Psyllid ID: psy4702
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 138 | ||||||
| 242001014 | 935 | heat shock protein 70 (HSP70)-interactin | 0.913 | 0.134 | 0.419 | 9e-22 | |
| 195451276 | 949 | GK13474 [Drosophila willistoni] gi|19416 | 0.905 | 0.131 | 0.441 | 2e-21 | |
| 195111867 | 954 | GI10261 [Drosophila mojavensis] gi|19391 | 0.905 | 0.131 | 0.441 | 4e-21 | |
| 183979249 | 943 | similar to CG2708-PA [Papilio xuthus] | 0.898 | 0.131 | 0.445 | 5e-21 | |
| 307188554 | 939 | UNC45-like protein A [Camponotus florida | 0.913 | 0.134 | 0.4 | 6e-21 | |
| 242010879 | 944 | heat shock protein 70 HSP70 interacting | 0.869 | 0.127 | 0.446 | 1e-20 | |
| 195498581 | 947 | GE24964 [Drosophila yakuba] gi|194182685 | 0.905 | 0.131 | 0.418 | 2e-20 | |
| 195153186 | 946 | GL21482 [Drosophila persimilis] gi|19411 | 0.905 | 0.132 | 0.426 | 2e-20 | |
| 125777358 | 946 | GA15439 [Drosophila pseudoobscura pseudo | 0.905 | 0.132 | 0.426 | 3e-20 | |
| 195055231 | 948 | GH17296 [Drosophila grimshawi] gi|193892 | 0.905 | 0.131 | 0.434 | 3e-20 |
| >gi|242001014|ref|XP_002435150.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ixodes scapularis] gi|215498480|gb|EEC07974.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
Score = 108 bits (269), Expect = 9e-22, Method: Compositional matrix adjust.
Identities = 55/131 (41%), Positives = 93/131 (70%), Gaps = 5/131 (3%)
Query: 12 SQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLE-KNWVDIFKQILAHPDVGV 70
+V++L L +ED +T+ AAAGALAMLTSVS C ++E K+WV+IF + AH D +
Sbjct: 796 DRVKYLTLCLEDEDYDTSQAAAGALAMLTSVSDVACQKVVEVKDWVEIFGGLAAHKDEAL 855
Query: 71 QHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEG----EEVRKLALQALAKGEEY 126
QHR + I+ N++ + +++AER++ + L+E+L+A+T +EG ++VRKLA + L+K E++
Sbjct: 856 QHRGVCILHNLVHSKRDVAERLVGSSLLEVLLAVTQVEGAAASDKVRKLAQETLSKAEQW 915
Query: 127 GIIRRPGEGEE 137
+I++ E +E
Sbjct: 916 KLIQKSSEQDE 926
|
Source: Ixodes scapularis Species: Ixodes scapularis Genus: Ixodes Family: Ixodidae Order: Ixodida Class: Arachnida Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195451276|ref|XP_002072843.1| GK13474 [Drosophila willistoni] gi|194168928|gb|EDW83829.1| GK13474 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195111867|ref|XP_002000498.1| GI10261 [Drosophila mojavensis] gi|193917092|gb|EDW15959.1| GI10261 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|183979249|dbj|BAG30786.1| similar to CG2708-PA [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|307188554|gb|EFN73289.1| UNC45-like protein A [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|242010879|ref|XP_002426185.1| heat shock protein 70 HSP70 interacting protein, putative [Pediculus humanus corporis] gi|212510236|gb|EEB13447.1| heat shock protein 70 HSP70 interacting protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|195498581|ref|XP_002096584.1| GE24964 [Drosophila yakuba] gi|194182685|gb|EDW96296.1| GE24964 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195153186|ref|XP_002017510.1| GL21482 [Drosophila persimilis] gi|194112567|gb|EDW34610.1| GL21482 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|125777358|ref|XP_001359581.1| GA15439 [Drosophila pseudoobscura pseudoobscura] gi|54639329|gb|EAL28731.1| GA15439 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195055231|ref|XP_001994523.1| GH17296 [Drosophila grimshawi] gi|193892286|gb|EDV91152.1| GH17296 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 138 | ||||||
| FB|FBgn0010812 | 947 | unc-45 [Drosophila melanogaste | 0.586 | 0.085 | 0.376 | 7.8e-10 | |
| RGD|1305666 | 735 | Unc45b "unc-45 homolog B (C. e | 0.528 | 0.099 | 0.386 | 3.7e-08 | |
| MGI|MGI:2443377 | 931 | Unc45b "unc-45 homolog B (C. e | 0.528 | 0.078 | 0.373 | 1.7e-07 | |
| UNIPROTKB|F1NXC5 | 953 | UNC45B "Uncharacterized protei | 0.405 | 0.058 | 0.431 | 2.3e-07 | |
| UNIPROTKB|F1MFZ5 | 931 | UNC45B "Uncharacterized protei | 0.528 | 0.078 | 0.36 | 5.8e-07 | |
| UNIPROTKB|F1S166 | 929 | UNC45B "Uncharacterized protei | 0.463 | 0.068 | 0.375 | 1.6e-06 | |
| UNIPROTKB|Q8IWX7 | 931 | UNC45B "Protein unc-45 homolog | 0.463 | 0.068 | 0.375 | 1.6e-06 | |
| ZFIN|ZDB-GENE-050417-158 | 935 | unc45a "unc-45 homolog A (C. e | 0.485 | 0.071 | 0.371 | 2e-06 | |
| UNIPROTKB|F1PUV3 | 943 | UNC45B "Uncharacterized protei | 0.463 | 0.067 | 0.375 | 2.6e-06 | |
| RGD|1305357 | 944 | Unc45a "unc-45 homolog A (C. e | 0.594 | 0.086 | 0.309 | 3.3e-06 |
| FB|FBgn0010812 unc-45 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 154 (59.3 bits), Expect = 7.8e-10, P = 7.8e-10
Identities = 32/85 (37%), Positives = 55/85 (64%)
Query: 41 SVSTPVCSMLLE-KNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELME 99
SVS C +L +W+DI ++A+P VQHR +VI+ N+++AG+E+A+++ T++ME
Sbjct: 831 SVSVKCCEKILAIASWLDILHTLIANPSPAVQHRGIVIILNMINAGEEIAKKLFETDIME 890
Query: 100 ILMALTLLEGE---EVRKLALQALA 121
+L L L + + R++A Q LA
Sbjct: 891 LLSGLGQLPDDTRAKAREVATQCLA 915
|
|
| RGD|1305666 Unc45b "unc-45 homolog B (C. elegans)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2443377 Unc45b "unc-45 homolog B (C. elegans)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NXC5 UNC45B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MFZ5 UNC45B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S166 UNC45B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IWX7 UNC45B "Protein unc-45 homolog B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050417-158 unc45a "unc-45 homolog A (C. elegans)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PUV3 UNC45B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1305357 Unc45a "unc-45 homolog A (C. elegans)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 138 | |||
| cd00020 | 120 | cd00020, ARM, Armadillo/beta-catenin-like repeats | 8e-06 |
| >gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
Score = 41.9 bits (99), Expect = 8e-06
Identities = 23/97 (23%), Positives = 42/97 (43%)
Query: 25 DTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSA 84
D AA AL+ L++ + ++E + Q+L D V AL + N+ +
Sbjct: 20 DENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKSEDEEVVKAALWALRNLAAG 79
Query: 85 GKELAERVLSTELMEILMALTLLEGEEVRKLALQALA 121
++ VL + L+ L E+++K A AL+
Sbjct: 80 PEDNKLIVLEAGGVPKLVNLLDSSNEDIQKNATGALS 116
|
An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| KOG4151|consensus | 748 | 99.82 | ||
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 98.58 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 97.16 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 96.93 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 96.62 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 96.41 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 94.91 | |
| KOG0166|consensus | 514 | 94.71 | ||
| KOG4224|consensus | 550 | 94.63 | ||
| KOG1048|consensus | 717 | 94.35 | ||
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 94.33 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 92.96 | |
| PF09759 | 102 | Atx10homo_assoc: Spinocerebellar ataxia type 10 pr | 92.17 | |
| PRK09687 | 280 | putative lyase; Provisional | 91.81 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 91.18 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 90.84 | |
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 90.72 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 90.63 | |
| KOG0166|consensus | 514 | 90.4 | ||
| PF08324 | 268 | PUL: PUL domain; InterPro: IPR013535 The PUL (afte | 90.01 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 88.44 | |
| PF11701 | 157 | UNC45-central: Myosin-binding striated muscle asse | 87.93 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 87.74 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 86.79 | |
| KOG4500|consensus | 604 | 86.01 | ||
| KOG4224|consensus | 550 | 85.84 | ||
| KOG1048|consensus | 717 | 85.7 | ||
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 85.61 | |
| KOG4199|consensus | 461 | 84.27 | ||
| KOG2160|consensus | 342 | 83.03 | ||
| PF11698 | 119 | V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 | 82.69 | |
| PRK09687 | 280 | putative lyase; Provisional | 82.44 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 82.37 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 81.91 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 81.86 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 81.03 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 80.77 |
| >KOG4151|consensus | Back alignment and domain information |
|---|
Probab=99.82 E-value=8.6e-21 Score=174.74 Aligned_cols=125 Identities=36% Similarity=0.519 Sum_probs=118.5
Q ss_pred ccCCChhhhhhhhcCCCCHHHHHhhhhhhhhhccCCHHHHhhhhh-ccHHHHHHHHhcCCCcccchhhhhhhhhhhhcCh
Q psy4702 8 LFYCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLE-KNWVDIFKQILAHPDVGVQHRALVIVGNILSAGK 86 (138)
Q Consensus 8 ~~~n~RlklLvll~~eED~~tr~AA~GALAmLT~~~~~~c~~I~~-~~wleil~~L~~~~~~~lqHRG~viv~Nmi~a~~ 86 (138)
..+|+|+|+|.++++++|+++++|++||+|+.|++++.+|.++.. .+|.+++..+..|+++++||||+||+.||+.++.
T Consensus 623 ~e~~~~l~~w~~~~e~~~E~~~lA~a~a~a~I~sv~~n~c~~~~~~~~~~e~~~~~i~~~~~~~qhrgl~~~ln~~~~~~ 702 (748)
T KOG4151|consen 623 VEYKDRLKLWNLNLEVADEKFELAGAGALAAITSVVENHCSRILELLEWLEILVRAIQDEDDEIQHRGLVIILNLFEALF 702 (748)
T ss_pred hccccCchHHHHHHHhhhhHHhhhccccccchhhcchhhhhhHHHhhcchHHHHHhhcCchhhhhhhhhhhhhhHHHHHH
Confidence 345999999999999999999999999999888889999999777 9999999999999999999999999999999999
Q ss_pred HHHHHHhhhhHHHHHHHhhccccHHHHHHHHHHHHHHHhCCCccCC
Q psy4702 87 ELAERVLSTELMEILMALTLLEGEEVRKLALQALAKGEEYGIIRRP 132 (138)
Q Consensus 87 e~a~kl~es~~leiL~~~~k~~~~~v~~~a~eaLk~~~~~glIk~~ 132 (138)
++++++++++.+++|....|.++.+..+.+..||.++.+||||+|+
T Consensus 703 ei~~~~~~~~~~~~l~~~~~~~~a~~~~~~~~~l~~a~~~~~~~~~ 748 (748)
T KOG4151|consen 703 EIAEKIFETEVMELLSGLQKLNRAPKREDAAPCLSAAEEYGLIKPK 748 (748)
T ss_pred HHHHHhccchHHHHHHHHHHhhhhhhhhhhhhHHHHHHHhhccCCC
Confidence 9999999999999999999995558899999999999999999985
|
|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >KOG4224|consensus | Back alignment and domain information |
|---|
| >KOG1048|consensus | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG4500|consensus | Back alignment and domain information |
|---|
| >KOG4224|consensus | Back alignment and domain information |
|---|
| >KOG1048|consensus | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >KOG4199|consensus | Back alignment and domain information |
|---|
| >KOG2160|consensus | Back alignment and domain information |
|---|
| >PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 138 | ||||
| 3now_A | 810 | Unc-45 From Drosophila Melanogaster Length = 810 | 8e-11 |
| >pdb|3NOW|A Chain A, Unc-45 From Drosophila Melanogaster Length = 810 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 138 | |||
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 2e-23 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 1e-08 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 7e-17 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 2e-08 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 3e-08 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 2e-08 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 2e-07 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 3e-05 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 3e-04 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 7e-08 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 4e-05 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 6e-05 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 7e-04 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 1e-07 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 1e-04 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 3e-07 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 1e-06 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 3e-04 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 5e-06 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 6e-04 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 6e-06 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 1e-05 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 8e-04 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 2e-05 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 5e-05 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 6e-04 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 7e-04 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 8e-05 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 5e-04 |
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 | Back alignment and structure |
|---|
Score = 93.8 bits (232), Expect = 2e-23
Identities = 55/132 (41%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
Query: 11 CSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLE-KNWVDIFKQILAHPDVG 69
+V+FL LL +ED ETA A AGALA++TSVS C +L +W+DI ++A+P
Sbjct: 664 NDRVKFLALLCEDEDEETATACAGALAIITSVSVKCCEKILAIASWLDILHTLIANPSPA 723
Query: 70 VQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEG---EEVRKLALQALAKGEEY 126
VQHR +VI+ N+++AG+E+A+++ T++ME+L L L + R++A Q LA E Y
Sbjct: 724 VQHRGIVIILNMINAGEEIAKKLFETDIMELLSGLGQLPDDTRAKAREVATQCLAAAERY 783
Query: 127 GIIRRPGEGEEE 138
II R E
Sbjct: 784 RIIERSDNAEIP 795
|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 99.77 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 99.51 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 98.92 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 98.88 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 98.76 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 98.72 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 98.66 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 98.55 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 98.35 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 98.27 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 98.26 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 98.2 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 98.19 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 98.17 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 98.17 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 98.12 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 98.12 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 98.09 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 98.03 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 98.02 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 98.01 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 98.01 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 97.99 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 97.96 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 97.96 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 97.89 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 97.81 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 97.79 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 97.78 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 97.67 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 97.67 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 97.62 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 97.43 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 97.4 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 97.37 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 97.19 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 97.15 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 96.8 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 96.09 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 96.05 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 95.49 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 94.91 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 94.73 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 94.65 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 94.51 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 94.33 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 93.7 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 92.99 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 92.81 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 92.62 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 92.05 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 90.95 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 90.58 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 90.36 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 90.35 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 90.18 | |
| 3ebb_A | 304 | Phospholipase A2-activating protein; armadillo rep | 89.68 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 89.2 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 89.18 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 86.78 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 85.53 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 85.39 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 85.18 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 84.88 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 83.89 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 83.65 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 81.52 |
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=99.77 E-value=3.3e-19 Score=164.39 Aligned_cols=127 Identities=43% Similarity=0.714 Sum_probs=114.8
Q ss_pred CCChhhhhhhhcCCCCHHHHHhhhhhhhhhccCCHHHHhhhhh-ccHHHHHHHHhcCCCcccchhhhhhhhhhhhcChHH
Q psy4702 10 YCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLE-KNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKEL 88 (138)
Q Consensus 10 ~n~RlklLvll~~eED~~tr~AA~GALAmLT~~~~~~c~~I~~-~~wleil~~L~~~~~~~lqHRG~viv~Nmi~a~~e~ 88 (138)
+++++++|+.|.+.+|..++++|+|||++||+.++..++.|++ .+|++.|..|+.++++++|||++.++.|+..++++.
T Consensus 663 ~~g~l~~Lv~LL~s~d~~vq~~Aa~ALanLt~~s~~~~~~ii~~~g~I~~Lv~LL~s~d~~vq~~A~~aL~NL~~~s~e~ 742 (810)
T 3now_A 663 NNDRVKFLALLCEDEDEETATACAGALAIITSVSVKCCEKILAIASWLDILHTLIANPSPAVQHRGIVIILNMINAGEEI 742 (810)
T ss_dssp SSSHHHHHHHGGGCSSHHHHHHHHHHHHHHHHHCHHHHHHHHTSTTHHHHHHHHHTCSSHHHHHHHHHHHHHHHTTCHHH
T ss_pred ccCcHHHHHHHhcCCCHHHHHHHHHHHHHHhCCCHHHHHHHHHHcCCHHHHHHHHCCCCHHHHHHHHHHHHHHHhCCHHH
Confidence 4689999999999999999999999999999866999999999 999999999999999999999999999999999999
Q ss_pred HHHHhhhhHHHHHHHhhccc--cH-HHHHHHHHHHHHHHhCCCccCCCCCC
Q psy4702 89 AERVLSTELMEILMALTLLE--GE-EVRKLALQALAKGEEYGIIRRPGEGE 136 (138)
Q Consensus 89 a~kl~es~~leiL~~~~k~~--~~-~v~~~a~eaLk~~~~~glIk~~~~~~ 136 (138)
++++++.|++++|..+.+.+ ++ ++++.|.+||+.+++||+|+|+++.+
T Consensus 743 ~~~l~e~G~i~~L~~LL~~~d~~~~~i~e~Al~aL~~ll~~g~~~~~~~~~ 793 (810)
T 3now_A 743 AKKLFETDIMELLSGLGQLPDDTRAKAREVATQCLAAAERYRIIERSDNAE 793 (810)
T ss_dssp HHHHHTSTHHHHHTTSCCCTTSTTHHHHHHHHHHHHHHHHHHTC-------
T ss_pred HHHHHHCCCHHHHHHHHhCcccCcHHHHHHHHHHHHHHHhCCCccCCCccc
Confidence 99999999999999999876 34 99999999999999999999998644
|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 138 | ||||
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 2e-05 | |
| d1xm9a1 | 457 | a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo | 1e-04 | |
| d1q1sc_ | 434 | a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus | 0.001 |
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Armadillo repeat domain: beta-Catenin species: Human (Homo sapiens) [TaxId: 9606]
Score = 40.6 bits (93), Expect = 2e-05
Identities = 23/104 (22%), Positives = 37/104 (35%), Gaps = 2/104 (1%)
Query: 19 LLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIV 78
+ E GAL +L ++ N + +F Q+L P +Q A ++
Sbjct: 426 FVEGVRMEEIVEGCTGALHILARDVHN-RIVIRGLNTIPLFVQLLYSPIENIQRVAAGVL 484
Query: 79 GNILSAGKELAERVLSTELMEILMALTLLEGEEVRKLALQALAK 122
L+ KE AE + + L L E V A L +
Sbjct: 485 CE-LAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFR 527
|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.65 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 98.52 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 98.45 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 98.17 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 98.17 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 98.17 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 97.99 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.89 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 97.83 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 97.75 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 96.45 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 94.47 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 94.06 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 93.91 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 92.39 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 92.27 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 90.83 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 80.71 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 80.71 |
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Plakophilin 1 helical region domain: Plakophilin 1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.65 E-value=5.3e-08 Score=72.47 Aligned_cols=111 Identities=12% Similarity=0.017 Sum_probs=97.0
Q ss_pred hhhhhcCCCCHHHHHhhhhhhhhhccCCHHHHhhhhhccHHHHHHHHhcCCCcccchhhhhhhhhhhhcChHHHHHHhhh
Q psy4702 16 FLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLST 95 (138)
Q Consensus 16 lLvll~~eED~~tr~AA~GALAmLT~~~~~~c~~I~~~~wleil~~L~~~~~~~lqHRG~viv~Nmi~a~~e~a~kl~es 95 (138)
.|+-|-+.+|+.++..|+++|.-|+.-++...+.|.+..+++.|..|+.++++++|..++-+++|+...+.+....+.+.
T Consensus 6 ~lv~~L~~~~~~~~~~a~~~l~~l~~~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~~~~~~~~i~~~ 85 (457)
T d1xm9a1 6 KAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETRRQ 85 (457)
T ss_dssp HHHHHHHSSCTHHHHHHHHHHHHHTSSCSSHHHHHHHTTHHHHHHHHTTSSCHHHHHHHHHHHHHHHSSCHHHHHHHHHT
T ss_pred HHHHHhCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCcHHHHHHHHCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHC
Confidence 34555567889999999999999986568889999888899999999999999999999999999998888888999999
Q ss_pred hHHHHHHHhhccccH-HHHHHHHHHHHHHHhC
Q psy4702 96 ELMEILMALTLLEGE-EVRKLALQALAKGEEY 126 (138)
Q Consensus 96 ~~leiL~~~~k~~~~-~v~~~a~eaLk~~~~~ 126 (138)
|+++.|..+.+...+ .+...|..+|..+...
T Consensus 86 g~v~~li~~l~~~~~~~~~~~a~~~l~~l~~~ 117 (457)
T d1xm9a1 86 NGIREAVSLLRRTGNAEIQKQLTGLLWNLSST 117 (457)
T ss_dssp TCHHHHHHHHTTCCCHHHHHHHHHHHHHHHTS
T ss_pred CChHHHHHHHhccCcHHHHHHHHHHHHHHHhh
Confidence 999999998877655 7888888888887653
|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|