Psyllid ID: psy4702


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MNKVYLILFYCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEGEEVRKLALQALAKGEEYGIIRRPGEGEEE
ccEEEHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccc
ccEEEEEEEEcccEEEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccc
MNKVYLILFYCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQIlahpdvgvQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEGEEVRKLALQALAKgeeygiirrpgegeee
MNKVYLILFYCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEGEEVRKLALQalakgeeygiirrpgegeee
MNKVYLILFYCSQVRFLFlltceedtetacaaagalamltSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEGEEVRKLALQALAKgeeygiirrpgegeee
***VYLILFYCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEGEEVRKLALQALAKGEEYGII*********
**KVYLILFYCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELMEILMALTLL***EVRKLALQALAKGEEY************
MNKVYLILFYCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEGEEVRKLALQALAKGEEYGIIRRPGEGEEE
MNKVYLILFYCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEGEEVRKLALQALAKGEEYGIIRR*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKVYLILFYCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEGEEVRKLALQALAKGEEYGIIRRPGEGEEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
Q8CGY6931 Protein unc-45 homolog B yes N/A 0.862 0.127 0.376 9e-15
Q8IWX7931 Protein unc-45 homolog B yes N/A 0.862 0.127 0.36 8e-14
Q5RAP0929 Protein unc-45 homolog A yes N/A 0.905 0.134 0.346 2e-13
Q9H3U1944 Protein unc-45 homolog A no N/A 0.905 0.132 0.346 2e-13
Q32PZ3944 Protein unc-45 homolog A no N/A 0.905 0.132 0.346 3e-13
Q99KD5944 Protein unc-45 homolog A no N/A 0.905 0.132 0.346 5e-13
Q68F64927 Protein unc-45 homolog B N/A N/A 0.826 0.122 0.352 1e-12
D7REX8927 Protein unc-45 homolog B no N/A 0.862 0.128 0.333 8e-12
Q6DGE9934 Protein unc-45 homolog B yes N/A 0.862 0.127 0.312 2e-11
O74994746 Ring assembly protein 3 O yes N/A 0.630 0.116 0.318 0.0006
>sp|Q8CGY6|UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus GN=Unc45b PE=1 SV=1 Back     alignment and function desciption
 Score = 79.0 bits (193), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 74/125 (59%), Gaps = 6/125 (4%)

Query: 12  SQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLE--KNWVDIFKQILAHPDVG 69
            +++ + LL  E+D +   AAAGALAMLT+    +C  + E    W++I +++  H  + 
Sbjct: 804 DRLKLVVLLCGEDDHKLQNAAAGALAMLTAAHKKLCLKMTEVTTQWLEILQRLCLHDQLS 863

Query: 70  VQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEGEEVR----KLALQALAKGEE 125
           VQHR LVI  N+LSA  ELA +++ +EL+EIL  +   E +E R    + A + L K  +
Sbjct: 864 VQHRGLVIAHNLLSADAELARKLVESELLEILTVVGKQEPDEKRAAVVQTARECLIKCMD 923

Query: 126 YGIIR 130
           YG I+
Sbjct: 924 YGFIK 928




Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain. Plays a role in sarcomere formation during muscle cell development.
Mus musculus (taxid: 10090)
>sp|Q8IWX7|UN45B_HUMAN Protein unc-45 homolog B OS=Homo sapiens GN=UNC45B PE=2 SV=1 Back     alignment and function description
>sp|Q5RAP0|UN45A_PONAB Protein unc-45 homolog A OS=Pongo abelii GN=UNC45A PE=2 SV=1 Back     alignment and function description
>sp|Q9H3U1|UN45A_HUMAN Protein unc-45 homolog A OS=Homo sapiens GN=UNC45A PE=1 SV=1 Back     alignment and function description
>sp|Q32PZ3|UN45A_RAT Protein unc-45 homolog A OS=Rattus norvegicus GN=Unc45a PE=2 SV=1 Back     alignment and function description
>sp|Q99KD5|UN45A_MOUSE Protein unc-45 homolog A OS=Mus musculus GN=Unc45a PE=1 SV=2 Back     alignment and function description
>sp|Q68F64|UN45B_XENLA Protein unc-45 homolog B OS=Xenopus laevis GN=unc45b PE=2 SV=1 Back     alignment and function description
>sp|D7REX8|UN45B_XENTR Protein unc-45 homolog B OS=Xenopus tropicalis GN=unc45b PE=1 SV=1 Back     alignment and function description
>sp|Q6DGE9|UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio GN=unc45b PE=1 SV=2 Back     alignment and function description
>sp|O74994|RNG3_SCHPO Ring assembly protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng3 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
242001014 935 heat shock protein 70 (HSP70)-interactin 0.913 0.134 0.419 9e-22
195451276 949 GK13474 [Drosophila willistoni] gi|19416 0.905 0.131 0.441 2e-21
195111867 954 GI10261 [Drosophila mojavensis] gi|19391 0.905 0.131 0.441 4e-21
183979249 943 similar to CG2708-PA [Papilio xuthus] 0.898 0.131 0.445 5e-21
307188554 939 UNC45-like protein A [Camponotus florida 0.913 0.134 0.4 6e-21
242010879 944 heat shock protein 70 HSP70 interacting 0.869 0.127 0.446 1e-20
195498581 947 GE24964 [Drosophila yakuba] gi|194182685 0.905 0.131 0.418 2e-20
195153186 946 GL21482 [Drosophila persimilis] gi|19411 0.905 0.132 0.426 2e-20
125777358 946 GA15439 [Drosophila pseudoobscura pseudo 0.905 0.132 0.426 3e-20
195055231 948 GH17296 [Drosophila grimshawi] gi|193892 0.905 0.131 0.434 3e-20
>gi|242001014|ref|XP_002435150.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ixodes scapularis] gi|215498480|gb|EEC07974.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 93/131 (70%), Gaps = 5/131 (3%)

Query: 12  SQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLE-KNWVDIFKQILAHPDVGV 70
            +V++L L   +ED +T+ AAAGALAMLTSVS   C  ++E K+WV+IF  + AH D  +
Sbjct: 796 DRVKYLTLCLEDEDYDTSQAAAGALAMLTSVSDVACQKVVEVKDWVEIFGGLAAHKDEAL 855

Query: 71  QHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEG----EEVRKLALQALAKGEEY 126
           QHR + I+ N++ + +++AER++ + L+E+L+A+T +EG    ++VRKLA + L+K E++
Sbjct: 856 QHRGVCILHNLVHSKRDVAERLVGSSLLEVLLAVTQVEGAAASDKVRKLAQETLSKAEQW 915

Query: 127 GIIRRPGEGEE 137
            +I++  E +E
Sbjct: 916 KLIQKSSEQDE 926




Source: Ixodes scapularis

Species: Ixodes scapularis

Genus: Ixodes

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195451276|ref|XP_002072843.1| GK13474 [Drosophila willistoni] gi|194168928|gb|EDW83829.1| GK13474 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195111867|ref|XP_002000498.1| GI10261 [Drosophila mojavensis] gi|193917092|gb|EDW15959.1| GI10261 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|183979249|dbj|BAG30786.1| similar to CG2708-PA [Papilio xuthus] Back     alignment and taxonomy information
>gi|307188554|gb|EFN73289.1| UNC45-like protein A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242010879|ref|XP_002426185.1| heat shock protein 70 HSP70 interacting protein, putative [Pediculus humanus corporis] gi|212510236|gb|EEB13447.1| heat shock protein 70 HSP70 interacting protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195498581|ref|XP_002096584.1| GE24964 [Drosophila yakuba] gi|194182685|gb|EDW96296.1| GE24964 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195153186|ref|XP_002017510.1| GL21482 [Drosophila persimilis] gi|194112567|gb|EDW34610.1| GL21482 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|125777358|ref|XP_001359581.1| GA15439 [Drosophila pseudoobscura pseudoobscura] gi|54639329|gb|EAL28731.1| GA15439 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195055231|ref|XP_001994523.1| GH17296 [Drosophila grimshawi] gi|193892286|gb|EDV91152.1| GH17296 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
FB|FBgn0010812947 unc-45 [Drosophila melanogaste 0.586 0.085 0.376 7.8e-10
RGD|1305666735 Unc45b "unc-45 homolog B (C. e 0.528 0.099 0.386 3.7e-08
MGI|MGI:2443377931 Unc45b "unc-45 homolog B (C. e 0.528 0.078 0.373 1.7e-07
UNIPROTKB|F1NXC5953 UNC45B "Uncharacterized protei 0.405 0.058 0.431 2.3e-07
UNIPROTKB|F1MFZ5931 UNC45B "Uncharacterized protei 0.528 0.078 0.36 5.8e-07
UNIPROTKB|F1S166929 UNC45B "Uncharacterized protei 0.463 0.068 0.375 1.6e-06
UNIPROTKB|Q8IWX7931 UNC45B "Protein unc-45 homolog 0.463 0.068 0.375 1.6e-06
ZFIN|ZDB-GENE-050417-158935 unc45a "unc-45 homolog A (C. e 0.485 0.071 0.371 2e-06
UNIPROTKB|F1PUV3943 UNC45B "Uncharacterized protei 0.463 0.067 0.375 2.6e-06
RGD|1305357944 Unc45a "unc-45 homolog A (C. e 0.594 0.086 0.309 3.3e-06
FB|FBgn0010812 unc-45 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 154 (59.3 bits), Expect = 7.8e-10, P = 7.8e-10
 Identities = 32/85 (37%), Positives = 55/85 (64%)

Query:    41 SVSTPVCSMLLE-KNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELME 99
             SVS   C  +L   +W+DI   ++A+P   VQHR +VI+ N+++AG+E+A+++  T++ME
Sbjct:   831 SVSVKCCEKILAIASWLDILHTLIANPSPAVQHRGIVIILNMINAGEEIAKKLFETDIME 890

Query:   100 ILMALTLLEGE---EVRKLALQALA 121
             +L  L  L  +   + R++A Q LA
Sbjct:   891 LLSGLGQLPDDTRAKAREVATQCLA 915




GO:0061077 "chaperone-mediated protein folding" evidence=IDA
GO:0034605 "cellular response to heat" evidence=IDA
GO:0007525 "somatic muscle development" evidence=IMP
GO:0031034 "myosin filament assembly" evidence=IMP
RGD|1305666 Unc45b "unc-45 homolog B (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443377 Unc45b "unc-45 homolog B (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXC5 UNC45B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFZ5 UNC45B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S166 UNC45B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IWX7 UNC45B "Protein unc-45 homolog B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-158 unc45a "unc-45 homolog A (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUV3 UNC45B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1305357 Unc45a "unc-45 homolog A (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 8e-06
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
 Score = 41.9 bits (99), Expect = 8e-06
 Identities = 23/97 (23%), Positives = 42/97 (43%)

Query: 25  DTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSA 84
           D      AA AL+ L++ +      ++E   +    Q+L   D  V   AL  + N+ + 
Sbjct: 20  DENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKSEDEEVVKAALWALRNLAAG 79

Query: 85  GKELAERVLSTELMEILMALTLLEGEEVRKLALQALA 121
            ++    VL    +  L+ L     E+++K A  AL+
Sbjct: 80  PEDNKLIVLEAGGVPKLVNLLDSSNEDIQKNATGALS 116


An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
KOG4151|consensus748 99.82
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.58
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.16
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 96.93
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 96.62
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 96.41
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 94.91
KOG0166|consensus 514 94.71
KOG4224|consensus 550 94.63
KOG1048|consensus717 94.35
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.33
PF04826 254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 92.96
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 92.17
PRK09687280 putative lyase; Provisional 91.81
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 91.18
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 90.84
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 90.72
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 90.63
KOG0166|consensus 514 90.4
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 90.01
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 88.44
PF11701157 UNC45-central: Myosin-binding striated muscle asse 87.93
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 87.74
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 86.79
KOG4500|consensus 604 86.01
KOG4224|consensus 550 85.84
KOG1048|consensus 717 85.7
PF05804 708 KAP: Kinesin-associated protein (KAP) 85.61
KOG4199|consensus461 84.27
KOG2160|consensus342 83.03
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 82.69
PRK09687 280 putative lyase; Provisional 82.44
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 82.37
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 81.91
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 81.86
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 81.03
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 80.77
>KOG4151|consensus Back     alignment and domain information
Probab=99.82  E-value=8.6e-21  Score=174.74  Aligned_cols=125  Identities=36%  Similarity=0.519  Sum_probs=118.5

