Psyllid ID: psy4506
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 83 | ||||||
| 328705267 | 454 | PREDICTED: octopamine receptor beta-3R-l | 0.855 | 0.156 | 0.689 | 1e-20 | |
| 221379028 | 1256 | Octbeta3R, isoform F [Drosophila melanog | 0.771 | 0.050 | 0.589 | 2e-20 | |
| 116875713 | 1256 | IP08282p [Drosophila melanogaster] | 0.771 | 0.050 | 0.589 | 2e-20 | |
| 221379031 | 1118 | Octbeta3R, isoform G [Drosophila melanog | 0.771 | 0.057 | 0.589 | 2e-20 | |
| 194764823 | 1281 | GF23003 [Drosophila ananassae] gi|190614 | 0.674 | 0.043 | 0.714 | 3e-20 | |
| 195329498 | 1139 | GM26001 [Drosophila sechellia] gi|194120 | 0.674 | 0.049 | 0.714 | 5e-20 | |
| 357622752 | 298 | hypothetical protein KGM_17023 [Danaus p | 0.855 | 0.238 | 0.619 | 1e-19 | |
| 195450841 | 1230 | GK13570 [Drosophila willistoni] gi|19416 | 0.771 | 0.052 | 0.575 | 2e-19 | |
| 242022776 | 72 | beta adrenergic receptor, putative [Pedi | 0.843 | 0.972 | 0.661 | 2e-19 | |
| 347968755 | 1230 | AGAP002888-PC [Anopheles gambiae str. PE | 0.795 | 0.053 | 0.571 | 3e-19 |
| >gi|328705267|ref|XP_001948521.2| PREDICTED: octopamine receptor beta-3R-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 103 bits (257), Expect = 1e-20, Method: Compositional matrix adjust.
Identities = 51/74 (68%), Positives = 58/74 (78%), Gaps = 3/74 (4%)
Query: 13 YLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFS 72
Y+ISTLCG PC PE +VT+LFWIGYFNS LNPL+YAYFNRDFREAFKNTL VFP C S
Sbjct: 381 YVISTLCGDPCSFPETLVTVLFWIGYFNSSLNPLIYAYFNRDFREAFKNTLQCVFPCCQS 440
Query: 73 C---FKNAHTLSYV 83
C ++ +SYV
Sbjct: 441 CCPKESDSTAMSYV 454
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|221379028|ref|NP_001034048.2| Octbeta3R, isoform F [Drosophila melanogaster] gi|347595820|sp|Q4LBB6.4|OCTB3_DROME RecName: Full=Octopamine receptor beta-3R; Short=DmOct-beta-3R gi|220903060|gb|ABC66173.2| Octbeta3R, isoform F [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|116875713|gb|ABK30906.1| IP08282p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|221379031|ref|NP_650210.2| Octbeta3R, isoform G [Drosophila melanogaster] gi|220903061|gb|AAF54832.2| Octbeta3R, isoform G [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194764823|ref|XP_001964528.1| GF23003 [Drosophila ananassae] gi|190614800|gb|EDV30324.1| GF23003 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195329498|ref|XP_002031447.1| GM26001 [Drosophila sechellia] gi|194120390|gb|EDW42433.1| GM26001 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|357622752|gb|EHJ74155.1| hypothetical protein KGM_17023 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|195450841|ref|XP_002072656.1| GK13570 [Drosophila willistoni] gi|194168741|gb|EDW83642.1| GK13570 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|242022776|ref|XP_002431814.1| beta adrenergic receptor, putative [Pediculus humanus corporis] gi|212517146|gb|EEB19076.1| beta adrenergic receptor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|347968755|ref|XP_003436282.1| AGAP002888-PC [Anopheles gambiae str. PEST] gi|333467858|gb|EGK96732.1| AGAP002888-PC [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 83 | ||||||
| FB|FBgn0250910 | 1256 | Octbeta3R "Octbeta3R" [Drosoph | 0.831 | 0.054 | 0.619 | 1.4e-19 | |
| FB|FBgn0038980 | 508 | oa2 "octopamine receptor 2" [D | 0.698 | 0.114 | 0.627 | 5.8e-16 | |
| FB|FBgn0038063 | 536 | Octbeta2R "Octbeta2R" [Drosoph | 0.746 | 0.115 | 0.590 | 2.9e-15 | |
