Psyllid ID: psy4640


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MPMRNPDFLSSSSPSSRKSVGSDLDSIGSRNGLAVTDRFEEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSLASILQNSSTG
ccccccccccccccccccccccccccccccEEEEEEcccccccccEEEEccccEEEEcccccccccccEEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHcccccccc
cccccccccccccccccccccccHHHHHHccEEEEEccccHcHEcccEccccEEEEEcccccccccEEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHcccccc
mpmrnpdflsssspssrksvgsdldsigsrnglavtdrfEEEKLlgsillpsykispcssddkvFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSLASILQNSSTG
mpmrnpdflsssspssrksvgsdldsigsrnglavtdrFEEEKLLgsillpsykispcssdDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSLASILQNSSTG
MPMRNPDFLsssspssrksvgsDLDSIGSRNGLAVTDRFEEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSLASILQNSSTG
*********************************AVTDRFEEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSLASI*******
*************************SIGSRNGLAVTDRFEEEKLLGSILLPSYKIS*********RKFSFKAEHANMRTYYFAADTRESMIQWMNALSL**********
*************************SIGSRNGLAVTDRFEEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSLASILQNSSTG
**********************DLDSIGSRNGLAVTDRFEEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSLASI*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPMRNPDFLSSSSPSSRKSVGSDLDSIGSRNGLAVTDRFEEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSLASILQNSSTG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
B6RSP1 1197 Pleckstrin homology domai yes N/A 0.614 0.055 0.522 1e-16
Q9HAU0 1116 Pleckstrin homology domai no N/A 0.596 0.058 0.523 5e-13
Q3UIL6 1118 Pleckstrin homology domai no N/A 0.614 0.059 0.448 2e-12
Q6IQ23 1121 Pleckstrin homology domai no N/A 0.614 0.059 0.436 6e-12
Q9Y2H5 1048 Pleckstrin homology domai no N/A 0.596 0.062 0.415 5e-10
Q8VC98 588 Pleckstrin homology domai no N/A 0.633 0.117 0.463 1e-09
Q7TQG1 1173 Pleckstrin homology domai no N/A 0.596 0.055 0.4 1e-09
Q9H4M7 779 Pleckstrin homology domai no N/A 0.633 0.088 0.478 1e-09
P60669 779 Pleckstrin homology domai no N/A 0.633 0.088 0.463 2e-09
Q9Z1T4 1032 Connector enhancer of kin no N/A 0.522 0.055 0.366 3e-05
>sp|B6RSP1|PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio GN=plekha7 PE=2 SV=2 Back     alignment and function desciption
 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 50/67 (74%)

Query: 41  EEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSLA 100
           EE +LGSI LPSY I+P   +D + RK++FKAEH  MRTYYF+ADT+E M  W+ A++ A
Sbjct: 196 EESVLGSIPLPSYTIAPVGPEDHISRKYAFKAEHTGMRTYYFSADTQEDMNGWVRAMNQA 255

Query: 101 SILQNSS 107
           +++Q  +
Sbjct: 256 ALMQTHT 262




Required for zonula adherens biogenesis and maintenance.
Danio rerio (taxid: 7955)
>sp|Q9HAU0|PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens GN=PLEKHA5 PE=1 SV=1 Back     alignment and function description
>sp|Q3UIL6|PKHA7_MOUSE Pleckstrin homology domain-containing family A member 7 OS=Mus musculus GN=Plekha7 PE=1 SV=2 Back     alignment and function description
>sp|Q6IQ23|PKHA7_HUMAN Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens GN=PLEKHA7 PE=1 SV=2 Back     alignment and function description
>sp|Q9Y2H5|PKHA6_HUMAN Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens GN=PLEKHA6 PE=1 SV=4 Back     alignment and function description
>sp|Q8VC98|PKHA4_MOUSE Pleckstrin homology domain-containing family A member 4 OS=Mus musculus GN=Plekha4 PE=2 SV=1 Back     alignment and function description
>sp|Q7TQG1|PKHA6_MOUSE Pleckstrin homology domain-containing family A member 6 OS=Mus musculus GN=Plekha6 PE=1 SV=1 Back     alignment and function description
>sp|Q9H4M7|PKHA4_HUMAN Pleckstrin homology domain-containing family A member 4 OS=Homo sapiens GN=PLEKHA4 PE=1 SV=2 Back     alignment and function description
>sp|P60669|PKHA4_RAT Pleckstrin homology domain-containing family A member 4 OS=Rattus norvegicus GN=Plekha4 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1T4|CNKR2_RAT Connector enhancer of kinase suppressor of ras 2 OS=Rattus norvegicus GN=Cnksr2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
328719140 1876 PREDICTED: hypothetical protein LOC10015 0.614 0.035 0.852 9e-27
328719136 1931 PREDICTED: hypothetical protein LOC10015 0.614 0.034 0.852 1e-26
328719138 1955 PREDICTED: hypothetical protein LOC10015 0.614 0.034 0.852 1e-26
328719132 1925 PREDICTED: hypothetical protein LOC10015 0.614 0.034 0.852 1e-26
328719134 1950 PREDICTED: hypothetical protein LOC10015 0.614 0.034 0.852 1e-26
242011727 752 phosphoinositol 3-phosphate-binding prot 0.596 0.086 0.815 6e-26
350417736 1986 PREDICTED: hypothetical protein LOC10074 0.642 0.035 0.728 8e-25
340729380 2148 PREDICTED: hypothetical protein LOC10064 0.642 0.032 0.728 8e-25
328791467 1021 PREDICTED: hypothetical protein LOC10057 0.642 0.068 0.728 1e-24
345492005 2706 PREDICTED: hypothetical protein LOC10067 0.642 0.025 0.714 2e-24
>gi|328719140|ref|XP_003246674.1| PREDICTED: hypothetical protein LOC100159827 isoform 5 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (92%), Gaps = 1/68 (1%)

Query: 40  EEEKLLGSILLPSYKISPCS-SDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALS 98
           EEEKLLGSILLPSYKISPC  S+DKV+RKFSFKAEH NMRTYYFA+DTRE M+QWMNALS
Sbjct: 74  EEEKLLGSILLPSYKISPCCPSEDKVYRKFSFKAEHDNMRTYYFASDTRELMVQWMNALS 133

Query: 99  LASILQNS 106
           LASILQ +
Sbjct: 134 LASILQQN 141




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328719136|ref|XP_003246673.1| PREDICTED: hypothetical protein LOC100159827 isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328719138|ref|XP_001942884.2| PREDICTED: hypothetical protein LOC100159827 isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328719132|ref|XP_003246671.1| PREDICTED: hypothetical protein LOC100159827 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328719134|ref|XP_003246672.1| PREDICTED: hypothetical protein LOC100159827 isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242011727|ref|XP_002426598.1| phosphoinositol 3-phosphate-binding protein, putative [Pediculus humanus corporis] gi|212510747|gb|EEB13860.1| phosphoinositol 3-phosphate-binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350417736|ref|XP_003491569.1| PREDICTED: hypothetical protein LOC100742314 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340729380|ref|XP_003402982.1| PREDICTED: hypothetical protein LOC100645228 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328791467|ref|XP_003251574.1| PREDICTED: hypothetical protein LOC100576695 [Apis mellifera] Back     alignment and taxonomy information
>gi|345492005|ref|XP_003426754.1| PREDICTED: hypothetical protein LOC100678498 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
FB|FBgn0085412 3022 CG34383 [Drosophila melanogast 0.642 0.023 0.614 6.5e-19
ZFIN|ZDB-GENE-050419-75 1208 plekha7a "pleckstrin homology 0.587 0.052 0.546 4.5e-14
UNIPROTKB|I3LDM9168 I3LDM9 "Uncharacterized protei 0.596 0.386 0.523 4.9e-14
UNIPROTKB|F1NQ91 1019 F1NQ91 "Uncharacterized protei 0.596 0.063 0.538 4.2e-13
ZFIN|ZDB-GENE-041210-25 1237 plekha5 "pleckstrin homology d 0.577 0.050 0.555 8.9e-13
UNIPROTKB|F1SQZ2 1040 F1SQZ2 "Uncharacterized protei 0.596 0.062 0.523 1.2e-12
UNIPROTKB|E2RD14 1118 PLEKHA5 "Uncharacterized prote 0.596 0.058 0.523 1.3e-12
UNIPROTKB|B4DJX4 977 PLEKHA5 "cDNA FLJ59284, highly 0.596 0.066 0.523 1.4e-12
UNIPROTKB|F5H0I0 1098 PLEKHA5 "Pleckstrin homology d 0.596 0.059 0.523 1.6e-12
UNIPROTKB|E7EME8 1105 PLEKHA5 "Pleckstrin homology d 0.596 0.058 0.523 1.6e-12
FB|FBgn0085412 CG34383 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 245 (91.3 bits), Expect = 6.5e-19, P = 6.5e-19
 Identities = 43/70 (61%), Positives = 58/70 (82%)

Query:    40 EEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSL 99
             EEEKLLGS+LLPSY++S C  +DK++RKF+FK EH NMRTY+ AAD  E+M+QW+ AL+ 
Sbjct:   408 EEEKLLGSVLLPSYRVSACLPEDKIYRKFAFKCEHQNMRTYWLAADNSEAMMQWVRALAA 467

Query:   100 ASILQNSSTG 109
             AS++Q  S+G
Sbjct:   468 ASLMQAPSSG 477




GO:0005543 "phospholipid binding" evidence=IEA
ZFIN|ZDB-GENE-050419-75 plekha7a "pleckstrin homology domain containing, family A member 7a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDM9 I3LDM9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQ91 F1NQ91 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041210-25 plekha5 "pleckstrin homology domain containing, family A member 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQZ2 F1SQZ2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RD14 PLEKHA5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B4DJX4 PLEKHA5 "cDNA FLJ59284, highly similar to Pleckstrin homology domain-containing family A member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H0I0 PLEKHA5 "Pleckstrin homology domain-containing family A member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EME8 PLEKHA5 "Pleckstrin homology domain-containing family A member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B6RSP1PKHA7_DANRENo assigned EC number0.52230.61460.0559yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 6e-37
cd01260114 cd01260, PH_CNK_mammalian-like, Connector enhancer 2e-09
smart00233102 smart00233, PH, Pleckstrin homology domain 5e-09
pfam00169101 pfam00169, PH, PH domain 6e-09
cd1331695 cd13316, PH_Boi, Boi family Pleckstrin homology do 1e-07
cd13236105 cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain co 1e-07
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 7e-06
cd13308113 cd13308, PH_3BP2, SH3 domain-binding protein 2 Ple 2e-05
cd1332690 cd13326, PH_CNK_insect-like, Connector enhancer of 2e-05
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 7e-05
cd13235113 cd13235, PH2_FARP1-like, FERM, RhoGEF and pleckstr 5e-04
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 6e-04
cd01263119 cd01263, PH_anillin, Anillin Pleckstrin homology ( 0.003
cd13272116 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bis 0.004
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
 Score =  120 bits (303), Expect = 6e-37
 Identities = 47/62 (75%), Positives = 52/62 (83%)

Query: 40  EEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSL 99
           EEEK LGSILLPSY ISP S  D++ RKF+FKAEHA MRTYYFAADT+E M QWM ALSL
Sbjct: 43  EEEKALGSILLPSYTISPASPSDEINRKFAFKAEHAGMRTYYFAADTQEEMEQWMKALSL 102

Query: 100 AS 101
           A+
Sbjct: 103 AA 104


PEPP1 (also called PLEKHA4/PH domain-containing family A member 4 and RHOXF1/Rhox homeobox family member 1), and related homologs PEPP2 (also called PLEKHA5/PH domain-containing family A member 5) and PEPP3 (also called PLEKHA6/PH domain-containing family A member 6), have PH domains that interact specifically with PtdIns(3,4)P3. Other proteins that bind PtdIns(3,4)P3 specifically are: TAPP1 (tandem PH-domain-containing protein-1) and TAPP2], PtdIns3P AtPH1, and Ptd- Ins(3,5)P2 (centaurin-beta2). All of these proteins contain at least 5 of the 6 conserved amino acids that make up the putative phosphatidylinositol 3,4,5- trisphosphate-binding motif (PPBM) located at their N-terminus. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 104

>gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241390 cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins pleckstrin homology (PH) domain, C-terminus Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241389 cd13235, PH2_FARP1-like, FERM, RhoGEF and pleckstrin domain-containing protein 1 and related proteins Pleckstrin Homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241294 cd01263, PH_anillin, Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241426 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bisphosphate 4-phosphatase and Type II inositol 3,4-bisphosphate 4-phosphatase Pleckstrin homology (PH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.88
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.83
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.81
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.81
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.8
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.8
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.8
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.76
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.76
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.76
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.75
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.74
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.74
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.74
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.73
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.73
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.72
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.7
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.69
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.69
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 99.65
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.65
KOG0930|consensus395 99.63
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.61
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.55
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.53
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.5
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.49
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.43
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 99.36
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.34
PF1540989 PH_8: Pleckstrin homology domain 99.22
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.03
KOG3531|consensus1036 98.88
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 98.82
KOG0932|consensus 774 98.79
KOG3640|consensus1116 98.68
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.59
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 98.48
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 98.46
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.39
KOG2059|consensus 800 98.39
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.33
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.27
KOG1117|consensus 1186 98.22
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 98.2
KOG0521|consensus 785 98.17
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 98.14
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 98.14
PF15406112 PH_6: Pleckstrin homology domain 98.1
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 98.0
KOG1090|consensus1732 97.97
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 97.92
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 97.83
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 97.8
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 97.79
KOG4424|consensus623 97.78
PTZ00267478 NIMA-related protein kinase; Provisional 97.64
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 97.61
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 97.59
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 97.49
PLN02866 1068 phospholipase D 97.48
KOG3751|consensus 622 97.44
KOG0690|consensus 516 97.39
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 97.33
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 97.25
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 97.22
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 96.94
PTZ00283496 serine/threonine protein kinase; Provisional 96.84
KOG1117|consensus1186 96.46
KOG3727|consensus 664 96.37
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 96.18
KOG0248|consensus 936 96.13
cd01255160 PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM 96.03
KOG1738|consensus638 95.96
KOG3549|consensus 505 95.74
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 95.73
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 95.64
KOG1739|consensus 611 95.6
KOG1264|consensus 1267 95.51
KOG4236|consensus 888 95.11
KOG3543|consensus 1218 94.96
KOG1451|consensus 812 94.84
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 94.74
PF15408104 PH_7: Pleckstrin homology domain 94.09
KOG4407|consensus 1973 93.96
KOG4424|consensus 623 93.81
KOG0705|consensus 749 92.9
KOG4807|consensus 593 92.16
KOG0517|consensus2473 91.66
PF08458110 PH_2: Plant pleckstrin homology-like region; Inter 91.06
KOG3523|consensus695 90.71
PF15411116 PH_10: Pleckstrin homology domain 90.07
KOG2070|consensus 661 89.89
KOG3520|consensus 1167 86.46
KOG3723|consensus851 85.63
PF15404185 PH_4: Pleckstrin homology domain 83.35
PF1248077 DUF3699: Protein of unknown function (DUF3699) ; I 80.93
KOG3531|consensus 1036 80.6
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
Probab=99.88  E-value=2.4e-22  Score=128.76  Aligned_cols=78  Identities=28%  Similarity=0.399  Sum_probs=69.2

Q ss_pred             ccCCceEEeeCCeEEEEcCCCCCcccEEEEcCCeEEeecCCCCcccceeeEEEeeCCceEEEEEcCCHHHHHHHHHHHHH
Q psy4640          20 VGSDLDSIGSRNGLAVTDRFEEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSL   99 (109)
Q Consensus        20 ~~~~~~~vL~~~~L~yyk~~~d~~p~G~I~L~~~~V~~~~~~~~~~k~~~F~i~~~~~r~y~fsA~s~~e~~~Wi~aI~~   99 (109)
                      .+++-|+||+++.|+||+++++++|.|.|+|++++|..+.+   .+++++|+|.+++.|+|+|+|+|++|+++||+||+.
T Consensus        19 ~WkkrwfvL~~~~L~yyk~~~~~~~~~~I~L~~~~v~~~~~---~~k~~~F~I~~~~~~~~~f~a~s~~e~~~Wi~ai~~   95 (96)
T cd01260          19 KWARRWFVLKGTTLYWYRSKQDEKAEGLIFLSGFTIESAKE---VKKKYAFKVCHPVYKSFYFAAETLDDLSQWVNHLIT   95 (96)
T ss_pred             CceeEEEEEECCEEEEECCCCCCccceEEEccCCEEEEchh---cCCceEEEECCCCCcEEEEEeCCHHHHHHHHHHHHh
Confidence            34445899999999999999999999999999999876644   257899999988779999999999999999999987


Q ss_pred             h
Q psy4640         100 A  100 (109)
Q Consensus       100 a  100 (109)
                      |
T Consensus        96 ~   96 (96)
T cd01260          96 A   96 (96)
T ss_pred             C
Confidence            6



Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain. CNK is believed to regulate the activity and the subcellular localization of RAS activated RAF. CNK is composed of N-terminal SAM and PDZ domains along with a central or C-terminal PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskelet

>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0930|consensus Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG0932|consensus Back     alignment and domain information
>KOG3640|consensus Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1090|consensus Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>KOG3727|consensus Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1739|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>KOG3543|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG4807|consensus Back     alignment and domain information
>KOG0517|consensus Back     alignment and domain information
>PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>PF15411 PH_10: Pleckstrin homology domain Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG3520|consensus Back     alignment and domain information
>KOG3723|consensus Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>PF12480 DUF3699: Protein of unknown function (DUF3699) ; InterPro: IPR022168 This domain family is found in eukaryotes, and is approximately 80 amino acids in length Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2dkp_A128 Solution Structure Of The Ph Domain Of Pleckstrin H 2e-15
1upq_A123 Crystal Structure Of The Pleckstrin Homology (Ph) D 1e-12
2d9y_A117 Solution Structure Of The Ph Domain Of Pepp-3 From 7e-11
2yry_A122 Solution Structure Of The Ph Domain Of Pleckstrin H 1e-10
>pdb|2DKP|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Protein Family A Member 5 From Human Length = 128 Back     alignment and structure

Iteration: 1

Score = 77.4 bits (189), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 50/68 (73%) Query: 40 EEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSL 99 +EE +LGSILLPS++I+ +S+D + RK++FKA H NMRTYYF DT + M WM A+ Sbjct: 57 KEEGILGSILLPSFQIALLTSEDHINRKYAFKAAHPNMRTYYFCTDTGKEMELWMKAMLD 116 Query: 100 ASILQNSS 107 A+++Q S Sbjct: 117 AALVQTSG 124
>pdb|1UPQ|A Chain A, Crystal Structure Of The Pleckstrin Homology (Ph) Domain Of Pepp1 Length = 123 Back     alignment and structure
>pdb|2D9Y|A Chain A, Solution Structure Of The Ph Domain Of Pepp-3 From Human Length = 117 Back     alignment and structure
>pdb|2YRY|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Family A Member 6 From Human Length = 122 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2dkp_A128 Pleckstrin homology domain-containing family A mem 2e-21
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 4e-21
2yry_A122 Pleckstrin homology domain-containing family A mem 6e-21
2d9y_A117 Pleckstrin homology domain-containing protein fami 1e-20
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 2e-19
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 1e-18
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 3e-18
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 5e-17
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 1e-16
3cxb_B112 Pleckstrin homology domain-containing family M mem 8e-16
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 2e-15
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 7e-15
1u5e_A211 SRC-associated adaptor protein; novel dimerization 2e-14
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 3e-14
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 1e-13
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 8e-13
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 3e-12
3aj4_A112 Pleckstrin homology domain-containing family B ME; 4e-12
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 2e-11
1v5p_A126 Pleckstrin homology domain-containing, family A; T 2e-11
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 8e-11
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 8e-11
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 9e-11
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 9e-11
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 2e-10
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 5e-10
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 1e-09
2d9v_A130 Pleckstrin homology domain-containing protein fami 2e-09
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 2e-09
1wi1_A126 Calcium-dependent activator protein for secretion, 3e-09
3rcp_A103 Pleckstrin homology domain-containing family A ME; 3e-09
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 4e-09
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 1e-08
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 1e-08
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 1e-08
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 2e-08
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 4e-08
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 9e-08
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 2e-07
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 4e-07
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 4e-07
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 6e-07
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 7e-07
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 9e-07
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 1e-06
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-06
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 2e-06
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 2e-06
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 2e-06
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 5e-06
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 7e-06
1v88_A130 Oxysterol binding protein-related protein 8; vesic 8e-06
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 2e-05
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 6e-04
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
 Score = 81.0 bits (200), Expect = 2e-21
 Identities = 35/68 (51%), Positives = 50/68 (73%)

Query: 40  EEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSL 99
           +EE +LGSILLPS++I+  +S+D + RK++FKA H NMRTYYF  DT + M  WM A+  
Sbjct: 57  KEEGILGSILLPSFQIALLTSEDHINRKYAFKAAHPNMRTYYFCTDTGKEMELWMKAMLD 116

Query: 100 ASILQNSS 107
           A+++Q S 
Sbjct: 117 AALVQTSG 124


>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Length = 124 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.92
1wi1_A126 Calcium-dependent activator protein for secretion, 99.88
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.88
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.88
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.87
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.87
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.87
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.87
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.86
2yry_A122 Pleckstrin homology domain-containing family A mem 99.85
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.85
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.85
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.84
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.82
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.82
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.82
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.82
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.81
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.81
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.81
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.81
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.8
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.8
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.8
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.79
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.79
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.79
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.79
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.79
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.78
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.78
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.78
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.78
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.77
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.77
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.77
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.77
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.77
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 99.77
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.76
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.76
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.76
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.76
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.75
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.75
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.75
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.74
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.73
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.72
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.7
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.69
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.68
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.68
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.66
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.66
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.65
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.65
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.64
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.63
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.6
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 99.59
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 99.56
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.55
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 99.53
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.46
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.32
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.27
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.12
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.99
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 98.97
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.94
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 98.76
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 98.6
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 98.39
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 98.37
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 98.08
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 98.02
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.95
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 97.79
3ml4_A 224 Protein DOK-7; tyrosine phosphorylation, adapter p 97.79
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 97.75
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 97.74
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 97.69
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 97.68
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.67
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 97.6
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 97.6
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.59
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 97.58
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 97.58
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 97.56
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 97.54
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 97.52
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 97.51
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 97.5
1foe_A377 T-lymphoma invasion and metastasis inducing protei 97.37
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 97.35
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 97.34
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 97.09
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 96.0
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 93.2
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 89.89
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
Probab=99.92  E-value=8.5e-25  Score=143.86  Aligned_cols=89  Identities=24%  Similarity=0.296  Sum_probs=76.7

Q ss_pred             cccCCceEEeeCC---eEEEEcCCCCCcccEEEEcCCeEEeecCCCCcccceeeEEEeeCCceEEEEEcCCHHHHHHHHH
Q psy4640          19 SVGSDLDSIGSRN---GLAVTDRFEEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMN   95 (109)
Q Consensus        19 ~~~~~~~~vL~~~---~L~yyk~~~d~~p~G~I~L~~~~V~~~~~~~~~~k~~~F~i~~~~~r~y~fsA~s~~e~~~Wi~   95 (109)
                      +.+++.|+||+++   +||||++++|.+|.|.|+|+||+|..+.+.+...++|+|+|.+++ ++|+|+|+|+++|++||+
T Consensus        21 ~~WkkrWfVL~~~~~~~Ly~Yk~~~d~~p~g~I~L~g~~V~~~~~~~~~~~~~~Fki~~~~-~~y~f~A~s~e~~~~Wl~   99 (112)
T 2coc_A           21 ETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHVWKLQWAK-QSWYLSASSAELQQQWLE   99 (112)
T ss_dssp             SCEEEEEEECCTTCTTCEEEECCTTCSSSCSEECGGGCEEECCCSSSCCSSSEEEEEEETT-EEEEEEESSHHHHHHHHH
T ss_pred             CCceEEEEEEECCCccEEEEECCCCccCcceEEEcCCCEEEecCcccccCCCCEEEEecCC-eEEEEEcCCHHHHHHHHH
Confidence            4455579999985   899999999999999999999999865444445678999999765 899999999999999999


Q ss_pred             HHHHhhhhccCCC
Q psy4640          96 ALSLASILQNSST  108 (109)
Q Consensus        96 aI~~a~~~~~~~~  108 (109)
                      +|+.|+..+.|.+
T Consensus       100 al~~A~~~~~~~~  112 (112)
T 2coc_A          100 TLSTAAHSGPSSG  112 (112)
T ss_dssp             HHHHHHSCCSSCC
T ss_pred             HHHHHhcCCCCCC
Confidence            9999998887754



>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 7e-12
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 2e-09
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 2e-08
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 3e-08
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 1e-07
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 2e-07
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 2e-07
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 3e-07
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 4e-07
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 4e-07
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 5e-07
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 5e-07
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 3e-06
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 3e-06
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 4e-06
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 5e-06
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 6e-06
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 8e-06
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 2e-05
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 2e-05
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 3e-05
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 4e-05
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 6e-05
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 6e-05
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 1e-04
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 1e-04
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 2e-04
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 4e-04
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 8e-04
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 0.001
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 0.002
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Phosphoinositol 3-phosphate binding protein-1, PEPP1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.9 bits (131), Expect = 7e-12
 Identities = 32/62 (51%), Positives = 38/62 (61%)

Query: 40  EEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNALSL 99
            EE +LGS+LLPSY I P        R+F+F AEH  MRTY  AADT E +  W+ AL  
Sbjct: 45  REESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGR 104

Query: 100 AS 101
           AS
Sbjct: 105 AS 106


>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.85
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.82
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.82
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.81
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.81
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.8
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.8
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.78
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.78
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.77
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.77
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.77
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.75
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.75
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.74
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.73
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.72
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.71
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.69
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.68
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.66
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.65
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.64
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.63
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.62
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.61
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.58
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.53
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 99.24
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.87
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.81
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.67
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 98.62
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 98.27
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 98.01
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.98
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.74
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 97.59
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 96.99
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 96.01
d1foea2162 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 95.58
d1zsqa1125 Myotubularin-related protein 2, N-terminal domain 94.77
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 93.6
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: FYVE, RhoGEF and PH domain containing protein 3, FGD3
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.85  E-value=2.5e-21  Score=120.24  Aligned_cols=82  Identities=23%  Similarity=0.323  Sum_probs=70.4

Q ss_pred             ccCCceEEeeCC---eEEEEcCCCCCcccEEEEcCCeEEeecCCCCcccceeeEEEeeCCceEEEEEcCCHHHHHHHHHH
Q psy4640          20 VGSDLDSIGSRN---GLAVTDRFEEEKLLGSILLPSYKISPCSSDDKVFRKFSFKAEHANMRTYYFAADTRESMIQWMNA   96 (109)
Q Consensus        20 ~~~~~~~vL~~~---~L~yyk~~~d~~p~G~I~L~~~~V~~~~~~~~~~k~~~F~i~~~~~r~y~fsA~s~~e~~~Wi~a   96 (109)
                      .+++-|+||+++   .||||+++++..|.|.|+|.+|.+.........+++|+|+|.+++ |+|+|+|+|++|+++||+|
T Consensus        15 ~W~krwfvL~~~~~~~ly~~~~~~~~~~~~~i~l~~~~~~~~~~~~~~~~~~~F~i~~~~-r~~~l~A~s~~e~~~Wi~a   93 (99)
T d2coca1          15 TWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHVWKLQWAK-QSWYLSASSAELQQQWLET   93 (99)
T ss_dssp             CEEEEEEECCTTCTTCEEEECCTTCSSSCSEECGGGCEEECCCSSSCCSSSEEEEEEETT-EEEEEEESSHHHHHHHHHH
T ss_pred             CccEEEEEEecCCccEEEEECcCccccccccccccceeeeecccccccCCceEEEEEcCC-cEEEEECCCHHHHHHHHHH
Confidence            344568999987   699999999999999999999988765554445678999998875 8999999999999999999


Q ss_pred             HHHhhh
Q psy4640          97 LSLASI  102 (109)
Q Consensus        97 I~~a~~  102 (109)
                      |+.|++
T Consensus        94 L~~Aa~   99 (99)
T d2coca1          94 LSTAAH   99 (99)
T ss_dssp             HHHHHS
T ss_pred             HHHhcC
Confidence            999874



>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zsqa1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure