Psyllid ID: psy4573


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MCPYKKPSLHQVSFRFYASRKKRGHEKTLPRAKKCREVEQDGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRHHVRSHHSSARLGLNLLDHELSMITSKG
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccHHcccccccccccccccccHHccccccHHHHHHccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccc
ccccccEEEcccccccccccccccEccccHHHHHccccccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEcccccEEccccEEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccEcccccccEccccccc
mcpykkpslhqvSFRFYASrkkrghektlprakkcreveqdgslacnvcskrcgsksglkihmksHTLSKRYACSICLAefhtltekdrhtlshvvegeykcnqcDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGffrkakyethniqkhnappfecesckkIFTYhkntthlgikfecevchrklstknhLRLHMrthtnerpavcsycgkgfrrgdaLTEHirihtgqrpyvceicgkgftqkqalnthkrghtgeipyhcefcserfstkALVRHHVrshhssarlGLNLLDHELSMITSKG
mcpykkpslhqvsfrfyasrkkrghektlprakkcreveqdgslacnvcskrcgsksglkIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHniqkhnappfECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHlrlhmrthtnerpavcsyCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRHHVRshhssarlglnlldhelsmitskg
MCPYKKPSLHQVSFRFYASRKKRGHEKTLPRAKKCREVEQDGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKalvrhhvrshhssarlGLNLLDHELSMITSKG
******************************************SLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRHHVRSHH**ARLGLNLL***********
*CPYKKPSLHQVSFRFYASRKKRGHEKTLPRAKKCREVEQDGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRHHVRSHHSSARLGLNLLDHELSMI****
MCPYKKPSLHQVSFRFYASR***********AKKCREVEQDGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALV**********ARLGLNLLDHELSMITSKG
****KKPSLHQVSFRFYASRKKRGHEKTLPRAKKCREVEQDGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRHHVRSHHSSARLGLNLLDHE********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCPYKKPSLHQVSFRFYASRKKRGHEKTLPRAKKCREVEQDGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRHHVRSHHSSARLGLNLLDHELSMITSKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
C9JN71531 Zinc finger protein 878 O yes N/A 0.781 0.450 0.395 2e-43
Q9UJU3 913 Zinc finger protein 112 O no N/A 0.745 0.249 0.384 2e-39
A0JNB1787 Zinc finger protein 227 O no N/A 0.781 0.303 0.359 2e-39
Q86WZ6799 Zinc finger protein 227 O no N/A 0.781 0.299 0.359 5e-39
Q5MCW4686 Zinc finger protein 569 O no N/A 0.846 0.377 0.350 3e-38
Q0VGE8651 Zinc finger protein 816 O no N/A 0.781 0.367 0.379 5e-38
Q6ZMW2699 Zinc finger protein 782 O no N/A 0.781 0.341 0.371 1e-37
Q0VAW7879 Zinc finger protein 112 O no N/A 0.790 0.275 0.358 3e-37
A1YF12 682 Zinc finger protein 16 OS N/A N/A 0.784 0.351 0.373 5e-37
Q5R5U3 672 Zinc finger protein 271 O no N/A 0.781 0.355 0.359 9e-37
>sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 Back     alignment and function desciption
 Score =  176 bits (446), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 129/245 (52%), Gaps = 6/245 (2%)

Query: 46  CNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQC 105
           CN+C K   S S LK H KSHT  KRY C  C   F+  +    H  +H  E  Y+C QC
Sbjct: 229 CNICGKAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYHERTHSGEKPYECTQC 288

Query: 106 DHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIF 165
               + + YL+ H +KH  E    C LC +GF     +  H        P+EC+ C K F
Sbjct: 289 RKAFRSVKYLRVHERKHTGEKPYECKLCGKGFISSTSFRYHEKTHTGEKPYECKKCVKAF 348

Query: 166 TYHKNT-----THLGIK-FECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGD 219
           ++ K+      TH G K FEC+ C +  ++ N    H RTHT E+P  C  CGK FR   
Sbjct: 349 SFVKDLRIHERTHTGEKPFECKQCGKTFTSSNSFHYHERTHTGEKPYECKQCGKAFRSAS 408

Query: 220 ALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRH 279
            L +HIR HTG++PY C+ CGK F     L  H+R HTGE PY C+ C + F +   +R+
Sbjct: 409 VLQKHIRTHTGEKPYGCKQCGKVFRVASQLKMHERTHTGEKPYECKQCGKAFISSNSIRY 468

Query: 280 HVRSH 284
           H R+H
Sbjct: 469 HKRTH 473




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 Back     alignment and function description
>sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 Back     alignment and function description
>sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=2 SV=1 Back     alignment and function description
>sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=2 SV=1 Back     alignment and function description
>sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 Back     alignment and function description
>sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 Back     alignment and function description
>sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 Back     alignment and function description
>sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 Back     alignment and function description
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
402904356 503 PREDICTED: zinc finger protein 878-like 0.781 0.475 0.4 5e-43
355755487 477 hypothetical protein EGM_09298, partial 0.781 0.501 0.4 9e-43
355703173 578 hypothetical protein EGK_10148 [Macaca m 0.781 0.413 0.395 3e-42
426387313 531 PREDICTED: zinc finger protein 878 [Gori 0.781 0.450 0.395 6e-42
332634996 531 zinc finger protein 878 [Homo sapiens] g 0.781 0.450 0.395 1e-41
441628330 503 PREDICTED: zinc finger protein 878 [Noma 0.781 0.475 0.4 1e-41
397485309 1055 PREDICTED: zinc finger protein 878-like 0.781 0.226 0.395 1e-41
405950372 592 Histone-lysine N-methyltransferase PRDM9 0.787 0.407 0.372 2e-41
390478614 1748 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.781 0.136 0.387 2e-41
410053259 503 PREDICTED: zinc finger protein 878 [Pan 0.781 0.475 0.395 4e-41
>gi|402904356|ref|XP_003915012.1| PREDICTED: zinc finger protein 878-like [Papio anubis] Back     alignment and taxonomy information
 Score =  181 bits (458), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 132/245 (53%), Gaps = 6/245 (2%)

Query: 46  CNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQC 105
           CN+C K   S S LK H KSHT  KRY C+ C   F+ L+    H  +H  E  Y+C QC
Sbjct: 201 CNICGKAFFSPSSLKRHEKSHTGEKRYKCTQCGKAFNCLSSFQYHERTHSGEKPYECTQC 260

Query: 106 DHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIF 165
               + + YL+ H +KH  E    C LC +GF     +  H        P+EC+ C+K F
Sbjct: 261 RKAFRSVKYLRVHERKHTGEKPYECKLCGKGFISSTSFRYHEKTHTGEKPYECKKCEKAF 320

Query: 166 TYHKNT-----THLGIK-FECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGD 219
           ++ K+      TH G K FEC+ C +  ++ N    H RTHT E+P  C  CGK FR   
Sbjct: 321 SFVKDLRIHERTHTGEKPFECKRCGKTFTSSNSFHYHERTHTGEKPYECEQCGKAFRSAS 380

Query: 220 ALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRH 279
            L +HIR HTG++PY C+ CGK F     L  H+R HTGE PY C+ C + F +   +R+
Sbjct: 381 ILQKHIRTHTGEKPYGCKQCGKAFRVASQLKMHERTHTGEKPYECKQCGKAFISSNSIRY 440

Query: 280 HVRSH 284
           H R+H
Sbjct: 441 HKRTH 445




Source: Papio anubis

Species: Papio anubis

Genus: Papio

Family: Cercopithecidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|355755487|gb|EHH59234.1| hypothetical protein EGM_09298, partial [Macaca fascicularis] Back     alignment and taxonomy information
>gi|355703173|gb|EHH29664.1| hypothetical protein EGK_10148 [Macaca mulatta] Back     alignment and taxonomy information
>gi|426387313|ref|XP_004060115.1| PREDICTED: zinc finger protein 878 [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|332634996|ref|NP_001073873.2| zinc finger protein 878 [Homo sapiens] gi|325511372|sp|C9JN71.2|ZN878_HUMAN RecName: Full=Zinc finger protein 878 Back     alignment and taxonomy information
>gi|441628330|ref|XP_003275706.2| PREDICTED: zinc finger protein 878 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|397485309|ref|XP_003813795.1| PREDICTED: zinc finger protein 878-like [Pan paniscus] Back     alignment and taxonomy information
>gi|405950372|gb|EKC18365.1| Histone-lysine N-methyltransferase PRDM9 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|390478614|ref|XP_002807853.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 729 [Callithrix jacchus] Back     alignment and taxonomy information
>gi|410053259|ref|XP_003953422.1| PREDICTED: zinc finger protein 878 [Pan troglodytes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
UNIPROTKB|C9JN71531 ZNF878 "Zinc finger protein 87 0.738 0.425 0.400 8.8e-47
UNIPROTKB|Q0VGE8651 ZNF816 "Zinc finger protein 81 0.748 0.351 0.378 8.1e-44
ZFIN|ZDB-GENE-110913-94419 si:dkey-199m13.3 "si:dkey-199m 0.826 0.603 0.357 1.3e-43
RGD|2293498455 Zfp9 "zinc finger protein 9" [ 0.882 0.593 0.35 1.3e-43
UNIPROTKB|B1AKS7420 ZNF25 "Zinc finger protein 25" 0.862 0.628 0.346 1.7e-43
UNIPROTKB|P17030456 ZNF25 "Zinc finger protein 25" 0.862 0.578 0.346 1.7e-43
UNIPROTKB|F1LNE0454 Zfp9 "Protein Zfp9" [Rattus no 0.879 0.592 0.35 2.2e-43
UNIPROTKB|A4IFL9 641 LOC100125304 "LOC100125304 pro 0.748 0.357 0.395 2.8e-43
UNIPROTKB|F1P9J6 633 ZNF16 "Uncharacterized protein 0.751 0.363 0.381 9.3e-43
ZFIN|ZDB-GENE-110913-27419 si:ch211-241n15.2 "si:ch211-24 0.745 0.544 0.372 9.3e-43
UNIPROTKB|C9JN71 ZNF878 "Zinc finger protein 878" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 490 (177.5 bits), Expect = 8.8e-47, P = 8.8e-47
 Identities = 93/232 (40%), Positives = 121/232 (52%)

Query:    46 CNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQC 105
             CN+C K   S S LK H KSHT  KRY C  C   F+  +    H  +H  E  Y+C QC
Sbjct:   229 CNICGKAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYHERTHSGEKPYECTQC 288

Query:   106 DHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIF 165
                 + + YL+ H +KH  E    C LC +GF     +  H        P+EC+ C K F
Sbjct:   289 RKAFRSVKYLRVHERKHTGEKPYECKLCGKGFISSTSFRYHEKTHTGEKPYECKKCVKAF 348

Query:   166 TYHKNT-----THLGIK-FECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGD 219
             ++ K+      TH G K FEC+ C +  ++ N    H RTHT E+P  C  CGK FR   
Sbjct:   349 SFVKDLRIHERTHTGEKPFECKQCGKTFTSSNSFHYHERTHTGEKPYECKQCGKAFRSAS 408

Query:   220 ALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERF 271
              L +HIR HTG++PY C+ CGK F     L  H+R HTGE PY C+ C + F
Sbjct:   409 VLQKHIRTHTGEKPYGCKQCGKVFRVASQLKMHERTHTGEKPYECKQCGKAF 460


