476         166 QPGGAGIGNSANTNRLRNKSNLNHRPSGAN  195 (266)
Q Consensus       166 v~~i~~Ii~~~~~~~~~~~kiLvcAPSN~a  195 (266)
                         +++++  ..+.+ .+.+||||||||.|
T Consensus       222 ---i~~~I--~~l~~-~~~~ILv~a~TN~A  245 (646)
T 4b3f_X          222 ---VVEII--LQAVK-QGLKVLCCAPSNIA  245 (646)
T ss_dssp             ---HHHHH--HHHHH-TTCCEEEEESSHHH
T ss_pred             ---HHHHH--HHHHh-CCCeEEEEcCchHH
Confidence               45555  23333 57899999999996



>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 266
d1w36d1359 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha c 6e-05
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]
 Score = 41.4 bits (96), Expect = 6e-05
 Identities = 18/73 (24%), Positives = 29/73 (39%), Gaps = 3/73 (4%)

Query: 83  FDRMQLALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAV 142
               +L L +   ++++V+ +         VDE L    L K F      D    Q  A 
Sbjct: 101 LCGDRLYLNRMWCNERTVARFFNEVNHAIEVDEALLAQTLDKLFPVS---DEINWQKVAA 157

Query: 143 KHAIQRPLSLIQG 155
             A+ R +S+I G
Sbjct: 158 AVALTRRISVISG 170


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query266
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 99.83
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 99.09
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 98.82
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 98.34
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.78
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.7
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.62
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.57
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.54
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.45
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.35
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.32
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.3
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.13
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.1
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.02
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.01
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.0
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.98
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 96.96
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 96.94
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.91
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 96.87
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 96.83
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 96.83
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.76
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.66
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 96.65
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 96.6
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.6
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 96.54
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.51
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 96.49
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 96.49
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.46
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 96.4
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.38
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.38
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.36
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.36
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.34
d2qy9a2211 GTPase domain of the signal recognition particle r 96.34
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.32
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.23
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.22
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 96.21
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.18
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.14
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.12
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 96.08
d1okkd2207 GTPase domain of the signal recognition particle r 96.07
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.06
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.06
d1vmaa2213 GTPase domain of the signal recognition particle r 96.05
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 95.98
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.96
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.94
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.88
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.85
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.84
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 95.77
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.73
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.56
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.53
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.45
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 95.44
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.38
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 95.38
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.23
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 95.2
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.2
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.19
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.18
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.17
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.15
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.09
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.91
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.89
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 94.73
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 94.7
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.69
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.54
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 94.51
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.49
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 94.44
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.41
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.4
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 94.29
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.29
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.26
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.25
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.01
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.98
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.94
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 93.92
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.83
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 93.81
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.78
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.75
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.67
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.61
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.52
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 93.45
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 93.44
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.24
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.2
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.16
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.15
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.05
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 91.25
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 90.79
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.78
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.63
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.62
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 90.27
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.21
d1z3ix2 298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 89.99
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 89.88
d1tuea_205 Replication protein E1 helicase domain {Human papi 89.8
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 89.7
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 89.41
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 89.41
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.4
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.23
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 89.01
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 88.98
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.92
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 88.89
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 88.8
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 87.62
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 87.34
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 87.08
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 86.75
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 86.52
d1xpua3 289 Transcription termination factor Rho, ATPase domai 86.16
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 85.74
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 85.67
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.01
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 85.01
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 84.73
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 84.58
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 84.32
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 84.32
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 84.24
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 83.8
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 83.6
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 83.15
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 82.74
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 82.63
d1nrjb_209 Signal recognition particle receptor beta-subunit 82.53
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 82.22
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 81.91
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 81.2
d2fh5b1207 Signal recognition particle receptor beta-subunit 80.23
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 80.12
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]
Probab=99.83  E-value=1.6e-22  Score=186.63  Aligned_cols=146  Identities=20%  Similarity=0.177  Sum_probs=94.2

Q ss_pred             HHHHhHHhccchHHHHHHHHcCCCCchhhhhccCCCCCCCCCCCCCCHHHHHHHHHHHhCCCeEEEcCCCCCcceEeCcc
Q psy4476          89 ALRKFAVDDQSVSAYIYHRLLGHNVDEVLFRCHLPKHFSAPNLPDLNRSQVYAVKHAIQRPLSLIQGMNQRSNGLHHQPG  168 (266)
Q Consensus        89 aL~~l~~~e~~~~~~L~~~l~g~~~~~~~~~~~~~~~~~~~~~~~LN~sQ~~AV~~aL~~~~tLIqGPPGTGKTtTiv~~  168 (266)
                      +|.+++..|..++..|.++....+++.......++..+..   ..++++|+.||+.|+.+++++|+||||||||||++.+
T Consensus       107 yl~~~~~~E~~ia~~l~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~Q~~A~~~al~~~~~vI~G~pGTGKTt~i~~~  183 (359)
T d1w36d1         107 YLNRMWCNERTVARFFNEVNHAIEVDEALLAQTLDKLFPV---SDEINWQKVAAAVALTRRISVISGGPGTGKTTTVAKL  183 (359)
T ss_dssp             EEHHHHHHHHHHHHHHTSCCBCCCCCHHHHHHHHHTTCCC---TTSCCHHHHHHHHHHTBSEEEEECCTTSTHHHHHHHH
T ss_pred             ehHHHHHHHHHHHHHHHHhcCCCCCChHHHHHHHHHhccC---cccccHHHHHHHHHHcCCeEEEEcCCCCCceehHHHH
Confidence            7788888888888777554333333333333333333321   3578899999999999999999999999999994322


Q ss_pred             ccccccchhhhhccCCceEecCCCCcc--cccccccccC-----------------cccccccc-cccccccCCCCcccC
Q psy4476         169 GAGIGNSANTNRLRNKSNLNHRPSGAN--KLSQGHLSQG-----------------NNSQEITQ-PYSQVMSQGGGFSLS  228 (266)
Q Consensus       169 i~~Ii~~~~~~~~~~~kiLvcAPSN~a--rl~~g~~~~g-----------------~~~~~i~~-~~~~~~~~~g~~~~~  228 (266)
                      +..+.   ......+.+|++|||||+|  +|++   ++|                 ..+.|+|| +++.  +...+|..+
T Consensus       184 l~~l~---~~~~~~~~~I~l~ApTgkAA~~L~e---~~~~~~~~~~~~~~~~~~~~~~~~t~~~ll~~~--~~~~~~~~~  255 (359)
T d1w36d1         184 LAALI---QMADGERCRIRLAAPTGKAAARLTE---SLGKALRQLPLTDEQKKRIPEDASTLHRLLGAQ--PGSQRLRHH  255 (359)
T ss_dssp             HHHHH---HTCSSCCCCEEEEBSSHHHHHHHHH---HHTHHHHHSSCCSCCCCSCSCCCBTTTSCC-------------C
T ss_pred             HHHHH---HHHhccCCeEEEecCcHHHHHHHHH---HHHHHHhhcCchhhhhhhhhhhhhHHHHHHhhh--hcchHHHHh
Confidence            22222   1122246789999999984  6766   333                 25789999 6654  545568777


Q ss_pred             C-CCCCcceeee---eecccc
Q psy4476         229 Q-ADLSQDSLMM---SQLDGM  245 (266)
Q Consensus       229 ~-~~~~~d~~~~---s~~d~~  245 (266)
                      . +++..|++|+   ||+|..
T Consensus       256 ~~~~l~~d~lIIDEaSmv~~~  276 (359)
T d1w36d1         256 AGNPLHLDVLVVDEASMIDLP  276 (359)
T ss_dssp             TTSCCSCSEEEECSGGGCBHH
T ss_pred             hhcccccceeeehhhhccCHH
Confidence            6 9999999998   898754



>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure