Psyllid ID: psy4506


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MGLTGTNLGIYLYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFSCFKNAHTLSYV
ccEEEEEHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHcHHHHHHHHHHHcccccccccccccccccccc
cccccccHHHHHEEEHccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEc
MGLTGTNLGIYLYLIStlcgppcdcpeyIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVfpwcfscfknahtlsyv
MGLTGTNLGIYLYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFSCfknahtlsyv
MGLTGTNLGIYLYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFSCFKNAHTLSYV
****GTNLGIYLYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFSCFKNAHTL***
MGLTGTNLGIYLYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCF************
MGLTGTNLGIYLYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFSCFKNAHTLSYV
**LTGTNLGIYLYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFSCFKNAHTLSYV
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLTGTNLGIYLYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFSCFKNAHTLSYV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query83 2.2.26 [Sep-21-2011]
Q4LBB61256 Octopamine receptor beta- yes N/A 0.771 0.050 0.589 4e-22
Q9VCZ3508 Octopamine receptor beta- no N/A 0.698 0.114 0.627 4e-16
Q4LBB9536 Octopamine receptor beta- no N/A 0.602 0.093 0.686 3e-14
P32251436 Alpha-2 adrenergic recept N/A N/A 0.602 0.114 0.5 4e-10
Q8JG70408 Alpha-2Da adrenergic rece yes N/A 0.662 0.134 0.454 9e-10
Q25322484 Putative tyramine recepto N/A N/A 0.650 0.111 0.462 2e-09
Q25321484 Tyramine receptor 1 OS=Lo N/A N/A 0.650 0.111 0.462 2e-09
P35405469 Alpha-2C adrenergic recep N/A N/A 0.638 0.113 0.452 9e-09
Q8JG69415 Alpha-2Db adrenergic rece no N/A 0.638 0.127 0.433 2e-08
O42385423 5-hydroxytryptamine recep N/A N/A 0.674 0.132 0.446 2e-08
>sp|Q4LBB6|OCTB3_DROME Octopamine receptor beta-3R OS=Drosophila melanogaster GN=Octbeta3R PE=2 SV=4 Back     alignment and function desciption
 Score =  103 bits (256), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 43/73 (58%), Positives = 54/73 (73%), Gaps = 9/73 (12%)

Query: 5    GTNLGIYL---------YLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDF 55
            G  +G++L         Y+I++LCGP C CP+ +V +LFWIGYFNS LNPL+YAYFNRDF
Sbjct: 1171 GIIMGVFLLCWLPFFLWYVITSLCGPACPCPDVLVVVLFWIGYFNSTLNPLIYAYFNRDF 1230

Query: 56   REAFKNTLSFVFP 68
            REAF+NTL  V P
Sbjct: 1231 REAFRNTLECVLP 1243




Receptor for octopamine. Octopamine (OA) is a neurotransmitter, neurohormone, and neuromodulator in invertebrates. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Drosophila melanogaster (taxid: 7227)
>sp|Q9VCZ3|OCTB1_DROME Octopamine receptor beta-1R OS=Drosophila melanogaster GN=oa2 PE=2 SV=1 Back     alignment and function description
>sp|Q4LBB9|OCTB2_DROME Octopamine receptor beta-2R OS=Drosophila melanogaster GN=Octbeta2R PE=2 SV=2 Back     alignment and function description
>sp|P32251|ADRA2_CARAU Alpha-2 adrenergic receptor OS=Carassius auratus PE=3 SV=1 Back     alignment and function description
>sp|Q8JG70|AA2DA_DANRE Alpha-2Da adrenergic receptor OS=Danio rerio GN=adra2da PE=2 SV=1 Back     alignment and function description
>sp|Q25322|OAR2_LOCMI Putative tyramine receptor 2 OS=Locusta migratoria GN=GCR2 PE=2 SV=1 Back     alignment and function description
>sp|Q25321|OAR1_LOCMI Tyramine receptor 1 OS=Locusta migratoria GN=GCR1 PE=1 SV=1 Back     alignment and function description
>sp|P35405|ADA2C_DIDVI Alpha-2C adrenergic receptor OS=Didelphis virginiana GN=ADRA2C PE=2 SV=2 Back     alignment and function description
>sp|Q8JG69|AA2DB_DANRE Alpha-2Db adrenergic receptor OS=Danio rerio GN=adra2db PE=2 SV=1 Back     alignment and function description
>sp|O42385|5H1AA_TAKRU 5-hydroxytryptamine receptor 1A-alpha OS=Takifugu rubripes GN=htr1aa PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
328705267 454 PREDICTED: octopamine receptor beta-3R-l 0.855 0.156 0.689 1e-20
221379028 1256 Octbeta3R, isoform F [Drosophila melanog 0.771 0.050 0.589 2e-20
116875713 1256 IP08282p [Drosophila melanogaster] 0.771 0.050 0.589 2e-20
221379031 1118 Octbeta3R, isoform G [Drosophila melanog 0.771 0.057 0.589 2e-20
194764823 1281 GF23003 [Drosophila ananassae] gi|190614 0.674 0.043 0.714 3e-20
195329498 1139 GM26001 [Drosophila sechellia] gi|194120 0.674 0.049 0.714 5e-20
357622752 298 hypothetical protein KGM_17023 [Danaus p 0.855 0.238 0.619 1e-19
195450841 1230 GK13570 [Drosophila willistoni] gi|19416 0.771 0.052 0.575 2e-19
24202277672 beta adrenergic receptor, putative [Pedi 0.843 0.972 0.661 2e-19
347968755 1230 AGAP002888-PC [Anopheles gambiae str. PE 0.795 0.053 0.571 3e-19
>gi|328705267|ref|XP_001948521.2| PREDICTED: octopamine receptor beta-3R-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/74 (68%), Positives = 58/74 (78%), Gaps = 3/74 (4%)

Query: 13  YLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFS 72
           Y+ISTLCG PC  PE +VT+LFWIGYFNS LNPL+YAYFNRDFREAFKNTL  VFP C S
Sbjct: 381 YVISTLCGDPCSFPETLVTVLFWIGYFNSSLNPLIYAYFNRDFREAFKNTLQCVFPCCQS 440

Query: 73  C---FKNAHTLSYV 83
           C     ++  +SYV
Sbjct: 441 CCPKESDSTAMSYV 454




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|221379028|ref|NP_001034048.2| Octbeta3R, isoform F [Drosophila melanogaster] gi|347595820|sp|Q4LBB6.4|OCTB3_DROME RecName: Full=Octopamine receptor beta-3R; Short=DmOct-beta-3R gi|220903060|gb|ABC66173.2| Octbeta3R, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|116875713|gb|ABK30906.1| IP08282p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|221379031|ref|NP_650210.2| Octbeta3R, isoform G [Drosophila melanogaster] gi|220903061|gb|AAF54832.2| Octbeta3R, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194764823|ref|XP_001964528.1| GF23003 [Drosophila ananassae] gi|190614800|gb|EDV30324.1| GF23003 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195329498|ref|XP_002031447.1| GM26001 [Drosophila sechellia] gi|194120390|gb|EDW42433.1| GM26001 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|357622752|gb|EHJ74155.1| hypothetical protein KGM_17023 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195450841|ref|XP_002072656.1| GK13570 [Drosophila willistoni] gi|194168741|gb|EDW83642.1| GK13570 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|242022776|ref|XP_002431814.1| beta adrenergic receptor, putative [Pediculus humanus corporis] gi|212517146|gb|EEB19076.1| beta adrenergic receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|347968755|ref|XP_003436282.1| AGAP002888-PC [Anopheles gambiae str. PEST] gi|333467858|gb|EGK96732.1| AGAP002888-PC [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
FB|FBgn02509101256 Octbeta3R "Octbeta3R" [Drosoph 0.831 0.054 0.619 1.4e-19
FB|FBgn0038980508 oa2 "octopamine receptor 2" [D 0.698 0.114 0.627 5.8e-16
FB|FBgn0038063536 Octbeta2R "Octbeta2R" [Drosoph 0.746 0.115 0.590 2.9e-15
ZFIN|ZDB-GENE-021010-4408 adra2da "adrenergic, alpha-2D- 0.638 0.129 0.471 2.7e-10
UNIPROTKB|F1NAZ2422 HTR1A "Uncharacterized protein 0.650 0.127 0.444 1e-09
ZFIN|ZDB-GENE-071203-1398 htr1aa "5-hydroxytryptamine (s 0.734 0.153 0.461 1.2e-09
FB|FBgn0038653699 CG18208 [Drosophila melanogast 0.638 0.075 0.452 1.4e-09
ZFIN|ZDB-GENE-021010-5415 adra2db "adrenergic, alpha-2D- 0.638 0.127 0.433 1.6e-09
MGI|MGI:96273421 Htr1a "5-hydroxytryptamine (se 0.650 0.128 0.462 1.7e-09
UNIPROTKB|F1NBV5344 ADRA2B "Uncharacterized protei 0.650 0.156 0.444 3e-09
FB|FBgn0250910 Octbeta3R "Octbeta3R" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 247 (92.0 bits), Expect = 1.4e-19, P = 1.4e-19
 Identities = 44/71 (61%), Positives = 54/71 (76%)

Query:    13 YLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFS 72
             Y+I++LCGP C CP+ +V +LFWIGYFNS LNPL+YAYFNRDFREAF+NTL  V P C  
Sbjct:  1188 YVITSLCGPACPCPDVLVVVLFWIGYFNSTLNPLIYAYFNRDFREAFRNTLECVLP-CLE 1246

Query:    73 CFKNAHTLSYV 83
               +N +   YV
Sbjct:  1247 K-RNPYNAYYV 1256




GO:0016021 "integral to membrane" evidence=ISS
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS
GO:0008227 "G-protein coupled amine receptor activity" evidence=ISS
GO:0004989 "octopamine receptor activity" evidence=IDA
FB|FBgn0038980 oa2 "octopamine receptor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038063 Octbeta2R "Octbeta2R" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021010-4 adra2da "adrenergic, alpha-2D-, receptor a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAZ2 HTR1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071203-1 htr1aa "5-hydroxytryptamine (serotonin) receptor 1A a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0038653 CG18208 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021010-5 adra2db "adrenergic, alpha-2D-, receptor b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:96273 Htr1a "5-hydroxytryptamine (serotonin) receptor 1A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBV5 ADRA2B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4LBB6OCTB3_DROMENo assigned EC number0.58900.77100.0509yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 83
PHA03234338 DNA packaging protein UL33; Provisional 99.21
KOG4220|consensus503 99.0
PHA02834323 chemokine receptor-like protein; Provisional 98.94
PHA03235409 DNA packaging protein UL33; Provisional 98.92
PHA02638417 CC chemokine receptor-like protein; Provisional 98.91
KOG4219|consensus423 98.8
PHA03087335 G protein-coupled chemokine receptor-like protein; 98.74
KOG2087|consensus363 97.87
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 97.18
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 97.05
PF10324318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 97.04
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 95.21
PF10321313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 94.35
PF05296303 TAS2R: Mammalian taste receptor protein (TAS2R); I 91.98
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
Probab=99.21  E-value=1.6e-11  Score=79.88  Aligned_cols=40  Identities=28%  Similarity=0.459  Sum_probs=34.6

Q ss_pred             HHHHHHHHHHHhhhhhhhHhHHhccHHHHHHHHHHhcccC
Q psy4506          28 YIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVF   67 (83)
Q Consensus        28 ~~~~~~~~l~~~ns~~nP~iY~~~~~~~r~~~~~~~~~~~   67 (83)
                      ..+.++.+++++|||+||+||++.+++||+++++.+++..
T Consensus       279 ~~~~v~~~La~~nsclNPiIY~f~~~~FR~~~~~~~~~~~  318 (338)
T PHA03234        279 ILQIIIRLMPEIHCFSNPLVYAFTGGDFRLRFTACFQDFF  318 (338)
T ss_pred             HHHHHHHHHHHhhhhhhHHHHHHhhHHHHHHHHHHHHHHh
Confidence            3457888999999999999999999999999998876543



>KOG4220|consensus Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>KOG4219|consensus Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-04
3rze_A452 Structure Of The Human Histamine H1 Receptor In Com 2e-04
2y00_B315 Turkey Beta1 Adrenergic Receptor With Stabilising M 4e-04
2vt4_A313 Turkey Beta1 Adrenergic Receptor With Stabilising M 4e-04
3uon_A467 Structure Of The Human M2 Muscarinic Acetylcholine 8e-04
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure

Iteration: 1

Score = 41.6 bits (96), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Query: 13 YLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLS 64 ++++T C C + + W+GY NS LNP++Y FN +FR+AF LS Sbjct: 421 HVLNTHC-QTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILS 471
>pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 Back     alignment and structure
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure
>pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 2e-16
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 7e-16
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 4e-15
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 7e-15
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 1e-14
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 1e-14
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 2e-14
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 5e-14
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 1e-12
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 8e-07
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 1e-06
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 3e-05
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 6e-05
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 9e-05
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
 Score = 71.3 bits (174), Expect = 2e-16
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 12  LYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSF 65
            ++++T C   C     + +   W+GY NS LNP++Y  FN +FR+AF   LS 
Sbjct: 420 THVLNTHC-QTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC 472


>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
4grv_A510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.5
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.35
2koe_A40 Human cannabinoid receptor 1 - helix 7/8 peptide; 99.35
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.31
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.29
3vw7_A484 Proteinase-activated receptor 1, lysozyme; high re 99.26
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.25
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 99.25
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.23
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 99.21
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 99.16
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 99.15
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 99.14
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.12
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 99.08
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.02
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 98.95
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 98.93
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 98.9
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.50  E-value=1e-15  Score=101.78  Aligned_cols=40  Identities=28%  Similarity=0.590  Sum_probs=27.8

Q ss_pred             HHHHHHHHHHhhhhhhhHhHHhccHHHHHHHHHHhcccCC
Q psy4506          29 IVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFP   68 (83)
Q Consensus        29 ~~~~~~~l~~~ns~~nP~iY~~~~~~~r~~~~~~~~~~~~   68 (83)
                      ...++.||+++|||+||+||++.|++||++++++++|+..
T Consensus       451 ~~~~~~~L~Y~NS~iNPiIY~~~n~~FR~aFk~iL~C~C~  490 (510)
T 4grv_A          451 FYMLTNALAYASSAINPILYNLVSANFRQVFLSTLACLCP  490 (510)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHSCCCCC----------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHhhcCC
Confidence            4567889999999999999999999999999999987544



>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>2koe_A Human cannabinoid receptor 1 - helix 7/8 peptide; GPCR, HCB1, membrane protein, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 83
d1u19a_348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 8e-06
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 39.6 bits (91), Expect = 8e-06
 Identities = 12/54 (22%), Positives = 19/54 (35%)

Query: 10  IYLYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTL 63
                         D     +TI  +    ++V NP++Y   N+ FR     TL
Sbjct: 268 YAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTL 321


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.24
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.24  E-value=2.6e-11  Score=74.74  Aligned_cols=48  Identities=25%  Similarity=0.372  Sum_probs=40.3

Q ss_pred             CCCCCcHHHHHHHHHHHHhhhhhhhHhHHhccHHHHHHHHHHhcccCC
Q psy4506          21 PPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFP   68 (83)
Q Consensus        21 ~~~~~~~~~~~~~~~l~~~ns~~nP~iY~~~~~~~r~~~~~~~~~~~~   68 (83)
                      ...........+..+++.+||++||+||.+++++||++++++++|+..
T Consensus       279 ~~~~~~~~~~~~~~~l~~~ns~iNPiIY~~~~~~fR~~~~~~l~c~~~  326 (348)
T d1u19a_         279 QGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKN  326 (348)
T ss_dssp             TTSCCCHHHHHHHHHHGGGGGTHHHHHHHHTCHHHHHHHHHHHTSSCC
T ss_pred             CCccccHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHhCCCCC
Confidence            344445667778889999999999999999999999999999976544