| ZFIN|ZDB-GENE-021010-4 | 408 | adra2da "adrenergic, alpha-2D- | 0.638 | 0.129 | 0.471 | 2.7e-10 | |
| UNIPROTKB|F1NAZ2 | 422 | HTR1A "Uncharacterized protein | 0.650 | 0.127 | 0.444 | 1e-09 | |
| ZFIN|ZDB-GENE-071203-1 | 398 | htr1aa "5-hydroxytryptamine (s | 0.734 | 0.153 | 0.461 | 1.2e-09 | |
| FB|FBgn0038653 | 699 | CG18208 [Drosophila melanogast | 0.638 | 0.075 | 0.452 | 1.4e-09 | |
| ZFIN|ZDB-GENE-021010-5 | 415 | adra2db "adrenergic, alpha-2D- | 0.638 | 0.127 | 0.433 | 1.6e-09 | |
| MGI|MGI:96273 | 421 | Htr1a "5-hydroxytryptamine (se | 0.650 | 0.128 | 0.462 | 1.7e-09 | |
| UNIPROTKB|F1NBV5 | 344 | ADRA2B "Uncharacterized protei | 0.650 | 0.156 | 0.444 | 3e-09 |
| FB|FBgn0250910 Octbeta3R "Octbeta3R" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 247 (92.0 bits), Expect = 1.4e-19, P = 1.4e-19
Identities = 44/71 (61%), Positives = 54/71 (76%)
Query: 13 YLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPWCFS 72
Y+I++LCGP C CP+ +V +LFWIGYFNS LNPL+YAYFNRDFREAF+NTL V P C
Sbjct: 1188 YVITSLCGPACPCPDVLVVVLFWIGYFNSTLNPLIYAYFNRDFREAFRNTLECVLP-CLE 1246
Query: 73 CFKNAHTLSYV 83
+N + YV
Sbjct: 1247 K-RNPYNAYYV 1256
|
|
| FB|FBgn0038980 oa2 "octopamine receptor 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038063 Octbeta2R "Octbeta2R" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-021010-4 adra2da "adrenergic, alpha-2D-, receptor a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NAZ2 HTR1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-071203-1 htr1aa "5-hydroxytryptamine (serotonin) receptor 1A a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038653 CG18208 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-021010-5 adra2db "adrenergic, alpha-2D-, receptor b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96273 Htr1a "5-hydroxytryptamine (serotonin) receptor 1A" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NBV5 ADRA2B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 83 | |||
| PHA03234 | 338 | DNA packaging protein UL33; Provisional | 99.21 | |
| KOG4220|consensus | 503 | 99.0 | ||
| PHA02834 | 323 | chemokine receptor-like protein; Provisional | 98.94 | |
| PHA03235 | 409 | DNA packaging protein UL33; Provisional | 98.92 | |
| PHA02638 | 417 | CC chemokine receptor-like protein; Provisional | 98.91 | |
| KOG4219|consensus | 423 | 98.8 | ||
| PHA03087 | 335 | G protein-coupled chemokine receptor-like protein; | 98.74 | |
| KOG2087|consensus | 363 | 97.87 | ||
| PF10320 | 257 | 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep | 97.18 | |
| PF00001 | 257 | 7tm_1: 7 transmembrane receptor (rhodopsin family) | 97.05 | |
| PF10324 | 318 | 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept | 97.04 | |
| PF10323 | 283 | 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept | 95.21 | |
| PF10321 | 313 | 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept | 94.35 | |
| PF05296 | 303 | TAS2R: Mammalian taste receptor protein (TAS2R); I | 91.98 |
| >PHA03234 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
Probab=99.21 E-value=1.6e-11 Score=79.88 Aligned_cols=40 Identities=28% Similarity=0.459 Sum_probs=34.6
Q ss_pred HHHHHHHHHHHhhhhhhhHhHHhccHHHHHHHHHHhcccC
Q psy4506 28 YIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVF 67 (83)
Q Consensus 28 ~~~~~~~~l~~~ns~~nP~iY~~~~~~~r~~~~~~~~~~~ 67 (83)
..+.++.+++++|||+||+||++.+++||+++++.+++..