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|Q0VGE8 ZNF816 "Zinc finger protein 816" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-94 si:dkey-199m13.3 "si:dkey-199m13.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|2293498 Zfp9 "zinc finger protein 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B1AKS7 ZNF25 "Zinc finger protein 25" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P17030 ZNF25 "Zinc finger protein 25" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LNE0 Zfp9 "Protein Zfp9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A4IFL9 LOC100125304 "LOC100125304 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P9J6 ZNF16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-27 si:ch211-241n15.2 "si:ch211-241n15.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 306
KOG1074|consensus958 99.95
KOG2462|consensus279 99.95
KOG2462|consensus279 99.94
KOG3608|consensus467 99.93
KOG3608|consensus467 99.93
KOG1074|consensus 958 99.89
KOG3623|consensus 1007 99.89
KOG3623|consensus 1007 99.83
KOG3576|consensus267 99.74
KOG3576|consensus267 99.69
PLN03086567 PRLI-interacting factor K; Provisional 99.29
PLN03086567 PRLI-interacting factor K; Provisional 99.19
PHA00733128 hypothetical protein 99.17
PHA00733128 hypothetical protein 99.05
KOG3993|consensus500 99.02
PHA0276855 hypothetical protein; Provisional 98.82
PHA0276855 hypothetical protein; Provisional 98.75
KOG3993|consensus500 98.54
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.47
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.46
PHA0061644 hypothetical protein 98.45
PHA0073279 hypothetical protein 98.28
PHA0061644 hypothetical protein 98.27
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.2
PHA0073279 hypothetical protein 98.14
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.94
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.76
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.66
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.63
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.56
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.53
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.5
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.41
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.36
COG5189423 SFP1 Putative transcriptional repressor regulating 97.16
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.95
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.67
smart0035526 ZnF_C2H2 zinc finger. 96.65
smart0035526 ZnF_C2H2 zinc finger. 96.53
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.5
COG5236493 Uncharacterized conserved protein, contains RING Z 96.43
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.41
COG5189423 SFP1 Putative transcriptional repressor regulating 96.23
KOG1146|consensus 1406 96.07
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.05
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.01
PRK04860160 hypothetical protein; Provisional 95.9
PRK04860160 hypothetical protein; Provisional 95.89
KOG2785|consensus 390 95.59
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.57
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.53
KOG2231|consensus 669 95.32
KOG2482|consensus423 94.64
KOG2231|consensus 669 94.63
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 94.26
KOG2785|consensus390 94.15
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.02
KOG2482|consensus423 93.92
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 93.53
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.38
KOG1146|consensus 1406 92.5
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 92.27
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.02
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.99
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.76
KOG2893|consensus 341 91.55
COG404965 Uncharacterized protein containing archaeal-type C 91.18
COG5048467 FOG: Zn-finger [General function prediction only] 90.5
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 90.11
KOG4173|consensus253 88.94
COG404965 Uncharacterized protein containing archaeal-type C 87.43
KOG2893|consensus 341 86.1
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 85.82
COG5048 467 FOG: Zn-finger [General function prediction only] 85.78
KOG4173|consensus253 85.52
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 85.28
PHA0062659 hypothetical protein 83.91
PF1371736 zinc_ribbon_4: zinc-ribbon domain 83.32
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 83.26
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 82.9
PF1371937 zinc_ribbon_5: zinc-ribbon domain 82.15
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 81.51
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 80.49
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 80.31
>KOG1074|consensus Back     alignment and domain information
Probab=99.95  E-value=8.5e-29  Score=221.55  Aligned_cols=191  Identities=27%  Similarity=0.528  Sum_probs=149.0

Q ss_pred             ccCCCChhhhccHHHHHHHHHhcccCCccccCcchhhccchHHHHHHhhhcCC----CCCcccc---ccccccccccc--
Q psy4573         100 YKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHN----APPFECE---SCKKIFTYHKN--  170 (306)
Q Consensus       100 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~----~~~~~c~---~c~~~f~~~~~--  170 (306)
                      .+|-+|.+..+-.+.|+.|+++|++++||+|.+|+++|.++.+|+.|+..|..    ..++.|+   +|-+-|...-.  
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            67999999999999999999999999999999999999999999999766653    3457888   88887764322  


Q ss_pred             ---cccc--------------CcceeccccccccCChHHHHHHHhhccC----------------CC----CcccCcCCC
Q psy4573         171 ---TTHL--------------GIKFECEVCHRKLSTKNHLRLHMRTHTN----------------ER----PAVCSYCGK  213 (306)
Q Consensus       171 ---~~~~--------------~~~~~C~~C~~~f~~~~~l~~H~~~h~~----------------~~----~~~C~~C~~  213 (306)
                         .+|.              ...-.|..|.+.|.+...+..++..|.+                +.    +..+..|+.
T Consensus       686 QhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~  765 (958)
T KOG1074|consen  686 QHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGR  765 (958)
T ss_pred             ceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccccc
Confidence               1111              1135699999999999999998877621                11    344556666


Q ss_pred             ccCCcHHHHHHHHHc-----------------------cC----------------------------------------
Q psy4573         214 GFRRGDALTEHIRIH-----------------------TG----------------------------------------  230 (306)
Q Consensus       214 ~f~~~~~l~~H~~~h-----------------------~~----------------------------------------  230 (306)
                      .+.....+..+-..+                       +.                                        
T Consensus       766 ~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~  845 (958)
T KOG1074|consen  766 ELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKT  845 (958)
T ss_pred             ccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccccc
Confidence            655444333331111                       00                                        


Q ss_pred             -------------------------------CCCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhhcChHHHHH
Q psy4573         231 -------------------------------QRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRH  279 (306)
Q Consensus       231 -------------------------------~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  279 (306)
                                                     .....|..||+.|...+.|..|+++|.++++|.|.+|++.|+.+.+|..
T Consensus       846 n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKv  925 (958)
T KOG1074|consen  846 NEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKV  925 (958)
T ss_pred             ccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhh
Confidence                                           0116899999999999999999999999999999999999999999999


Q ss_pred             HhhhcCCCCCC
Q psy4573         280 HVRSHHSSARL  290 (306)
Q Consensus       280 H~~~~h~~~~~  290 (306)
                      ||.+|++..+.
T Consensus       926 HMgtH~w~q~~  936 (958)
T KOG1074|consen  926 HMGTHMWVQPP  936 (958)
T ss_pred             hhccccccCCC
Confidence            99999998763



>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-25
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-16
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-15
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 7e-15
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 9e-15
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-14
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-14
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-14
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-14
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 5e-14
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-14
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 6e-14
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-13
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-13
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-13
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 3e-13
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-11
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 8e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-11
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-11
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 6e-11
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-10
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-10
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-10
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-09
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-08
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 7e-08
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 1e-07
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 2e-07
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 5e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 2e-07
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 8e-07
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 9e-07
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 1e-06
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-06
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 7e-06
2ysv_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-04
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 8e-04
2eps_A54 Solution Structure Of The 4th Zinc Finger Domain Of 9e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 111 bits (278), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 64/168 (38%), Positives = 81/168 (48%), Gaps = 6/168 (3%) Query: 97 EGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPF 156 E Y C +C + +L H + H E C C + F K H P+ Sbjct: 19 EKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPY 78 Query: 157 ECESCKKIFTYHKNT-----THLGIK-FECEVCHRKLSTKNHLRLHMRTHTNERPAVCSY 210 +C C K F+ N TH G K + C C + S HLR H RTHT E+P C Sbjct: 79 KCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPE 138 Query: 211 CGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTG 258 CGK F R D L H R HTG++PY C CGK F+++ ALN H+R HTG Sbjct: 139 CGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTG 186
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2YSV|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 17 In Zinc Finger Protein 473 Length = 42 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2EPS|A Chain A, Solution Structure Of The 4th Zinc Finger Domain Of Zinc Finger Protein 278 Length = 54 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-33
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-33
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-30
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-30
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-28
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-31
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-30
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-24
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-30
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-26
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-29
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-20
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-17
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-29
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-28
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-27
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-26
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-23
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-23
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-25
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-20
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-25
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-15
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-25
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-25
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-22
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-25
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-24
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-13
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-23
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-20
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-23
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-17
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-21
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-20
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-17
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-16
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 9e-13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 8e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-10
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-13
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-13
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-13
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-13
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-13
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-13
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-12
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-12
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-12
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-10
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-12
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-12
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-12
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-12
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-10
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-12
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-12
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-10
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 8e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-12
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-12
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-12
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-09
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-10
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 9e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-10
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 8e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 9e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 6e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  118 bits (299), Expect = 7e-33
 Identities = 57/136 (41%), Positives = 79/136 (58%), Gaps = 6/136 (4%)

Query: 155 PFECESCKKIFTYHKN-----TTHLGIK-FECEVCHRKLSTKNHLRLHMRTHTNERPAVC 208
           P++C  C K F+  K+      TH G K ++C  C +  S + +LR H RTHT E+P  C
Sbjct: 49  PYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYAC 108

Query: 209 SYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCS 268
             CGK F +   L  H R HTG++PY C  CGK F+++  L+TH+R HTGE PY C  C 
Sbjct: 109 PECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECG 168

Query: 269 ERFSTKALVRHHVRSH 284
           + FS +  +  H R+H
Sbjct: 169 KSFSRRDALNVHQRTH 184


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.86
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.81
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.8
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.8
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.79
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.79
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.79
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.79
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.78
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.78
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.78
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.77
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.77
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.73
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.71
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.71
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.7
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.7
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.7
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.66
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.64
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.64
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.62
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.61
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.6
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.59
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.58
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.58
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.55
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.55
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.55
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.52
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.52
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.52
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.51
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.51
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.5
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.5
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.49
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.49
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.48
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.48
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.48
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.45
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.45
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.45
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.45
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.44
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.43
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.42
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.41
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.39
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.39
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.38
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.34
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.33
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.31
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.31
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.29
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.28
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.23
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.22
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.19
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.19
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.19
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.18
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.18
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.17
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.17
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.14
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.1
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.1
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.03
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.03
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.01
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.01
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.01
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.0
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.0
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.99
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.99
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.98
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.97
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.96
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.95
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.94
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.93
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.92
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.92
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.92
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.92
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.9
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.9
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.9
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.88
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.87
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.84
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.83
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.82
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.82
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.79
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.78
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.77
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.74
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.65
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.61
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.61
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.58
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.56
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.55
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.54
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.54
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.53
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.45
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.4
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.39
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.38
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.36
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.26
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.24
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.2
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.2
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.15
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.15
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.15
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.14
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.11
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.09
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.08
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.07
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.07
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.06
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.06
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.06
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.04
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.04
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.04
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.04
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.03
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.02
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.25
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.99
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.98
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.21
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.95
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.95
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.94
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.94
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.94
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.93
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.92
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.92
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.09
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.87
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.86
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.86
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.86
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.06
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.03
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.82
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.95
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.69
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.66
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.49
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.46
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.37
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.42
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.14
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.0
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.99
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.79
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.4
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.82
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.48
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 92.81
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 89.7
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 88.95
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 86.46
2k5c_A95 Uncharacterized protein PF0385; structural genomic 84.24
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 83.75
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 82.2
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 81.87
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.14
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=2.9e-38  Score=252.26  Aligned_cols=184  Identities=35%  Similarity=0.677  Sum_probs=99.3

Q ss_pred             HHHHHHhhhcCCCCceecccchhccCChHHHhhhhhhcccCCcccCCCChhhhccHHHHHHHHHhcccCCccccCcchhh
Q psy4573          57 SGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEG  136 (306)
Q Consensus        57 ~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~  136 (306)
                      ..|..|+..+.++++|.|.+|++.|.....|..|++.|.+..+|.|++|++.|.+...|..|++.|.++.+         
T Consensus         7 ~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~---------   77 (190)
T 2i13_A            7 SSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKP---------   77 (190)
T ss_dssp             ------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCC---------
T ss_pred             ccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCC---------
Confidence            34445555555555555555555555555555555555555555555555555555555555554444433         


Q ss_pred             ccchHHHHHHhhhcCCCCCcccccccccccccccccccCcceeccccccccCChHHHHHHHhhccCCCCcccCcCCCccC
Q psy4573         137 FFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFR  216 (306)
Q Consensus       137 ~~~~~~l~~H~~~~h~~~~~~c~~c~~~f~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  216 (306)
                                                               |.|+.|++.|.+...|..|++.|.++++|.|.+|++.|.
T Consensus        78 -----------------------------------------~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  116 (190)
T 2i13_A           78 -----------------------------------------YKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFS  116 (190)
T ss_dssp             -----------------------------------------EECTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEES
T ss_pred             -----------------------------------------ccCcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccC
Confidence                                                     445555555566666666677776777777777777777


Q ss_pred             CcHHHHHHHHHccCCCCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhhcChHHHHHHhhhcCCCCCC
Q psy4573         217 RGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRHHVRSHHSSARL  290 (306)
Q Consensus       217 ~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~  290 (306)
                      +...|..|+++|+++++|.|++|++.|.+...|..|++.|+++++|.|++|+++|.....|..|+++|+++.+|
T Consensus       117 ~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          117 QLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             SHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             CHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            77777777777777777777777777777777777777777777777777777777777777777777766543



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 306
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 5e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.001
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.003
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 3e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.003
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 5e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.003
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.002
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.002
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.003
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 50.3 bits (121), Expect = 2e-09
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 227 IHTGQRPYVCEICGKGFTQKQALNTHKRGHTGE 259
           IH+G++PY C  CGK F++   L  H+R HTGE
Sbjct: 1   IHSGEKPYGCVECGKAFSRSSILVQHQRVHTGE 33


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.13
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.12
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.12
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.06
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.04
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.03
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.98
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.96
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.96
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.94
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.93
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.91
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.89
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.86
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.86
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.84
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.78
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.76
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.75
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.74
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.71
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.69
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.66
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.63
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.58
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.56
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.51
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.47
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.45
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.38
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.35
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.3
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.27
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.23
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.21
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.11
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.08
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.0
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.97
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.96
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.91
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.85
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.78
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.73
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.71
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.58
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.5
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.48
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.45
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.42
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.39
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.37
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.32
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.26
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.25
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.23
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.18
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.15
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.14
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.12
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.09
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.06
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.97
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.8
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.79
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.78
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.68
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.58
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.55
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.55
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.35
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.33
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.3
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.21
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.17
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.13
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.98
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.84
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.65
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.5
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.42
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.36
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.21
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.1
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.01
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.95
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.95
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.93
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.79
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.38
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.82
d1y0jb136 U-shaped transcription factor, different fingers { 93.67
d1y0jb136 U-shaped transcription factor, different fingers { 93.42
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.79
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.02
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 91.7
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.26
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.08
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.95
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 90.61
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.94
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 89.74
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.54
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 89.39
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 89.29
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.93
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 88.34
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.08
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 87.73
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 87.66
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 87.11
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.16
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 85.26
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 84.54
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 84.48
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 82.5
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 81.36
d2ctda153 Zinc finger protein 512, ZNF512 {Human (Homo sapie 80.22
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60  E-value=3.6e-16  Score=94.62  Aligned_cols=51  Identities=37%  Similarity=0.766  Sum_probs=25.2

Q ss_pred             CCcccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcCCChhHHHHHHhh
Q psy4573         204 RPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRG  255 (306)
Q Consensus       204 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~  255 (306)
                      +||.| .||+.|.....|..|+++|++++||.|++||+.|...+.|..|+++
T Consensus         2 K~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1           2 KLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             CCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             cCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence            44455 2555555555555555555555555555555555555555555444



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda1 g.37.1.1 (A:8-60) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure