Psyllid ID: psy4615
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 477 | 2.2.26 [Sep-21-2011] | |||||||
| Q7ZXY0 | 563 | Inositol-3-phosphate synt | N/A | N/A | 0.360 | 0.305 | 0.697 | 1e-65 | |
| Q6DDT1 | 563 | Inositol-3-phosphate synt | N/A | N/A | 0.352 | 0.298 | 0.708 | 2e-65 | |
| Q40271 | 512 | Inositol-3-phosphate synt | N/A | N/A | 0.322 | 0.300 | 0.746 | 3e-64 | |
| Q9S7U0 | 510 | Inositol-3-phosphate synt | N/A | N/A | 0.322 | 0.301 | 0.740 | 6e-64 | |
| Q9LW96 | 510 | Inositol-3-phosphate synt | N/A | N/A | 0.322 | 0.301 | 0.733 | 7e-64 | |
| Q9SSV4 | 510 | Inositol-3-phosphate synt | N/A | N/A | 0.322 | 0.301 | 0.733 | 8e-64 | |
| P42801 | 511 | Inositol-3-phosphate synt | yes | N/A | 0.322 | 0.301 | 0.727 | 1e-63 | |
| Q96348 | 510 | Inositol-3-phosphate synt | N/A | N/A | 0.322 | 0.301 | 0.733 | 1e-63 | |
| Q41107 | 511 | Inositol-3-phosphate synt | N/A | N/A | 0.322 | 0.301 | 0.727 | 1e-63 | |
| Q38862 | 510 | Inositol-3-phosphate synt | no | N/A | 0.322 | 0.301 | 0.727 | 1e-63 |
| >sp|Q7ZXY0|INO1A_XENLA Inositol-3-phosphate synthase 1-A OS=Xenopus laevis GN=isyna1-a PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 250 bits (639), Expect = 1e-65, Method: Compositional matrix adjust.
Identities = 120/172 (69%), Positives = 136/172 (79%)
Query: 293 ISKSNVVDDMVASNSILYRPGEKPDHTVVIKYVPYVGDSKRALDEYTSEILLGGHNTISM 352
ISKSNVVDDMV SN ILY P EKPDH VVIKYVPYVGDSKRA+DEYTSEI++GG NTI +
Sbjct: 351 ISKSNVVDDMVQSNPILYGPNEKPDHCVVIKYVPYVGDSKRAMDEYTSEIMMGGANTIVL 410
Query: 353 HNTCEDSLLASPLILDLIILAELSSRIQFTSPTVAEYTYFHPVLSILSYLCKAPLVPPGT 412
HNTCEDSLLASP+ILDL++L EL RI F + T E+ FH VLSILS+LCKAPLVP GT
Sbjct: 411 HNTCEDSLLASPIILDLVLLTELCQRITFRTETDQEFQTFHSVLSILSFLCKAPLVPAGT 470
Query: 413 PVVNALAQQRSCIENILRACLSLPPENSMTLEHKLPRRLFQDKSKSIDSHPQ 464
PV+NA +QR+CIENILRACL L P+N M LEHK+ R K S +PQ
Sbjct: 471 PVINAFFRQRNCIENILRACLGLSPQNHMMLEHKMQRSFVSLKRPSTVCNPQ 522
|
Key enzyme in myo-inositol biosynthesis pathway that catalyzes the conversion of glucose 6-phosphate to 1-myo-inositol 1-phosphate in a NAD-dependent manner. Rate-limiting enzyme in the synthesis of all inositol-containing compounds. Xenopus laevis (taxid: 8355) EC: 5EC: .EC: 5EC: .EC: 1EC: .EC: 4 |
| >sp|Q6DDT1|INO1B_XENLA Inositol-3-phosphate synthase 1-B OS=Xenopus laevis GN=isyna1-b PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q40271|INO1_MESCR Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9S7U0|INO1_WHEAT Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LW96|INO1_TOBAC Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SSV4|INO1_NICPA Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P42801|INO1_ARATH Inositol-3-phosphate synthase isozyme 1 OS=Arabidopsis thaliana GN=At4g39800 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q96348|INO1_BRANA Inositol-3-phosphate synthase OS=Brassica napus PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q41107|INO1_PHAVU Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q38862|INO2_ARATH Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 477 | ||||||
| 332374410 | 525 | unknown [Dendroctonus ponderosae] | 0.368 | 0.335 | 0.697 | 6e-67 | |
| 350395981 | 514 | PREDICTED: inositol-3-phosphate synthase | 0.324 | 0.301 | 0.794 | 5e-66 | |
| 383862822 | 512 | PREDICTED: inositol-3-phosphate synthase | 0.324 | 0.302 | 0.801 | 6e-66 | |
| 340730177 | 516 | PREDICTED: inositol-3-phosphate synthase | 0.324 | 0.300 | 0.794 | 6e-66 | |
| 380017684 | 513 | PREDICTED: inositol-3-phosphate synthase | 0.324 | 0.302 | 0.788 | 2e-65 | |
| 66546786 | 513 | PREDICTED: inositol-3-phosphate synthase | 0.324 | 0.302 | 0.788 | 2e-65 | |
| 307185895 | 519 | Inositol-3-phosphate synthase A [Campono | 0.333 | 0.306 | 0.745 | 8e-65 | |
| 332022385 | 520 | Inositol-3-phosphate synthase 1-A [Acrom | 0.333 | 0.305 | 0.740 | 9e-65 | |
| 291222917 | 540 | PREDICTED: inositol-3-phosphate synthase | 0.324 | 0.287 | 0.754 | 1e-64 | |
| 291239737 | 541 | PREDICTED: inositol-3-phosphate synthase | 0.324 | 0.286 | 0.754 | 2e-64 |
| >gi|332374410|gb|AEE62346.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
Score = 261 bits (666), Expect = 6e-67, Method: Compositional matrix adjust.
Identities = 127/182 (69%), Positives = 148/182 (81%), Gaps = 6/182 (3%)
Query: 293 ISKSNVVDDMVASNSILYRPGEKPDHTVVIKYVPYVGDSKRALDEYTSEILLGGHNTISM 352
ISKSNVVDDMVASNSILY+PGEKPDH VVIKYVPYVGDSKRA+DEY SEI++GGHNT+ +
Sbjct: 346 ISKSNVVDDMVASNSILYKPGEKPDHVVVIKYVPYVGDSKRAMDEYISEIMMGGHNTLVI 405
Query: 353 HNTCEDSLLASPLILDLIILAELSSRIQFT--SPTVAEYTYFHPVLSILSYLCKAPLVPP 410
HNTCEDSLLA+PLILDL++LAEL SRI+ AEYT HPVLS+LSYLCKAPLVP
Sbjct: 406 HNTCEDSLLAAPLILDLVLLAELFSRIEVKKLENEDAEYTKLHPVLSVLSYLCKAPLVPK 465
Query: 411 GTPVVNALAQQRSCIENILRACLSLPPENSMTLEHKLPRRLFQDKSKSIDSHPQGDKMVS 470
GTP+VN+L +QR+CIENILRAC LPPE +MTLEHK+P + S++ PQ K+
Sbjct: 466 GTPIVNSLFRQRACIENILRACTGLPPETNMTLEHKVPFLM----SQTAYEEPQSKKVKL 521
Query: 471 NN 472
N
Sbjct: 522 EN 523
|
Source: Dendroctonus ponderosae Species: Dendroctonus ponderosae Genus: Dendroctonus Family: Curculionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350395981|ref|XP_003484397.1| PREDICTED: inositol-3-phosphate synthase 1-B-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383862822|ref|XP_003706882.1| PREDICTED: inositol-3-phosphate synthase 1-B-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340730177|ref|XP_003403362.1| PREDICTED: inositol-3-phosphate synthase 1-B-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|380017684|ref|XP_003692777.1| PREDICTED: inositol-3-phosphate synthase 1-B-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|66546786|ref|XP_623377.1| PREDICTED: inositol-3-phosphate synthase 1-B isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307185895|gb|EFN71722.1| Inositol-3-phosphate synthase A [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332022385|gb|EGI62697.1| Inositol-3-phosphate synthase 1-A [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|291222917|ref|XP_002731437.1| PREDICTED: inositol-3-phosphate synthase 1-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|291239737|ref|XP_002739775.1| PREDICTED: inositol-3-phosphate synthase 1-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 477 | ||||||
| TAIR|locus:2184153 | 510 | MIPS3 "myo-inositol-1-phosphat | 0.322 | 0.301 | 0.727 | 2.9e-60 | |
| TAIR|locus:2060364 | 510 | MIPS2 "myo-inositol-1-phosphat | 0.322 | 0.301 | 0.727 | 3.8e-60 | |
| TAIR|locus:2135297 | 511 | MIPS1 "D-myo-Inositol 3-Phosph | 0.322 | 0.301 | 0.727 | 7.8e-60 | |
| UNIPROTKB|B7Z3K3 | 356 | ISYNA1 "Inositol-3-phosphate s | 0.329 | 0.441 | 0.713 | 4e-58 | |
| UNIPROTKB|G3V1R9 | 408 | ISYNA1 "Myo-inositol 1-phospha | 0.329 | 0.384 | 0.713 | 4e-58 | |
| UNIPROTKB|Q9NPH2 | 558 | ISYNA1 "Inositol-3-phosphate s | 0.329 | 0.281 | 0.713 | 4e-58 | |
| UNIPROTKB|Q0P5C2 | 350 | MTHFD2 "Bifunctional methylene | 0.383 | 0.522 | 0.5 | 4.8e-58 | |
| RGD|1359423 | 557 | Isyna1 "inositol-3-phosphate s | 0.329 | 0.281 | 0.694 | 1.7e-57 | |
| UNIPROTKB|E2RJW5 | 612 | ISYNA1 "Uncharacterized protei | 0.329 | 0.256 | 0.700 | 3.6e-57 | |
| DICTYBASE|DDB_G0285505 | 511 | ino1 "inositol-3-phosphate syn | 0.324 | 0.303 | 0.664 | 6.9e-57 |
| TAIR|locus:2184153 MIPS3 "myo-inositol-1-phosphate synthase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 594 (214.2 bits), Expect = 2.9e-60, Sum P(2) = 2.9e-60
Identities = 112/154 (72%), Positives = 132/154 (85%)
Query: 293 ISKSNVVDDMVASNSILYRPGEKPDHTVVIKYVPYVGDSKRALDEYTSEILLGGHNTISM 352
ISKSNVVDDMV SN ILY PGE PDH VVIKYVP VGDSKRA+DEYTSEI +GG NTI M
Sbjct: 357 ISKSNVVDDMVGSNGILYEPGEHPDHVVVIKYVPCVGDSKRAMDEYTSEIFMGGKNTIVM 416
Query: 353 HNTCEDSLLASPLILDLIILAELSSRIQFTSPTVAEYTYFHPVLSILSYLCKAPLVPPGT 412
HNTCEDSLLA+P+ILDL++LAEL++RIQF S ++ FHPV ++LSYL KAPLVPPGT
Sbjct: 417 HNTCEDSLLAAPIILDLVLLAELTTRIQFMSENEGKFHSFHPVATLLSYLSKAPLVPPGT 476
Query: 413 PVVNALAQQRSCIENILRACLSLPPENSMTLEHK 446
PVVNAL++QR+ +EN+LRAC+ L PEN+M LE+K
Sbjct: 477 PVVNALSKQRAMLENVLRACVGLAPENNMILEYK 510
|
|
| TAIR|locus:2060364 MIPS2 "myo-inositol-1-phosphate synthase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135297 MIPS1 "D-myo-Inositol 3-Phosphate Synthase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z3K3 ISYNA1 "Inositol-3-phosphate synthase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V1R9 ISYNA1 "Myo-inositol 1-phosphate synthase A1, isoform CRA_d" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NPH2 ISYNA1 "Inositol-3-phosphate synthase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0P5C2 MTHFD2 "Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1359423 Isyna1 "inositol-3-phosphate synthase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RJW5 ISYNA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285505 ino1 "inositol-3-phosphate synthase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 5.5.1 | 0.766 |
| 3rd Layer | 3.5.4 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.5.1 | 0.691 |
| 4th Layer | 1.5.1.5 | LOW CONFIDENCE prediction! |
| 4th Layer | 5.5.1.4 | 0.824 |
| 3rd Layer | 3.5.4.9 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 477 | |||
| PLN02438 | 510 | PLN02438, PLN02438, inositol-3-phosphate synthase | 1e-94 | |
| PRK14190 | 284 | PRK14190, PRK14190, bifunctional 5,10-methylene-te | 1e-53 | |
| pfam07994 | 389 | pfam07994, NAD_binding_5, Myo-inositol-1-phosphate | 5e-50 | |
| COG0190 | 283 | COG0190, FolD, 5,10-methylene-tetrahydrofolate deh | 6e-48 | |
| PRK10792 | 285 | PRK10792, PRK10792, bifunctional 5,10-methylene-te | 9e-44 | |
| PRK14191 | 285 | PRK14191, PRK14191, bifunctional 5,10-methylene-te | 9e-41 | |
| PRK14185 | 293 | PRK14185, PRK14185, bifunctional 5,10-methylene-te | 3e-38 | |
| PRK14175 | 286 | PRK14175, PRK14175, bifunctional 5,10-methylene-te | 2e-37 | |
| PRK14184 | 286 | PRK14184, PRK14184, bifunctional 5,10-methylene-te | 4e-37 | |
| PRK14188 | 296 | PRK14188, PRK14188, bifunctional 5,10-methylene-te | 1e-36 | |
| PRK14193 | 284 | PRK14193, PRK14193, bifunctional 5,10-methylene-te | 7e-36 | |
| PRK14172 | 278 | PRK14172, PRK14172, bifunctional 5,10-methylene-te | 1e-34 | |
| PRK14189 | 285 | PRK14189, PRK14189, bifunctional 5,10-methylene-te | 1e-34 | |
| PLN02516 | 299 | PLN02516, PLN02516, methylenetetrahydrofolate dehy | 2e-33 | |
| PRK14168 | 297 | PRK14168, PRK14168, bifunctional 5,10-methylene-te | 1e-32 | |
| PRK14179 | 284 | PRK14179, PRK14179, bifunctional 5,10-methylene-te | 2e-32 | |
| PRK14174 | 295 | PRK14174, PRK14174, bifunctional 5,10-methylene-te | 3e-32 | |
| PRK14183 | 281 | PRK14183, PRK14183, bifunctional 5,10-methylene-te | 5e-32 | |
| PLN02616 | 364 | PLN02616, PLN02616, tetrahydrofolate dehydrogenase | 6e-31 | |
| PRK14178 | 279 | PRK14178, PRK14178, bifunctional 5,10-methylene-te | 9e-31 | |
| PRK14186 | 297 | PRK14186, PRK14186, bifunctional 5,10-methylene-te | 1e-30 | |
| PRK14167 | 297 | PRK14167, PRK14167, bifunctional 5,10-methylene-te | 6e-30 | |
| PRK14171 | 288 | PRK14171, PRK14171, bifunctional 5,10-methylene-te | 1e-29 | |
| PRK14169 | 282 | PRK14169, PRK14169, bifunctional 5,10-methylene-te | 4e-29 | |
| PRK14192 | 283 | PRK14192, PRK14192, bifunctional 5,10-methylene-te | 1e-28 | |
| PRK14170 | 284 | PRK14170, PRK14170, bifunctional 5,10-methylene-te | 1e-28 | |
| PRK14176 | 287 | PRK14176, PRK14176, bifunctional 5,10-methylene-te | 2e-28 | |
| PRK14177 | 284 | PRK14177, PRK14177, bifunctional 5,10-methylene-te | 3e-28 | |
| PRK14180 | 282 | PRK14180, PRK14180, bifunctional 5,10-methylene-te | 6e-28 | |
| PRK14194 | 301 | PRK14194, PRK14194, bifunctional 5,10-methylene-te | 6e-27 | |
| PLN02897 | 345 | PLN02897, PLN02897, tetrahydrofolate dehydrogenase | 7e-27 | |
| PRK14187 | 294 | PRK14187, PRK14187, bifunctional 5,10-methylene-te | 1e-26 | |
| PRK14166 | 282 | PRK14166, PRK14166, bifunctional 5,10-methylene-te | 1e-26 | |
| PRK14182 | 282 | PRK14182, PRK14182, bifunctional 5,10-methylene-te | 3e-26 | |
| PRK14173 | 287 | PRK14173, PRK14173, bifunctional 5,10-methylene-te | 1e-25 | |
| PRK14181 | 287 | PRK14181, PRK14181, bifunctional 5,10-methylene-te | 3e-25 | |
| pfam00763 | 117 | pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydroge | 1e-24 | |
| cd01080 | 168 | cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding | 3e-24 | |
| pfam02882 | 160 | pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydro | 4e-23 | |
| pfam02882 | 160 | pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydro | 8e-23 | |
| pfam01658 | 108 | pfam01658, Inos-1-P_synth, Myo-inositol-1-phosphat | 2e-22 | |
| cd01080 | 168 | cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding | 2e-21 | |
| COG0190 | 283 | COG0190, FolD, 5,10-methylene-tetrahydrofolate deh | 2e-20 | |
| PRK14189 | 285 | PRK14189, PRK14189, bifunctional 5,10-methylene-te | 2e-19 | |
| PRK14190 | 284 | PRK14190, PRK14190, bifunctional 5,10-methylene-te | 2e-18 | |
| PRK14188 | 296 | PRK14188, PRK14188, bifunctional 5,10-methylene-te | 2e-18 | |
| PRK10792 | 285 | PRK10792, PRK10792, bifunctional 5,10-methylene-te | 3e-18 | |
| PRK14173 | 287 | PRK14173, PRK14173, bifunctional 5,10-methylene-te | 1e-16 | |
| COG1260 | 362 | COG1260, INO1, Myo-inositol-1-phosphate synthase [ | 5e-16 | |
| PRK14186 | 297 | PRK14186, PRK14186, bifunctional 5,10-methylene-te | 6e-16 | |
| cd01080 | 168 | cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding | 7e-15 | |
| PRK14168 | 297 | PRK14168, PRK14168, bifunctional 5,10-methylene-te | 2e-14 | |
| PRK14191 | 285 | PRK14191, PRK14191, bifunctional 5,10-methylene-te | 3e-14 | |
| PRK14183 | 281 | PRK14183, PRK14183, bifunctional 5,10-methylene-te | 4e-14 | |
| PRK14189 | 285 | PRK14189, PRK14189, bifunctional 5,10-methylene-te | 5e-14 | |
| PRK14179 | 284 | PRK14179, PRK14179, bifunctional 5,10-methylene-te | 5e-14 | |
| PRK14174 | 295 | PRK14174, PRK14174, bifunctional 5,10-methylene-te | 5e-14 | |
| PRK14178 | 279 | PRK14178, PRK14178, bifunctional 5,10-methylene-te | 6e-14 | |
| PRK14193 | 284 | PRK14193, PRK14193, bifunctional 5,10-methylene-te | 1e-13 | |
| PRK14184 | 286 | PRK14184, PRK14184, bifunctional 5,10-methylene-te | 2e-13 | |
| COG0190 | 283 | COG0190, FolD, 5,10-methylene-tetrahydrofolate deh | 3e-13 | |
| PRK14185 | 293 | PRK14185, PRK14185, bifunctional 5,10-methylene-te | 3e-13 | |
| PLN02516 | 299 | PLN02516, PLN02516, methylenetetrahydrofolate dehy | 6e-13 | |
| PRK14194 | 301 | PRK14194, PRK14194, bifunctional 5,10-methylene-te | 6e-13 | |
| PRK14166 | 282 | PRK14166, PRK14166, bifunctional 5,10-methylene-te | 3e-12 | |
| PRK14188 | 296 | PRK14188, PRK14188, bifunctional 5,10-methylene-te | 7e-12 | |
| PRK10792 | 285 | PRK10792, PRK10792, bifunctional 5,10-methylene-te | 8e-12 | |
| PRK14167 | 297 | PRK14167, PRK14167, bifunctional 5,10-methylene-te | 1e-11 | |
| PRK14176 | 287 | PRK14176, PRK14176, bifunctional 5,10-methylene-te | 1e-11 | |
| PRK14173 | 287 | PRK14173, PRK14173, bifunctional 5,10-methylene-te | 1e-11 | |
| PRK14169 | 282 | PRK14169, PRK14169, bifunctional 5,10-methylene-te | 3e-11 | |
| PRK14187 | 294 | PRK14187, PRK14187, bifunctional 5,10-methylene-te | 4e-11 | |
| PRK14170 | 284 | PRK14170, PRK14170, bifunctional 5,10-methylene-te | 8e-11 | |
| PRK14175 | 286 | PRK14175, PRK14175, bifunctional 5,10-methylene-te | 1e-10 | |
| PLN02516 | 299 | PLN02516, PLN02516, methylenetetrahydrofolate dehy | 2e-10 | |
| PLN02616 | 364 | PLN02616, PLN02616, tetrahydrofolate dehydrogenase | 6e-10 | |
| PLN02897 | 345 | PLN02897, PLN02897, tetrahydrofolate dehydrogenase | 6e-10 | |
| PRK14186 | 297 | PRK14186, PRK14186, bifunctional 5,10-methylene-te | 9e-10 | |
| PRK14191 | 285 | PRK14191, PRK14191, bifunctional 5,10-methylene-te | 1e-09 | |
| PRK14179 | 284 | PRK14179, PRK14179, bifunctional 5,10-methylene-te | 1e-09 | |
| PRK14168 | 297 | PRK14168, PRK14168, bifunctional 5,10-methylene-te | 2e-09 | |
| PRK14183 | 281 | PRK14183, PRK14183, bifunctional 5,10-methylene-te | 2e-09 | |
| PRK14171 | 288 | PRK14171, PRK14171, bifunctional 5,10-methylene-te | 3e-09 | |
| PRK14181 | 287 | PRK14181, PRK14181, bifunctional 5,10-methylene-te | 7e-09 | |
| PRK14174 | 295 | PRK14174, PRK14174, bifunctional 5,10-methylene-te | 8e-09 | |
| PRK14194 | 301 | PRK14194, PRK14194, bifunctional 5,10-methylene-te | 8e-09 | |
| PRK14175 | 286 | PRK14175, PRK14175, bifunctional 5,10-methylene-te | 1e-08 | |
| PRK14184 | 286 | PRK14184, PRK14184, bifunctional 5,10-methylene-te | 2e-08 | |
| PRK14187 | 294 | PRK14187, PRK14187, bifunctional 5,10-methylene-te | 3e-08 | |
| PRK14166 | 282 | PRK14166, PRK14166, bifunctional 5,10-methylene-te | 4e-08 | |
| PRK14185 | 293 | PRK14185, PRK14185, bifunctional 5,10-methylene-te | 7e-08 | |
| PRK14182 | 282 | PRK14182, PRK14182, bifunctional 5,10-methylene-te | 8e-08 | |
| PRK14167 | 297 | PRK14167, PRK14167, bifunctional 5,10-methylene-te | 9e-08 | |
| PRK14172 | 278 | PRK14172, PRK14172, bifunctional 5,10-methylene-te | 2e-07 | |
| PRK14170 | 284 | PRK14170, PRK14170, bifunctional 5,10-methylene-te | 3e-07 | |
| PRK14176 | 287 | PRK14176, PRK14176, bifunctional 5,10-methylene-te | 3e-07 | |
| cd05212 | 140 | cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) b | 4e-07 | |
| PRK14180 | 282 | PRK14180, PRK14180, bifunctional 5,10-methylene-te | 8e-07 | |
| PLN02616 | 364 | PLN02616, PLN02616, tetrahydrofolate dehydrogenase | 9e-07 | |
| PLN02897 | 345 | PLN02897, PLN02897, tetrahydrofolate dehydrogenase | 9e-07 | |
| PRK14192 | 283 | PRK14192, PRK14192, bifunctional 5,10-methylene-te | 1e-06 | |
| cd01079 | 197 | cd01079, NAD_bind_m-THF_DH, NAD binding domain of | 1e-06 | |
| PRK14181 | 287 | PRK14181, PRK14181, bifunctional 5,10-methylene-te | 3e-06 | |
| PRK14171 | 288 | PRK14171, PRK14171, bifunctional 5,10-methylene-te | 5e-06 | |
| cd05212 | 140 | cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) b | 9e-05 | |
| PRK14177 | 284 | PRK14177, PRK14177, bifunctional 5,10-methylene-te | 4e-04 | |
| PRK14177 | 284 | PRK14177, PRK14177, bifunctional 5,10-methylene-te | 0.002 | |
| PRK14180 | 282 | PRK14180, PRK14180, bifunctional 5,10-methylene-te | 0.002 |
| >gnl|CDD|178057 PLN02438, PLN02438, inositol-3-phosphate synthase | Back alignment and domain information |
|---|
Score = 295 bits (756), Expect = 1e-94
Identities = 116/154 (75%), Positives = 134/154 (87%)
Query: 293 ISKSNVVDDMVASNSILYRPGEKPDHTVVIKYVPYVGDSKRALDEYTSEILLGGHNTISM 352
ISKSNVVDDMVASNSILY PGE PDH VVIKYVPYVGDSKRA+DEYTSEI +GG NTI M
Sbjct: 357 ISKSNVVDDMVASNSILYEPGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVM 416
Query: 353 HNTCEDSLLASPLILDLIILAELSSRIQFTSPTVAEYTYFHPVLSILSYLCKAPLVPPGT 412
HNTCEDSLLA+P+ILDL++LAELS+RIQ + ++ FHPV ++LSYL KAPLVPPGT
Sbjct: 417 HNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEEKFHSFHPVATLLSYLTKAPLVPPGT 476
Query: 413 PVVNALAQQRSCIENILRACLSLPPENSMTLEHK 446
PVVNALA+QR+ +ENILRAC+ L PEN+M LE+K
Sbjct: 477 PVVNALAKQRAMLENILRACVGLAPENNMLLEYK 510
|
Length = 510 |
| >gnl|CDD|184560 PRK14190, PRK14190, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219688 pfam07994, NAD_binding_5, Myo-inositol-1-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|223268 COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236760 PRK10792, PRK10792, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172679 PRK14191, PRK14191, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184556 PRK14185, PRK14185, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184552 PRK14175, PRK14175, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237635 PRK14184, PRK14184, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184558 PRK14188, PRK14188, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237637 PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172660 PRK14172, PRK14172, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184559 PRK14189, PRK14189, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178131 PLN02516, PLN02516, methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >gnl|CDD|237633 PRK14168, PRK14168, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237634 PRK14179, PRK14179, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172662 PRK14174, PRK14174, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184555 PRK14183, PRK14183, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215332 PLN02616, PLN02616, tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|172666 PRK14178, PRK14178, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237636 PRK14186, PRK14186, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184549 PRK14167, PRK14167, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172659 PRK14171, PRK14171, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184550 PRK14169, PRK14169, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184561 PRK14192, PRK14192, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172658 PRK14170, PRK14170, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184553 PRK14176, PRK14176, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172665 PRK14177, PRK14177, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172668 PRK14180, PRK14180, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172682 PRK14194, PRK14194, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178485 PLN02897, PLN02897, tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|172675 PRK14187, PRK14187, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172654 PRK14166, PRK14166, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172670 PRK14182, PRK14182, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184551 PRK14173, PRK14173, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172669 PRK14181, PRK14181, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201431 pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|217267 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|217267 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|145021 pfam01658, Inos-1-P_synth, Myo-inositol-1-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|223268 COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184559 PRK14189, PRK14189, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184560 PRK14190, PRK14190, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184558 PRK14188, PRK14188, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236760 PRK10792, PRK10792, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184551 PRK14173, PRK14173, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224180 COG1260, INO1, Myo-inositol-1-phosphate synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237636 PRK14186, PRK14186, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|237633 PRK14168, PRK14168, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172679 PRK14191, PRK14191, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184555 PRK14183, PRK14183, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184559 PRK14189, PRK14189, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237634 PRK14179, PRK14179, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172662 PRK14174, PRK14174, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172666 PRK14178, PRK14178, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237637 PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237635 PRK14184, PRK14184, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223268 COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184556 PRK14185, PRK14185, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178131 PLN02516, PLN02516, methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >gnl|CDD|172682 PRK14194, PRK14194, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172654 PRK14166, PRK14166, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184558 PRK14188, PRK14188, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236760 PRK10792, PRK10792, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184549 PRK14167, PRK14167, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184553 PRK14176, PRK14176, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184551 PRK14173, PRK14173, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184550 PRK14169, PRK14169, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172675 PRK14187, PRK14187, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172658 PRK14170, PRK14170, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184552 PRK14175, PRK14175, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178131 PLN02516, PLN02516, methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >gnl|CDD|215332 PLN02616, PLN02616, tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|178485 PLN02897, PLN02897, tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|237636 PRK14186, PRK14186, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172679 PRK14191, PRK14191, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237634 PRK14179, PRK14179, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237633 PRK14168, PRK14168, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184555 PRK14183, PRK14183, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172659 PRK14171, PRK14171, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172669 PRK14181, PRK14181, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172662 PRK14174, PRK14174, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172682 PRK14194, PRK14194, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184552 PRK14175, PRK14175, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237635 PRK14184, PRK14184, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172675 PRK14187, PRK14187, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172654 PRK14166, PRK14166, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184556 PRK14185, PRK14185, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172670 PRK14182, PRK14182, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184549 PRK14167, PRK14167, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172660 PRK14172, PRK14172, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172658 PRK14170, PRK14170, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184553 PRK14176, PRK14176, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133451 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|172668 PRK14180, PRK14180, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215332 PLN02616, PLN02616, tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|178485 PLN02897, PLN02897, tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|184561 PRK14192, PRK14192, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133447 cd01079, NAD_bind_m-THF_DH, NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|172669 PRK14181, PRK14181, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172659 PRK14171, PRK14171, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133451 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|172665 PRK14177, PRK14177, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172665 PRK14177, PRK14177, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172668 PRK14180, PRK14180, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 477 | |||
| KOG0693|consensus | 512 | 100.0 | ||
| COG0190 | 283 | FolD 5,10-methylene-tetrahydrofolate dehydrogenase | 100.0 | |
| PRK14171 | 288 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14184 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14170 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14190 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14177 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14186 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14172 | 278 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14187 | 294 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14169 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PLN02516 | 299 | methylenetetrahydrofolate dehydrogenase (NADP+) | 100.0 | |
| PLN02438 | 510 | inositol-3-phosphate synthase | 100.0 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PLN02616 | 364 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 100.0 | |
| PRK14167 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14166 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PLN02897 | 345 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 100.0 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14182 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14193 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14185 | 293 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14176 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14183 | 281 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14180 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14168 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK10792 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14181 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14174 | 295 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14173 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14178 | 279 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| KOG4230|consensus | 935 | 100.0 | ||
| KOG0089|consensus | 309 | 100.0 | ||
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| TIGR03450 | 351 | mycothiol_INO1 inositol 1-phosphate synthase, Acti | 99.98 | |
| PF00763 | 117 | THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh | 99.97 | |
| COG1260 | 362 | INO1 Myo-inositol-1-phosphate synthase [Lipid meta | 99.94 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 99.93 | |
| cd01079 | 197 | NAD_bind_m-THF_DH NAD binding domain of methylene- | 99.93 | |
| PF01658 | 112 | Inos-1-P_synth: Myo-inositol-1-phosphate synthase; | 99.9 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 99.83 | |
| PF07994 | 295 | NAD_binding_5: Myo-inositol-1-phosphate synthase; | 99.78 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 99.75 | |
| KOG4230|consensus | 935 | 99.65 | ||
| PRK14167 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 99.53 | |
| PRK14186 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 99.51 | |
| PRK14187 | 294 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 99.51 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 99.5 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 99.46 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 99.43 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 93.31 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 91.72 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 89.26 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 87.84 | |
| COG0190 | 283 | FolD 5,10-methylene-tetrahydrofolate dehydrogenase | 87.64 | |
| PLN02616 | 364 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 86.83 | |
| PLN02897 | 345 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 86.35 | |
| PRK14171 | 288 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 86.1 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 85.22 | |
| PRK14185 | 293 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 85.11 | |
| PRK14166 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 85.02 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 84.99 | |
| PRK14172 | 278 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.84 | |
| PRK14177 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.83 | |
| PRK14181 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.81 | |
| PRK10423 | 327 | transcriptional repressor RbsR; Provisional | 84.71 | |
| PRK14168 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.56 | |
| PRK14173 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.49 | |
| PRK14193 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 83.93 | |
| PRK14170 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 83.69 | |
| PRK14169 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 83.64 | |
| PRK14180 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 83.44 | |
| PLN02516 | 299 | methylenetetrahydrofolate dehydrogenase (NADP+) | 82.76 | |
| PRK14182 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 82.65 | |
| TIGR02417 | 327 | fruct_sucro_rep D-fructose-responsive transcriptio | 81.71 | |
| PRK14183 | 281 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 81.44 | |
| PRK09526 | 342 | lacI lac repressor; Reviewed | 81.4 | |
| PRK11303 | 328 | DNA-binding transcriptional regulator FruR; Provis | 81.24 |
| >KOG0693|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.5e-66 Score=518.38 Aligned_cols=251 Identities=52% Similarity=0.816 Sum_probs=216.6
Q ss_pred HHHHhhcCCCCCCCCCCccchHHhhc---CCCCcccCCHH-----HHHHHHHHhCCCCCCCeEEEECCCCCcchHHHHHh
Q psy4615 177 RAVCNAVAPHKDVDGFNIVNVGRFCL---DLKTLIPCTPL-----GVQELIRRYKVETFGKNAVVCGRSKNVGMPIAMLL 248 (477)
Q Consensus 177 ~~l~~aI~p~KDVDGl~p~nlg~l~~---g~~~f~PcTa~-----Av~~Lle~~gi~l~Gk~vvViGrS~~VGkPLA~lL 248 (477)
++|++.| ++|-+-++|+++.+++. |++ |+--.|. |+++|+++.++=+.|-|.+ -| .+-+.+.|...|
T Consensus 248 enl~~si--~~~~~EisPStifA~AsilEg~~-yiNGSPQNTfVPGlielA~~~~vfigGDDfK-SG-QTK~KSvlvdFL 322 (512)
T KOG0693|consen 248 ENLLESI--EKDESEISPSTIFAIASILEGCP-YINGSPQNTFVPGLIELAERHNVFIGGDDFK-SG-QTKMKSVLVDFL 322 (512)
T ss_pred HHHHHHH--hcCccccChHHHHHHHHHHcCCC-cccCCCccccchhHHHHHHHhCceecccccc-cc-chhHHHHHHHHH
Confidence 4566666 34555677888777662 544 2211222 8999999999988888887 77 344566777766
Q ss_pred hhCCCCccccceEEccCCCCCChhHHHHHH---HH---HHHHHHHHhhhccCCCchhhHhhhcccccCCCCCCCCceeEE
Q psy4615 249 HADGAGVSEVAGYITPVPGGVGPMTVAMLM---KN---TILAAKHAVIYNISKSNVVDDMVASNSILYRPGEKPDHTVVI 322 (477)
Q Consensus 249 ~~~~a~v~~~a~~iTPVpGGVGp~T~a~L~---~N---~l~a~~~~~sk~iSK~~v~~~~~~~~~~ly~~~~~~~h~v~I 322 (477)
... |+.|+++++++ +| +|+++++|||||||||+|+|||+++|.+||.+||+|||||+|
T Consensus 323 Vga----------------GiKp~SIvSYNHLGNNDG~NLSap~qFRSKEISKSnVvDDmv~SN~iLy~pge~pDH~vVI 386 (512)
T KOG0693|consen 323 VGA----------------GIKPTSIVSYNHLGNNDGMNLSAPQQFRSKEISKSNVVDDMVASNGILYEPGEHPDHCVVI 386 (512)
T ss_pred hcc----------------CCCceeEeeeccccCCCcccccchhhhhhhhcchhhhhHHHHhcCCcccCCCCCCCeEEEE
Confidence 443 55555555554 22 799999999999999999999999999999999999999999
Q ss_pred EeecCCCCccccccccceeeeeccceeEEeecccccchhhhhHHHHHHHHHHHhhhhcccCCCccccccccchHHHHHhh
Q psy4615 323 KYVPYVGDSKRALDEYTSEILLGGHNTISMHNTCEDSLLASPLILDLIILAELSSRIQFTSPTVAEYTYFHPVLSILSYL 402 (477)
Q Consensus 323 ~Y~p~~Gd~K~a~d~~~~~~flG~~~~i~~~~~c~DSlLAaPLilDL~~l~~~~~r~~~~~~~~~~~~~~~~vl~~Ls~~ 402 (477)
||||++||+|||||||+||+||||+|||.+||+||||||||||||||++|+|||+|++|+.+++..+..||+|+++|||+
T Consensus 387 KYvpyVgDSKrAmDEYtsei~mGG~ntiviHNtCEDSLLA~PlilDL~lltEl~tRvs~k~~de~k~~~FhpVltlLSyl 466 (512)
T KOG0693|consen 387 KYVPYVGDSKRAMDEYTSEIFMGGKNTIVIHNTCEDSLLAAPLILDLVLLTELSTRVSFKAEDEGKFHSFHPVLTLLSYL 466 (512)
T ss_pred EecccccchhhHHHHHHHHHhhCCcceEEEeccchHhhhhhhHHHHHHHHHHHhhheEeeecCCCCccccccHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999987777888899999999999
Q ss_pred hcCCCCCCCCchhchHHHHHHHHHHHHHHhcCCCCCCccccceecc
Q psy4615 403 CKAPLVPPGTPVVNALAQQRSCIENILRACLSLPPENSMTLEHKLP 448 (477)
Q Consensus 403 fK~P~~~~g~~~~~~l~~Q~~~l~~~~~~~~g~~~~~~~~~~~~~~ 448 (477)
||||++|||++++|+|+|||++|+|++|+|.|+||++||.+||++.
T Consensus 467 ~KAPlvppGtpvvNal~kQra~lenilracvGlpp~n~m~lE~~~~ 512 (512)
T KOG0693|consen 467 LKAPLVPPGTPVVNALSKQRAMLENILRACVGLPPENNMILEFKLL 512 (512)
T ss_pred hcCCcCCCCcchhhHHHHHHHHHHHHHHHhcCCCCccceeeeeecC
Confidence 9999999999999999999999999999999999999999999863
|
|
| >COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >PLN02438 inositol-3-phosphate synthase | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG4230|consensus | Back alignment and domain information |
|---|
| >KOG0089|consensus | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03450 mycothiol_INO1 inositol 1-phosphate synthase, Actinobacterial type | Back alignment and domain information |
|---|
| >PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >COG1260 INO1 Myo-inositol-1-phosphate synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
| >PF01658 Inos-1-P_synth: Myo-inositol-1-phosphate synthase; InterPro: IPR013021 This is a region of myo-inositol-1-phosphate synthases that is related to the glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PF07994 NAD_binding_5: Myo-inositol-1-phosphate synthase; InterPro: IPR002587 1L-myo-Inositol-1-phosphate synthase (5 | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >KOG4230|consensus | Back alignment and domain information |
|---|
| >PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10423 transcriptional repressor RbsR; Provisional | Back alignment and domain information |
|---|
| >PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor | Back alignment and domain information |
|---|
| >PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09526 lacI lac repressor; Reviewed | Back alignment and domain information |
|---|
| >PRK11303 DNA-binding transcriptional regulator FruR; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 477 | ||||
| 1jkf_A | 533 | Holo 1l-Myo-Inositol-1-Phosphate Synthase Length = | 5e-43 | ||
| 1la2_A | 533 | Structural Analysis Of Saccharomyces Cerevisiae Myo | 8e-42 | ||
| 1vko_A | 537 | Crystal Structure Of Inositol-3-Phosphate Synthase | 2e-39 | ||
| 1b0a_A | 288 | 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCL | 3e-27 | ||
| 1b0a_A | 288 | 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCL | 1e-04 | ||
| 4a5o_A | 286 | Crystal Structure Of Pseudomonas Aeruginosa N5, N10 | 1e-25 | ||
| 3l07_A | 285 | Methylenetetrahydrofolate DehydrogenaseMETHENYLTETR | 3e-25 | ||
| 2c2x_A | 281 | Three Dimensional Structure Of Bifunctional Methyle | 3e-24 | ||
| 4a26_A | 300 | The Crystal Structure Of Leishmania Major N5,N10- M | 2e-23 | ||
| 4a26_A | 300 | The Crystal Structure Of Leishmania Major N5,N10- M | 4e-05 | ||
| 3p2o_A | 285 | Crystal Structure Of Fold Bifunctional Protein From | 2e-23 | ||
| 3p2o_A | 285 | Crystal Structure Of Fold Bifunctional Protein From | 2e-05 | ||
| 4b4u_A | 303 | Crystal Structure Of Acinetobacter Baumannii N5, N1 | 1e-22 | ||
| 1dia_A | 306 | Human Methylenetetrahydrofolate Dehydrogenase Cyclo | 3e-19 | ||
| 1dia_A | 306 | Human Methylenetetrahydrofolate Dehydrogenase Cyclo | 3e-06 | ||
| 1a4i_A | 301 | Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE | 3e-19 | ||
| 1a4i_A | 301 | Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE | 3e-06 | ||
| 1edz_A | 320 | Structure Of The Nad-Dependent 5,10- Methylenetetra | 8e-08 | ||
| 3ngl_A | 276 | Crystal Structure Of Bifunctional 5,10-Methylenetet | 5e-07 |
| >pdb|1JKF|A Chain A, Holo 1l-Myo-Inositol-1-Phosphate Synthase Length = 533 | Back alignment and structure |
|
| >pdb|1LA2|A Chain A, Structural Analysis Of Saccharomyces Cerevisiae Myo- Inositol Phosphate Synthase Length = 533 | Back alignment and structure |
| >pdb|1VKO|A Chain A, Crystal Structure Of Inositol-3-Phosphate Synthase (Ce21227) From Caenorhabditis Elegans At 2.30 A Resolution Length = 537 | Back alignment and structure |
| >pdb|1B0A|A Chain A, 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCLOHYDROLASE FROM E COLI Length = 288 | Back alignment and structure |
| >pdb|1B0A|A Chain A, 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCLOHYDROLASE FROM E COLI Length = 288 | Back alignment and structure |
| >pdb|4A5O|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa N5, N10- Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase (Fold) Length = 286 | Back alignment and structure |
| >pdb|3L07|A Chain A, Methylenetetrahydrofolate DehydrogenaseMETHENYLTETRAHYDROFOLATE Cyclohydrolase, Putative Bifunctional Protein Fold From Francisella Tularensis. Length = 285 | Back alignment and structure |
| >pdb|2C2X|A Chain A, Three Dimensional Structure Of Bifunctional Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase From Mycobacterium Tuberculosis Length = 281 | Back alignment and structure |
| >pdb|4A26|A Chain A, The Crystal Structure Of Leishmania Major N5,N10- Methylenetetrahydrofolate DehydrogenaseCYCLOHYDROLASE Length = 300 | Back alignment and structure |
| >pdb|4A26|A Chain A, The Crystal Structure Of Leishmania Major N5,N10- Methylenetetrahydrofolate DehydrogenaseCYCLOHYDROLASE Length = 300 | Back alignment and structure |
| >pdb|3P2O|A Chain A, Crystal Structure Of Fold Bifunctional Protein From Campylobacter Jejuni Length = 285 | Back alignment and structure |
| >pdb|3P2O|A Chain A, Crystal Structure Of Fold Bifunctional Protein From Campylobacter Jejuni Length = 285 | Back alignment and structure |
| >pdb|4B4U|A Chain A, Crystal Structure Of Acinetobacter Baumannii N5, N10-Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase (Fold) Complexed With Nadp Cofactor Length = 303 | Back alignment and structure |
| >pdb|1DIA|A Chain A, Human Methylenetetrahydrofolate Dehydrogenase Cyclohydrolase Complexed With Nadp And Inhibitor Ly249543 Length = 306 | Back alignment and structure |
| >pdb|1DIA|A Chain A, Human Methylenetetrahydrofolate Dehydrogenase Cyclohydrolase Complexed With Nadp And Inhibitor Ly249543 Length = 306 | Back alignment and structure |
| >pdb|1A4I|A Chain A, Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE Length = 301 | Back alignment and structure |
| >pdb|1A4I|A Chain A, Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE Length = 301 | Back alignment and structure |
| >pdb|1EDZ|A Chain A, Structure Of The Nad-Dependent 5,10- Methylenetetrahydrofolate Dehydrogenase From Saccharomyces Cerevisiae Length = 320 | Back alignment and structure |
| >pdb|3NGL|A Chain A, Crystal Structure Of Bifunctional 5,10-Methylenetetrahydrofolate Dehydrogenase CYCLOHYDROLASE FROM THERMOPLASMA ACIDOPHILUM Length = 276 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Length = 288 | Back alignment and structure |
|---|
Score = 201 bits (514), Expect = 1e-61
Identities = 73/193 (37%), Positives = 99/193 (51%), Gaps = 15/193 (7%)
Query: 71 AQIIDGKFIANTILEELKDEVKAWVALGHRVPTLTAILVGNDSASSTYVNNKMKSAAKVG 130
A+IIDGK IA + E+ +V+A +A G R P L +LVG++ AS YV +K K+ +VG
Sbjct: 3 AKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNPASQIYVASKRKACEEVG 62
Query: 131 EVNALGVLYHL-------TLFGRSKLINPMSIPISTGVSSHISQLPLPEHMVERAVCNAV 183
+ Y L L +N + + QLPLP + V +
Sbjct: 63 ---FVSRSYDLPETTSEAELLELIDTLNA-----DNTIDGILVQLPLPAGIDNVKVLERI 114
Query: 184 APHKDVDGFNIVNVGRFCLDLKTLIPCTPLGVQELIRRYKVETFGKNAVVCGRSKNVGMP 243
P KDVDGF+ NVGR C L PCTP G+ L+ RY ++TFG NAVV G S VG P
Sbjct: 115 HPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRP 174
Query: 244 IAMLLHADGAGVS 256
++M L G +
Sbjct: 175 MSMELLLAGCTTT 187
|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Length = 288 | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Length = 288 | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Length = 285 | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Length = 285 | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Length = 285 | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Length = 286 | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Length = 286 | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Length = 286 | Back alignment and structure |
|---|
| >1vko_A Inositol-3-phosphate synthase; CE21227, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD; 2.30A {Caenorhabditis elegans} SCOP: c.2.1.3 d.81.1.3 Length = 537 | Back alignment and structure |
|---|
| >1p1j_A Inositol-3-phosphate synthase; 1L-MYO-inositol 1-phosphate, NADH, isomerase, rossmann fold; HET: NAI; 1.70A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.3 PDB: 1jkf_A* 1la2_A* 1p1f_A 1jki_A* 1p1i_A* 1p1h_A* 1p1k_A* 1rm0_A* Length = 533 | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Length = 300 | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Length = 300 | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Length = 300 | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Length = 281 | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Length = 281 | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Length = 281 | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Length = 285 | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Length = 285 | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Length = 285 | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Length = 301 | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Length = 301 | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Length = 301 | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Length = 320 | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Length = 320 | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Length = 320 | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Length = 276 | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Length = 276 | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Length = 276 | Back alignment and structure |
|---|
| >1vjp_A MYO-inositol-1-phosphate synthase-related protein; TM1419, structural genomics, JCSG, PSI, protein structure initiative; HET: NAD; 1.70A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 3cin_A* Length = 394 | Back alignment and structure |
|---|
| >1gr0_A Inositol-3-phosphate synthase; isomerase, oxidoreductase, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: NAD; 1.95A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 Length = 367 | Back alignment and structure |
|---|
| >3qvs_A MIPS, MYO-inositol-1-phosphate synthase (INO1); NAD binding rossmann fold, L-MYO-inositol 1-phosphate syntha isomerase; HET: NAD PG4; 1.70A {Archaeoglobus fulgidus} PDB: 1u1i_A* 3qvt_A* 3qvw_A* 3qvx_A* 3qw2_A* Length = 392 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 477 | |||
| 4b4u_A | 303 | Bifunctional protein fold; oxidoreductase; HET: NA | 100.0 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 100.0 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 100.0 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 100.0 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 100.0 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 100.0 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 100.0 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 100.0 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 100.0 | |
| 1vko_A | 537 | Inositol-3-phosphate synthase; CE21227, structural | 100.0 | |
| 1p1j_A | 533 | Inositol-3-phosphate synthase; 1L-MYO-inositol 1-p | 100.0 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 100.0 | |
| 3qvs_A | 392 | MIPS, MYO-inositol-1-phosphate synthase (INO1); NA | 100.0 | |
| 1vjp_A | 394 | MYO-inositol-1-phosphate synthase-related protein; | 100.0 | |
| 3cin_A | 394 | MYO-inositol-1-phosphate synthase-related protein; | 100.0 | |
| 1gr0_A | 367 | Inositol-3-phosphate synthase; isomerase, oxidored | 100.0 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 98.53 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 98.46 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 98.36 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 98.17 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 98.08 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 97.98 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 96.65 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 94.8 | |
| 4b4u_A | 303 | Bifunctional protein fold; oxidoreductase; HET: NA | 90.17 | |
| 3dbi_A | 338 | Sugar-binding transcriptional regulator, LACI FAM; | 84.59 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 83.14 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 81.26 |
| >4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.7e-67 Score=524.88 Aligned_cols=220 Identities=36% Similarity=0.546 Sum_probs=209.8
Q ss_pred hhhccccccccHHHHHHHHHHHHHHHHHHHHcCCCCCEEEEEEeCCChhhHHHHHHHHHHHHHcCCeeeeeEEecCCccc
Q psy4615 66 KKANKAQIIDGKFIANTILEELKDEVKAWVALGHRVPTLTAILVGNDSASSTYVNNKMKSAAKVGEVNALGVLYHLTLFG 145 (477)
Q Consensus 66 ~~~~ma~ILdGk~lA~~I~~~lk~~v~~lk~~~g~~P~LaiI~vGdd~aS~~Yv~~k~k~a~~vGI~~~~~~~lp~~~~t 145 (477)
++++|++|||||++|++|++++++++++++++++++|+||+|+||+||+|..|+++|.|+|+++||+++ .++||+++ +
T Consensus 18 ~~~~Ma~ildGk~iA~~i~~~l~~~v~~l~~~~g~~P~LavIlVG~dpaS~~Yv~~K~k~c~~vGi~s~-~~~lp~~~-s 95 (303)
T 4b4u_A 18 FQGHMALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSL-KIELPQET-T 95 (303)
T ss_dssp ----CCEECCHHHHHHHHHHHHHHHHHHHHHHHSCCCEEEEEEESCCHHHHHHHHHHHHHHHHTTCEEE-EEEECTTC-C
T ss_pred ccCCCCEEeehHHHHHHHHHHHHHHHHHHHHcCCCCCcEEEEEeCCCHHHHHHHHHHHHHHHHcCCeEE-EEecCccC-C
Confidence 356799999999999999999999999999888899999999999999999999999999999999999 99999999 8
Q ss_pred HH---hhhccccCCCCCCccEEEEcCCCCCCCcHHHHHhhcCCCCCCCCCCccchHHhhcCCCCcccCCHHHHHHHHHHh
Q psy4615 146 RS---KLINPMSIPISTGVSSHISQLPLPEHMVERAVCNAVAPHKDVDGFNIVNVGRFCLDLKTLIPCTPLGVQELIRRY 222 (477)
Q Consensus 146 ~e---~~I~~L~~N~D~~V~GILVqlPLP~~ld~~~l~~aI~p~KDVDGl~p~nlg~l~~g~~~f~PcTa~Av~~Lle~~ 222 (477)
|+ +.|++| |+|++|||||||+|||+|+|+++++++|+|+||||||||.|+|+|+.|.+.|.||||.||++||++|
T Consensus 96 e~ell~~I~~L--N~D~~V~GIlVQlPLP~hid~~~i~~~I~p~KDVDG~hp~N~G~L~~g~~~~~PcTp~gv~~lL~~~ 173 (303)
T 4b4u_A 96 TEQLLAEIEKL--NANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGEAAYGSATPAGIMTILKEN 173 (303)
T ss_dssp HHHHHHHHHHH--HTCTTCCEEEECSSCCTTSCHHHHHHHSCGGGCTTCCCHHHHHHHHTTCCCCCCHHHHHHHHHHHHT
T ss_pred HHHHHHHHHHh--cCCCCccEEEEeCCCccccChHHHHhccCcccccCccCcchHHHhcCCCCcccCccHHHHHHHHHHH
Confidence 87 788889 9999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCeEEEECCCCCcchHHHHHhhhCCC-------------------------------------------------
Q psy4615 223 KVETFGKNAVVCGRSKNVGMPIAMLLHADGA------------------------------------------------- 253 (477)
Q Consensus 223 gi~l~Gk~vvViGrS~~VGkPLA~lL~~~~a------------------------------------------------- 253 (477)
+++++||+++|+|||++||+|+|+||.++|+
T Consensus 174 ~i~l~Gk~vvViGRS~iVGkPla~LL~~~~ATVTi~Hs~T~dl~~~~~~ADIvV~A~G~p~~i~~d~vk~GavVIDVGin 253 (303)
T 4b4u_A 174 NIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFH 253 (303)
T ss_dssp TCCCTTCEEEEECCCTTTHHHHHHHHHHTTCEEEEECTTCSSHHHHHHTCSEEEECSCSTTCBCGGGSCTTCEEEECCCB
T ss_pred CCCCCCCEEEEEeccccccchHHHHHHhcCCEEEEecCCCCCHHHHhhcCCeEEeccCCCCccccccccCCCEEEEecee
Confidence 9999999999999999999999999998888
Q ss_pred -------------CccccceEEccCCCCCChhHHHHHHHHHHHHHHHHh
Q psy4615 254 -------------GVSEVAGYITPVPGGVGPMTVAMLMKNTILAAKHAV 289 (477)
Q Consensus 254 -------------~v~~~a~~iTPVpGGVGp~T~a~L~~N~l~a~~~~~ 289 (477)
+|.++|+|||||||||||||++||++|++.+++++.
T Consensus 254 ~~~~~~vGDVdf~~v~~~a~~iTPVPGGVGPmTiamLl~Ntv~aa~r~~ 302 (303)
T 4b4u_A 254 PRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKAL 302 (303)
T ss_dssp CCTTSCBCSBCCTTGGGTCSEECCSSSSHHHHHHHHHHHHHHHHHHHHH
T ss_pred cCCCCeECCcCHHHHhhhCcEECCCCCCchHHHHHHHHHHHHHHHHHhc
Confidence 578899999999999999999999999999998754
|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >1vko_A Inositol-3-phosphate synthase; CE21227, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD; 2.30A {Caenorhabditis elegans} SCOP: c.2.1.3 d.81.1.3 | Back alignment and structure |
|---|
| >1p1j_A Inositol-3-phosphate synthase; 1L-MYO-inositol 1-phosphate, NADH, isomerase, rossmann fold; HET: NAI; 1.70A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.3 PDB: 1jkf_A* 1la2_A* 1p1f_A 1jki_A* 1p1i_A* 1p1h_A* 1p1k_A* 1rm0_A* | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >3qvs_A MIPS, MYO-inositol-1-phosphate synthase (INO1); NAD binding rossmann fold, L-MYO-inositol 1-phosphate syntha isomerase; HET: NAD PG4; 1.70A {Archaeoglobus fulgidus} PDB: 1u1i_A* 3qvt_A* 3qvw_A* 3qvx_A* 3qw2_A* | Back alignment and structure |
|---|
| >1vjp_A MYO-inositol-1-phosphate synthase-related protein; TM1419, structural genomics, JCSG, PSI, protein structure initiative; HET: NAD; 1.70A {Thermotoga maritima} PDB: 3cin_A* | Back alignment and structure |
|---|
| >3cin_A MYO-inositol-1-phosphate synthase-related protein; structura genomics, joint center for structural genomics, JCSG; HET: NAD; 1.70A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >1gr0_A Inositol-3-phosphate synthase; isomerase, oxidoreductase, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: NAD; 1.95A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* | Back alignment and structure |
|---|
| >3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 477 | ||||
| d1p1ja1 | 410 | c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phospha | 4e-56 | |
| d1vkoa1 | 397 | c.2.1.3 (A:11-314,A:429-521) Myo-inositol 1-phosph | 8e-40 | |
| d1edza2 | 146 | c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/ | 3e-32 | |
| d1vkoa2 | 114 | d.81.1.3 (A:315-428) Myo-inositol 1-phosphate synt | 4e-29 | |
| d1p1ja2 | 115 | d.81.1.3 (A:323-437) Myo-inositol 1-phosphate synt | 7e-27 | |
| d1b0aa2 | 121 | c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/ | 2e-22 | |
| d1a4ia2 | 125 | c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/ | 2e-20 | |
| d1vjpa2 | 107 | d.81.1.3 (A:210-316) Hypothetical protein TM1419 { | 2e-17 | |
| d1gr0a2 | 111 | d.81.1.3 (A:201-311) Myo-inositol 1-phosphate synt | 5e-17 | |
| d1b0aa1 | 166 | c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehy | 2e-16 | |
| d1b0aa1 | 166 | c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehy | 4e-15 | |
| d1b0aa1 | 166 | c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehy | 4e-12 | |
| d1a4ia1 | 170 | c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehy | 3e-14 | |
| d1a4ia1 | 170 | c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehy | 4e-13 | |
| d1a4ia1 | 170 | c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehy | 9e-10 | |
| d1edza1 | 171 | c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehy | 6e-13 | |
| d1edza1 | 171 | c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehy | 5e-11 | |
| d1edza1 | 171 | c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehy | 2e-08 | |
| d1u1ia2 | 105 | d.81.1.3 (A:228-332) Myo-inositol 1-phosphate synt | 1e-12 |
| >d1p1ja1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 410 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain domain: Myo-inositol 1-phosphate synthase species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 190 bits (483), Expect = 4e-56
Identities = 49/171 (28%), Positives = 83/171 (48%), Gaps = 11/171 (6%)
Query: 282 ILAAKHAVIYNISKSNVVDDMVASNSILYRPGEKPDHTVVIKYVPYVGDSKRALDEYTSE 341
+ + + N+ +S D + S ++ +++ VPY+ S +
Sbjct: 245 VSPGVNDTMENLLQSIKNDHEEIAPSTIFA------AASILEGVPYINGSPQNTFVPGLV 298
Query: 342 ILLGGHNTISMHNTCEDSLLASPLILDLIILAELSSRIQFTS-----PTVAEYTYFHPVL 396
L T + +DSLLA+PLI+DL+++ E +R+ + ++ F+PVL
Sbjct: 299 QLAEHEGTFIAGDDLKDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPVL 358
Query: 397 SILSYLCKAPLVPPGTPVVNALAQQRSCIENILRACLSLPPENSMTLEHKL 447
+ LSY KAPL PG VN L +QR+ +EN LR + LP +N + E +L
Sbjct: 359 TFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 409
|
| >d1vkoa1 c.2.1.3 (A:11-314,A:429-521) Myo-inositol 1-phosphate synthase {Caenorhabditis elegans [TaxId: 6239]} Length = 397 | Back information, alignment and structure |
|---|
| >d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1vkoa2 d.81.1.3 (A:315-428) Myo-inositol 1-phosphate synthase {Caenorhabditis elegans [TaxId: 6239]} Length = 114 | Back information, alignment and structure |
|---|
| >d1p1ja2 d.81.1.3 (A:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 115 | Back information, alignment and structure |
|---|
| >d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1vjpa2 d.81.1.3 (A:210-316) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]} Length = 107 | Back information, alignment and structure |
|---|
| >d1gr0a2 d.81.1.3 (A:201-311) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 111 | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d1u1ia2 d.81.1.3 (A:228-332) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 105 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 477 | |||
| d1edza2 | 146 | Tetrahydrofolate dehydrogenase/cyclohydrolase {Bak | 100.0 | |
| d1b0aa2 | 121 | Tetrahydrofolate dehydrogenase/cyclohydrolase {Esc | 100.0 | |
| d1a4ia2 | 125 | Tetrahydrofolate dehydrogenase/cyclohydrolase {Hum | 99.98 | |
| d1vkoa1 | 397 | Myo-inositol 1-phosphate synthase {Caenorhabditis | 99.97 | |
| d1p1ja1 | 410 | Myo-inositol 1-phosphate synthase {Baker's yeast ( | 99.96 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 99.95 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 99.95 | |
| d1vkoa2 | 114 | Myo-inositol 1-phosphate synthase {Caenorhabditis | 99.94 | |
| d1p1ja2 | 115 | Myo-inositol 1-phosphate synthase {Baker's yeast ( | 99.93 | |
| d1u1ia2 | 105 | Myo-inositol 1-phosphate synthase {Archaeoglobus f | 99.9 | |
| d1gr0a2 | 111 | Myo-inositol 1-phosphate synthase {Mycobacterium t | 99.87 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 99.84 | |
| d1vjpa2 | 107 | Hypothetical protein TM1419 {Thermotoga maritima [ | 99.83 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 99.65 | |
| d1u1ia1 | 287 | Myo-inositol 1-phosphate synthase {Archaeoglobus f | 99.08 | |
| d1vjpa1 | 275 | Hypothetical protein TM1419 {Thermotoga maritima [ | 95.6 | |
| d1gr0a1 | 243 | Myo-inositol 1-phosphate synthase {Mycobacterium t | 92.58 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 92.36 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 91.22 |
| >d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Aminoacid dehydrogenase-like, N-terminal domain superfamily: Aminoacid dehydrogenase-like, N-terminal domain family: Tetrahydrofolate dehydrogenase/cyclohydrolase domain: Tetrahydrofolate dehydrogenase/cyclohydrolase species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=5.7e-40 Score=296.71 Aligned_cols=142 Identities=18% Similarity=0.164 Sum_probs=131.5
Q ss_pred ccccccHHHHHHHHHHHHHHHHHHHHc-CCCCCEEEEEEeCCChhhHHHHHHHHHHHHHcCCeeeeeEEecCCcccHHhh
Q psy4615 71 AQIIDGKFIANTILEELKDEVKAWVAL-GHRVPTLTAILVGNDSASSTYVNNKMKSAAKVGEVNALGVLYHLTLFGRSKL 149 (477)
Q Consensus 71 a~ILdGk~lA~~I~~~lk~~v~~lk~~-~g~~P~LaiI~vGdd~aS~~Yv~~k~k~a~~vGI~~~~~~~lp~~~~t~e~~ 149 (477)
.++|||++||++|++++++++++|+++ +|++|+|++|+||+|++|.+|+++|+|+|+++||+++ ..++++.. +..+.
T Consensus 3 gkiidG~~iA~~i~~~l~~~v~~l~~~~~g~~P~Lavilvg~d~aS~~Yv~~k~k~a~~~Gi~~~-l~~~~~~~-~l~~~ 80 (146)
T d1edza2 3 GRTILASKVAETFNTEIINNVEEYKKTHNGQGPLLVGFLANNDPAAKMYATWTQKTSESMGFRYD-LRVIEDKD-FLEEA 80 (146)
T ss_dssp CEECCHHHHHHHHHHHHHHHHHHHHHHTTTCCCEEEEEECCCCHHHHHHHHHHHHHHHHHTCEEE-EEECSSGG-GHHHH
T ss_pred CeeccHHHHHHHHHHHHHHHHHHHHHhcCCCCceEEEEEeCCCHHHHHHHHHHHHHHHHcCCccc-cCccchHH-HHHHH
Confidence 578999999999999999999999866 4799999999999999999999999999999999998 76665543 23389
Q ss_pred hccccCCCCCCccEEEEcCCCCCCCcHHHHHhhcCCCCCCCCCCccchHHhhcCCCCcccCCHHHHH
Q psy4615 150 INPMSIPISTGVSSHISQLPLPEHMVERAVCNAVAPHKDVDGFNIVNVGRFCLDLKTLIPCTPLGVQ 216 (477)
Q Consensus 150 I~~L~~N~D~~V~GILVqlPLP~~ld~~~l~~aI~p~KDVDGl~p~nlg~l~~g~~~f~PcTa~Av~ 216 (477)
|++| |+|++|||||||+|||+|+|+++++++|+|.||||||||.|+|+|+.|..++.||||+||+
T Consensus 81 I~~L--N~D~~V~GIlvQlPLP~~i~~~~i~~~I~p~KDVDGl~p~N~G~L~~~~~~l~P~t~~~~i 145 (146)
T d1edza2 81 IIQA--NGDDSVNGIMVYFPVFGNAQDQYLQQVVCKEKDVEGLNHVYYQNLYHNVRYLDKENRLKSI 145 (146)
T ss_dssp HHHH--HHCTTCCEEEECSCSSSSHHHHHHTTTSCTTTBTTCCSHHHHHHHHTTCCBSSSSSCSBCC
T ss_pred HHHH--hcchhhhhhhhcCCCCcccCHHHHHHhcCCCCCcCCCChHhHHHHHcCCCCCCCCCccCcc
Confidence 9999 9999999999999999999999999999999999999999999999999999999998864
|
| >d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vkoa1 c.2.1.3 (A:11-314,A:429-521) Myo-inositol 1-phosphate synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1p1ja1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vkoa2 d.81.1.3 (A:315-428) Myo-inositol 1-phosphate synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1p1ja2 d.81.1.3 (A:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u1ia2 d.81.1.3 (A:228-332) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gr0a2 d.81.1.3 (A:201-311) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vjpa2 d.81.1.3 (A:210-316) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u1ia1 c.2.1.3 (A:1-227,A:333-392) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vjpa1 c.2.1.3 (A:0-209,A:317-381) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|