T Consensus 279 ~~~~v~~~La~~nsclNPiIY~f~~~~FR~~~~~~~~~~~ 318 (338)
T PHA03234 279 ILQIIIRLMPEIHCFSNPLVYAFTGGDFRLRFTACFQDFF 318 (338)
T ss_pred HHHHHHHHHHHhhhhhhHHHHHHhhHHHHHHHHHHHHHHh
Confidence 3457888999999999999999999999999998876543
|
|
| >KOG4220|consensus | Back alignment and domain information |
|---|
| >PHA02834 chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03235 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PHA02638 CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4219|consensus | Back alignment and domain information |
|---|
| >PHA03087 G protein-coupled chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2087|consensus | Back alignment and domain information |
|---|
| >PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] | Back alignment and domain information |
|---|
| >PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 83 | ||||
| 3pbl_A | 481 | Structure Of The Human Dopamine D3 Receptor In Comp | 1e-04 | ||
| 3rze_A | 452 | Structure Of The Human Histamine H1 Receptor In Com | 2e-04 | ||
| 2y00_B | 315 | Turkey Beta1 Adrenergic Receptor With Stabilising M | 4e-04 | ||
| 2vt4_A | 313 | Turkey Beta1 Adrenergic Receptor With Stabilising M | 4e-04 | ||
| 3uon_A | 467 | Structure Of The Human M2 Muscarinic Acetylcholine | 8e-04 |
| >pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 | Back alignment and structure |
|
| >pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 | Back alignment and structure |
| >pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 | Back alignment and structure |
| >pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 | Back alignment and structure |
| >pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 83 | |||
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 2e-16 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 7e-16 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 4e-15 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 7e-15 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 1e-14 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 1e-14 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 2e-14 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 5e-14 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 1e-12 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 8e-07 | |
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 1e-06 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 3e-05 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 6e-05 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 9e-05 |
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 | Back alignment and structure |
|---|
Score = 71.3 bits (174), Expect = 2e-16
Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
Query: 12 LYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSF 65
++++T C C + + W+GY NS LNP++Y FN +FR+AF LS
Sbjct: 420 THVLNTHC-QTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC 472
|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 | Back alignment and structure |
|---|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 | Back alignment and structure |
|---|
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 83 | |||
| 4grv_A | 510 | Neurotensin receptor type 1, lysozyme chimera; G-p | 99.5 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 99.35 | |
| 2koe_A | 40 | Human cannabinoid receptor 1 - helix 7/8 peptide; | 99.35 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 99.31 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 99.29 | |
| 3vw7_A | 484 | Proteinase-activated receptor 1, lysozyme; high re | 99.26 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 99.25 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 99.25 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 99.23 | |
| 2lnl_A | 296 | C-X-C chemokine receptor type 1; G protein coupled | 99.21 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 99.16 | |
| 1u19_A | 349 | Rhodopsin; G protein-coupled receptor, membrane pr | 99.15 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 99.14 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 99.12 | |
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 99.08 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 99.02 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 98.95 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 98.93 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 98.9 |
| >4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.50 E-value=1e-15 Score=101.78 Aligned_cols=40 Identities=28% Similarity=0.590 Sum_probs=27.8
Q ss_pred HHHHHHHHHHhhhhhhhHhHHhccHHHHHHHHHHhcccCC
Q psy4506 29 IVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFP 68 (83)
Q Consensus 29 ~~~~~~~l~~~ns~~nP~iY~~~~~~~r~~~~~~~~~~~~ 68 (83)
...++.||+++|||+||+||++.|++||++++++++|+..
T Consensus 451 ~~~~~~~L~Y~NS~iNPiIY~~~n~~FR~aFk~iL~C~C~ 490 (510)
T 4grv_A 451 FYMLTNALAYASSAINPILYNLVSANFRQVFLSTLACLCP 490 (510)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHSCCCCC----------
T ss_pred HHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHhhcCC
Confidence 4567889999999999999999999999999999987544
|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* | Back alignment and structure |
|---|
| >2koe_A Human cannabinoid receptor 1 - helix 7/8 peptide; GPCR, HCB1, membrane protein, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A | Back alignment and structure |
|---|
| >3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* | Back alignment and structure |
|---|
| >2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* | Back alignment and structure |
|---|
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 83 | ||||
| d1u19a_ | 348 | f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: | 8e-06 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Score = 39.6 bits (91), Expect = 8e-06
Identities = 12/54 (22%), Positives = 19/54 (35%)
Query: 10 IYLYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTL 63
D +TI + ++V NP++Y N+ FR TL
Sbjct: 268 YAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTL 321
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 83 | |||
| d1u19a_ | 348 | Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | 99.24 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.24 E-value=2.6e-11 Score=74.74 Aligned_cols=48 Identities=25% Similarity=0.372 Sum_probs=40.3
Q ss_pred CCCCCcHHHHHHHHHHHHhhhhhhhHhHHhccHHHHHHHHHHhcccCC
Q psy4506 21 PPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFP 68 (83)
Q Consensus 21 ~~~~~~~~~~~~~~~l~~~ns~~nP~iY~~~~~~~r~~~~~~~~~~~~ 68 (83)
...........+..+++.+||++||+||.+++++||++++++++|+..
T Consensus 279 ~~~~~~~~~~~~~~~l~~~ns~iNPiIY~~~~~~fR~~~~~~l~c~~~ 326 (348)
T d1u19a_ 279 QGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKN 326 (348)
T ss_dssp TTSCCCHHHHHHHHHHGGGGGTHHHHHHHHTCHHHHHHHHHHHTSSCC
T ss_pred CCccccHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHhCCCCC
Confidence 344445667778889999999999999999999999999999976544
|