Q ss_pred             ccCCChhhhhhhhcCCCCHHHHHhhhhhhhhhccCCHHHHhhhhh-ccHHHHHHHHhcCCCcccchhhhhhhhhhhhcCh
Q psy4702           8 LFYCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLE-KNWVDIFKQILAHPDVGVQHRALVIVGNILSAGK   86 (138)
Q Consensus         8 ~~~n~RlklLvll~~eED~~tr~AA~GALAmLT~~~~~~c~~I~~-~~wleil~~L~~~~~~~lqHRG~viv~Nmi~a~~   86 (138)
                      ..+|+|+|+|.++++++|+++++|++||+|+.|++++.+|.++.. .+|.+++..+..|+++++||||+||+.||+.++.
T Consensus       623 ~e~~~~l~~w~~~~e~~~E~~~lA~a~a~a~I~sv~~n~c~~~~~~~~~~e~~~~~i~~~~~~~qhrgl~~~ln~~~~~~  702 (748)
T KOG4151|consen  623 VEYKDRLKLWNLNLEVADEKFELAGAGALAAITSVVENHCSRILELLEWLEILVRAIQDEDDEIQHRGLVIILNLFEALF  702 (748)
T ss_pred             hccccCchHHHHHHHhhhhHHhhhccccccchhhcchhhhhhHHHhhcchHHHHHhhcCchhhhhhhhhhhhhhHHHHHH
Confidence            345999999999999999999999999999888889999999777 9999999999999999999999999999999999


Q ss_pred             HHHHHHhhhhHHHHHHHhhccccHHHHHHHHHHHHHHHhCCCccCC
Q psy4702          87 ELAERVLSTELMEILMALTLLEGEEVRKLALQALAKGEEYGIIRRP  132 (138)
Q Consensus        87 e~a~kl~es~~leiL~~~~k~~~~~v~~~a~eaLk~~~~~glIk~~  132 (138)
                      ++++++++++.+++|....|.++.+..+.+..||.++.+||||+|+
T Consensus       703 ei~~~~~~~~~~~~l~~~~~~~~a~~~~~~~~~l~~a~~~~~~~~~  748 (748)
T KOG4151|consen  703 EIAEKIFETEVMELLSGLQKLNRAPKREDAAPCLSAAEEYGLIKPK  748 (748)
T ss_pred             HHHHHhccchHHHHHHHHHHhhhhhhhhhhhhHHHHHHHhhccCCC
Confidence            9999999999999999999995558899999999999999999985



>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
3now_A810 Unc-45 From Drosophila Melanogaster Length = 810 8e-11
>pdb|3NOW|A Chain A, Unc-45 From Drosophila Melanogaster Length = 810 Back     alignment and structure

Iteration: 1

Score = 62.4 bits (150), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 32/85 (37%), Positives = 55/85 (64%), Gaps = 4/85 (4%) Query: 41 SVSTPVCSMLLE-KNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLSTELME 99 SVS C +L +W+DI ++A+P VQHR +VI+ N+++AG+E+A+++ T++ME Sbjct: 694 SVSVKCCEKILAIASWLDILHTLIANPSPAVQHRGIVIILNMINAGEEIAKKLFETDIME 753 Query: 100 ILMALTLLEGE---EVRKLALQALA 121 +L L L + + R++A Q LA Sbjct: 754 LLSGLGQLPDDTRAKAREVATQCLA 778

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-23
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-08
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 7e-17
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-08
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 3e-08
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-08
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-07
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-05
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-04
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 7e-08
4db8_A 252 Armadillo-repeat protein; solenoid repeat, de novo 4e-05
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-05
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 7e-04
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-07
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-04
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 3e-07
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 1e-06
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 3e-04
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-06
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 6e-04
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-06
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-05
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 8e-04
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-05
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-05
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-04
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 7e-04
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 8e-05
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 5e-04
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
 Score = 93.8 bits (232), Expect = 2e-23
 Identities = 55/132 (41%), Positives = 82/132 (62%), Gaps = 4/132 (3%)

Query: 11  CSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLE-KNWVDIFKQILAHPDVG 69
             +V+FL LL  +ED ETA A AGALA++TSVS   C  +L   +W+DI   ++A+P   
Sbjct: 664 NDRVKFLALLCEDEDEETATACAGALAIITSVSVKCCEKILAIASWLDILHTLIANPSPA 723

Query: 70  VQHRALVIVGNILSAGKELAERVLSTELMEILMALTLLEG---EEVRKLALQALAKGEEY 126
           VQHR +VI+ N+++AG+E+A+++  T++ME+L  L  L      + R++A Q LA  E Y
Sbjct: 724 VQHRGIVIILNMINAGEEIAKKLFETDIMELLSGLGQLPDDTRAKAREVATQCLAAAERY 783

Query: 127 GIIRRPGEGEEE 138
            II R    E  
Sbjct: 784 RIIERSDNAEIP 795


>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.77
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.51
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.92
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.88
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.76
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.72
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 98.66
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 98.55
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 98.35
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 98.27
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 98.26
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.2
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.19
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 98.17
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 98.17
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 98.12
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.12
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 98.09
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 98.03
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 98.02
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 98.01
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 98.01
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 97.99
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 97.96
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 97.96
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 97.89
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 97.81
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 97.79
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 97.78
3nmz_A458 APC variant protein; protein-protein complex, arma 97.67
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 97.67
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 97.62
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 97.43
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 97.4
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 97.37
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 97.19
3nmz_A458 APC variant protein; protein-protein complex, arma 97.15
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 96.8
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 96.09
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 96.05
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 95.49
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 94.91
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 94.73
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 94.65
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 94.51
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 94.33
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 93.7
1oyz_A 280 Hypothetical protein YIBA; structural genomics, PS 92.99
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 92.81
3grl_A 651 General vesicular transport factor P115; vesicle t 92.62
3b2a_A 265 TON_1937, putative uncharacterized protein; heat-r 92.05
3dad_A 339 FH1/FH2 domain-containing protein 1; formin, FHOD1 90.95
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 90.58
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 90.36
2qk2_A 242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 90.35
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 90.18
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 89.68
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 89.2
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 89.18
1qgr_A 876 Protein (importin beta subunit); transport recepto 86.78
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 85.53
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 85.39
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 85.18
3grl_A 651 General vesicular transport factor P115; vesicle t 84.88
1qgr_A 876 Protein (importin beta subunit); transport recepto 83.89
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 83.65
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 81.52
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
Probab=99.77  E-value=3.3e-19  Score=164.39  Aligned_cols=127  Identities=43%  Similarity=0.714  Sum_probs=114.8

Q ss_pred             CCChhhhhhhhcCCCCHHHHHhhhhhhhhhccCCHHHHhhhhh-ccHHHHHHHHhcCCCcccchhhhhhhhhhhhcChHH
Q psy4702          10 YCSQVRFLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLE-KNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKEL   88 (138)
Q Consensus        10 ~n~RlklLvll~~eED~~tr~AA~GALAmLT~~~~~~c~~I~~-~~wleil~~L~~~~~~~lqHRG~viv~Nmi~a~~e~   88 (138)
                      +++++++|+.|.+.+|..++++|+|||++||+.++..++.|++ .+|++.|..|+.++++++|||++.++.|+..++++.
T Consensus       663 ~~g~l~~Lv~LL~s~d~~vq~~Aa~ALanLt~~s~~~~~~ii~~~g~I~~Lv~LL~s~d~~vq~~A~~aL~NL~~~s~e~  742 (810)
T 3now_A          663 NNDRVKFLALLCEDEDEETATACAGALAIITSVSVKCCEKILAIASWLDILHTLIANPSPAVQHRGIVIILNMINAGEEI  742 (810)
T ss_dssp             SSSHHHHHHHGGGCSSHHHHHHHHHHHHHHHHHCHHHHHHHHTSTTHHHHHHHHHTCSSHHHHHHHHHHHHHHHTTCHHH
T ss_pred             ccCcHHHHHHHhcCCCHHHHHHHHHHHHHHhCCCHHHHHHHHHHcCCHHHHHHHHCCCCHHHHHHHHHHHHHHHhCCHHH
Confidence            4689999999999999999999999999999866999999999 999999999999999999999999999999999999


Q ss_pred             HHHHhhhhHHHHHHHhhccc--cH-HHHHHHHHHHHHHHhCCCccCCCCCC
Q psy4702          89 AERVLSTELMEILMALTLLE--GE-EVRKLALQALAKGEEYGIIRRPGEGE  136 (138)
Q Consensus        89 a~kl~es~~leiL~~~~k~~--~~-~v~~~a~eaLk~~~~~glIk~~~~~~  136 (138)
                      ++++++.|++++|..+.+.+  ++ ++++.|.+||+.+++||+|+|+++.+
T Consensus       743 ~~~l~e~G~i~~L~~LL~~~d~~~~~i~e~Al~aL~~ll~~g~~~~~~~~~  793 (810)
T 3now_A          743 AKKLFETDIMELLSGLGQLPDDTRAKAREVATQCLAAAERYRIIERSDNAE  793 (810)
T ss_dssp             HHHHHTSTHHHHHTTSCCCTTSTTHHHHHHHHHHHHHHHHHHTC-------
T ss_pred             HHHHHHCCCHHHHHHHHhCcccCcHHHHHHHHHHHHHHHhCCCccCCCccc
Confidence            99999999999999999876  34 99999999999999999999998644



>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 138
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-05
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-04
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 0.001
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.6 bits (93), Expect = 2e-05
 Identities = 23/104 (22%), Positives = 37/104 (35%), Gaps = 2/104 (1%)

Query: 19  LLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIV 78
            +      E      GAL +L         ++   N + +F Q+L  P   +Q  A  ++
Sbjct: 426 FVEGVRMEEIVEGCTGALHILARDVHN-RIVIRGLNTIPLFVQLLYSPIENIQRVAAGVL 484

Query: 79  GNILSAGKELAERVLSTELMEILMALTLLEGEEVRKLALQALAK 122
              L+  KE AE + +      L  L     E V   A   L +
Sbjct: 485 CE-LAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFR 527


>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.52
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.17
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.17
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.17
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.99
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.89
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.83
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 97.75
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 96.45
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 94.47
d1b3ua_588 Constant regulatory domain of protein phosphatase 94.06
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 93.91
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 92.39
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 92.27
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 90.83
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 80.71
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 80.71
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Plakophilin 1 helical region
domain: Plakophilin 1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.65  E-value=5.3e-08  Score=72.47  Aligned_cols=111  Identities=12%  Similarity=0.017  Sum_probs=97.0

Q ss_pred             hhhhhcCCCCHHHHHhhhhhhhhhccCCHHHHhhhhhccHHHHHHHHhcCCCcccchhhhhhhhhhhhcChHHHHHHhhh
Q psy4702          16 FLFLLTCEEDTETACAAAGALAMLTSVSTPVCSMLLEKNWVDIFKQILAHPDVGVQHRALVIVGNILSAGKELAERVLST   95 (138)
Q Consensus        16 lLvll~~eED~~tr~AA~GALAmLT~~~~~~c~~I~~~~wleil~~L~~~~~~~lqHRG~viv~Nmi~a~~e~a~kl~es   95 (138)
                      .|+-|-+.+|+.++..|+++|.-|+.-++...+.|.+..+++.|..|+.++++++|..++-+++|+...+.+....+.+.
T Consensus         6 ~lv~~L~~~~~~~~~~a~~~l~~l~~~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~~~~~~~~i~~~   85 (457)
T d1xm9a1           6 KAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETRRQ   85 (457)
T ss_dssp             HHHHHHHSSCTHHHHHHHHHHHHHTSSCSSHHHHHHHTTHHHHHHHHTTSSCHHHHHHHHHHHHHHHSSCHHHHHHHHHT
T ss_pred             HHHHHhCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCcHHHHHHHHCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHC
Confidence            34555567889999999999999986568889999888899999999999999999999999999998888888999999


Q ss_pred             hHHHHHHHhhccccH-HHHHHHHHHHHHHHhC
Q psy4702          96 ELMEILMALTLLEGE-EVRKLALQALAKGEEY  126 (138)
Q Consensus        96 ~~leiL~~~~k~~~~-~v~~~a~eaLk~~~~~  126 (138)
                      |+++.|..+.+...+ .+...|..+|..+...
T Consensus        86 g~v~~li~~l~~~~~~~~~~~a~~~l~~l~~~  117 (457)
T d1xm9a1          86 NGIREAVSLLRRTGNAEIQKQLTGLLWNLSST  117 (457)
T ss_dssp             TCHHHHHHHHTTCCCHHHHHHHHHHHHHHHTS
T ss_pred             CChHHHHHHHhccCcHHHHHHHHHHHHHHHhh
Confidence            999999998877655 7888888888887653



>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure