Psyllid ID: psy4861


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MTKRYEEIYEDMVRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVRYKDAKGNEMYSYVQTGTLWR
ccccccccccccEEccccccEEccccccccccccEEEEEccccEEEEEEEEccccccccccccccEEEEEEEcccccccEEcccccccEEEEEEEcccEEc
ccccHHHHHHHHHccccccccccccccccccccEEEEEEccccEEEEEEEEccccccccccEHcEEEEEEEEcccccEEEEEEcccccEEEEEEccccEcc
MTKRYEEIYEDMVrtdynggawcpknqitteprEWIEINLHFVHVITAtgvqgrfgngqgaeftEAYLIDywrpklgkwvrykdakgnemYSYVQTGTLWR
MTKRYEEIYEDmvrtdynggawcPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVrykdakgnemysyvqtgtlwr
MTKRYEEIYEDMVRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVRYKDAKGNEMYSYVQTGTLWR
******EIYEDMVRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVRYKDAKGNEMYSYVQTGTL**
*********E**VRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVRYKDAKGNEMYSYVQTGTLW*
MTKRYEEIYEDMVRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVRYKDAKGNEMYSYVQTGTLWR
**KRYEEIYEDMVRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVRYKDAKGNEMYSYVQTGTLW*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKRYEEIYEDMVRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVRYKDAKGNEMYSYVQTGTLWR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query101 2.2.26 [Sep-21-2011]
Q16832 855 Discoidin domain-containi yes N/A 0.673 0.079 0.391 4e-09
Q7YR43 909 Epithelial discoidin doma no N/A 0.712 0.079 0.342 1e-08
Q08345 913 Epithelial discoidin doma no N/A 0.712 0.078 0.342 1e-08
Q63474 910 Epithelial discoidin doma yes N/A 0.712 0.079 0.342 2e-08
Q03146 911 Epithelial discoidin doma yes N/A 0.712 0.079 0.342 2e-08
Q62371 854 Discoidin domain-containi no N/A 0.673 0.079 0.364 5e-08
>sp|Q16832|DDR2_HUMAN Discoidin domain-containing receptor 2 OS=Homo sapiens GN=DDR2 PE=1 SV=2 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 20  GAWCPKNQITTEP---REWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKL 76
           GAWCP  +I  EP   +E+++I+LH +H IT  G QGR   G G EF   Y I+Y R   
Sbjct: 70  GAWCP--EIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGT 127

Query: 77  GKWVRYKDAKGNEM 90
            +W+ +++  G ++
Sbjct: 128 -RWISWRNRHGKQV 140




Tyrosine kinase that functions as cell surface receptor for fibrillar collagen and regulates cell differentiation, remodeling of the extracellular matrix, cell migration and cell proliferation. Required for normal bone development. Regulates osteoblast differentiation and chondrocyte maturation via a signaling pathway that involves MAP kinases and leads to the activation of the transcription factor RUNX2. Regulates remodeling of the extracellular matrix by up-regulation of the collagenases MMP1, MMP2 and MMP13, and thereby facilitates cell migration and tumor cell invasion. Promotes fibroblast migration and proliferation, and thereby contributes to cutaneous wound healing.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 0EC: .EC: 1
>sp|Q7YR43|DDR1_PANTR Epithelial discoidin domain-containing receptor 1 OS=Pan troglodytes GN=DDR1 PE=3 SV=1 Back     alignment and function description
>sp|Q08345|DDR1_HUMAN Epithelial discoidin domain-containing receptor 1 OS=Homo sapiens GN=DDR1 PE=1 SV=1 Back     alignment and function description
>sp|Q63474|DDR1_RAT Epithelial discoidin domain-containing receptor 1 OS=Rattus norvegicus GN=Ddr1 PE=2 SV=1 Back     alignment and function description
>sp|Q03146|DDR1_MOUSE Epithelial discoidin domain-containing receptor 1 OS=Mus musculus GN=Ddr1 PE=2 SV=2 Back     alignment and function description
>sp|Q62371|DDR2_MOUSE Discoidin domain-containing receptor 2 OS=Mus musculus GN=Ddr2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
383856443 631 PREDICTED: discoidin domain-containing r 0.772 0.123 0.717 7e-31
340716326 631 PREDICTED: discoidin domain-containing r 0.772 0.123 0.717 7e-31
350406219 631 PREDICTED: discoidin domain-containing r 0.772 0.123 0.717 8e-31
307196962 607 Discoidin domain-containing receptor 2 [ 0.792 0.131 0.725 1e-30
328789013 632 PREDICTED: discoidin domain-containing r 0.772 0.123 0.705 6e-30
345497425 958 PREDICTED: discoidin domain-containing r 0.811 0.085 0.646 7e-30
307171888 598 Discoidin domain-containing receptor 2 [ 0.772 0.130 0.692 6e-29
242022560 876 discoidin domain receptor, putative [Ped 0.772 0.089 0.705 1e-28
332026442 599 Discoidin domain-containing receptor 2 [ 0.772 0.130 0.679 3e-28
357631556 843 hypothetical protein KGM_15700 [Danaus p 0.732 0.087 0.716 9e-28
>gi|383856443|ref|XP_003703718.1| PREDICTED: discoidin domain-containing receptor 2-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 56/78 (71%), Positives = 70/78 (89%)

Query: 13  VRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYW 72
           +R + +GGAWCPK QITTEPREW+EI+LH VH+ITATG QGRFGNGQG E++EAY+++YW
Sbjct: 62  LRQESHGGAWCPKQQITTEPREWLEIDLHTVHMITATGTQGRFGNGQGVEYSEAYMLEYW 121

Query: 73  RPKLGKWVRYKDAKGNEM 90
           RPKLGKWVRY+D +G E+
Sbjct: 122 RPKLGKWVRYRDVRGEEV 139




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340716326|ref|XP_003396650.1| PREDICTED: discoidin domain-containing receptor 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350406219|ref|XP_003487696.1| PREDICTED: discoidin domain-containing receptor 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307196962|gb|EFN78337.1| Discoidin domain-containing receptor 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328789013|ref|XP_394686.4| PREDICTED: discoidin domain-containing receptor 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|345497425|ref|XP_001601637.2| PREDICTED: discoidin domain-containing receptor 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307171888|gb|EFN63530.1| Discoidin domain-containing receptor 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242022560|ref|XP_002431708.1| discoidin domain receptor, putative [Pediculus humanus corporis] gi|212517016|gb|EEB18970.1| discoidin domain receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332026442|gb|EGI66570.1| Discoidin domain-containing receptor 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357631556|gb|EHJ79026.1| hypothetical protein KGM_15700 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
FB|FBgn0085409 772 CG34380 [Drosophila melanogast 0.772 0.101 0.487 3.6e-19
FB|FBgn0053531 1064 Ddr "Discoidin domain receptor 0.722 0.068 0.506 3.4e-18
WB|WBGene00017381 797 ddr-2 [Caenorhabditis elegans 0.643 0.081 0.507 1.6e-14
WB|WBGene00016104 766 ddr-1 [Caenorhabditis elegans 0.742 0.097 0.421 2.8e-13
UNIPROTKB|Q5T244148 DDR2 "Discoidin domain-contain 0.673 0.459 0.391 2e-10
UNIPROTKB|A2ABL0147 DDR1 "Epithelial discoidin dom 0.712 0.489 0.342 5.2e-10
UNIPROTKB|A2ABL1166 DDR1 "Epithelial discoidin dom 0.712 0.433 0.342 5.2e-10
UNIPROTKB|A2ABL2209 DDR1 "Epithelial discoidin dom 0.712 0.344 0.342 5.2e-10
UNIPROTKB|E7EPN2170 DDR1 "Epithelial discoidin dom 0.712 0.423 0.342 5.2e-10
UNIPROTKB|E7ERI6153 DDR1 "Epithelial discoidin dom 0.712 0.470 0.342 5.2e-10
FB|FBgn0085409 CG34380 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 240 (89.5 bits), Expect = 3.6e-19, P = 3.6e-19
 Identities = 38/78 (48%), Positives = 59/78 (75%)

Query:    13 VRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYW 72
             ++TD +GGAWCPK+ ++   +E+++++L   HVITA   QGR+G GQG E+TEAY+++YW
Sbjct:   112 LKTDNDGGAWCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYW 171

Query:    73 RPKLGKWVRYKDAKGNEM 90
             RP   KW R+K+ +G E+
Sbjct:   172 RPGFDKWQRWKNIQGKEI 189




GO:0007165 "signal transduction" evidence=ISS
GO:0004716 "receptor signaling protein tyrosine kinase activity" evidence=ISS
GO:0007155 "cell adhesion" evidence=IEA
FB|FBgn0053531 Ddr "Discoidin domain receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00017381 ddr-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00016104 ddr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T244 DDR2 "Discoidin domain-containing receptor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A2ABL0 DDR1 "Epithelial discoidin domain-containing receptor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A2ABL1 DDR1 "Epithelial discoidin domain-containing receptor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A2ABL2 DDR1 "Epithelial discoidin domain-containing receptor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EPN2 DDR1 "Epithelial discoidin domain-containing receptor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ERI6 DDR1 "Epithelial discoidin domain-containing receptor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
cd00057143 cd00057, FA58C, Coagulation factor 5/8 C-terminal 5e-04
>gnl|CDD|238014 cd00057, FA58C, Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes Back     alignment and domain information
 Score = 36.6 bits (85), Expect = 5e-04
 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 5/75 (6%)

Query: 19  GGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGK 78
             AW P      +P +W++++L     +T    QGR   G  +E+  +Y + Y       
Sbjct: 34  DNAWTPAVN---DPPQWLQVDLGKTRRVTGIQTQGRK-GGGSSEWVTSYKVQY-SLDGET 88

Query: 79  WVRYKDAKGNEMYSY 93
           W  YKD    ++++ 
Sbjct: 89  WTTYKDKGEEKVFTG 103


Length = 143

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 101
KOG1094|consensus 807 99.89
smart00231139 FA58C Coagulation factor 5/8 C-terminal domain, di 99.87
cd00057143 FA58C Substituted updates: Jan 31, 2002 99.65
KOG3516|consensus 1306 99.52
PF00754129 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000 99.0
smart00607151 FTP eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domai 85.18
KOG4276|consensus113 84.65
>KOG1094|consensus Back     alignment and domain information
Probab=99.89  E-value=1.7e-23  Score=167.45  Aligned_cols=92  Identities=33%  Similarity=0.676  Sum_probs=87.6

Q ss_pred             CCcCcccccCCCCCceeeeCCCCCCCCCCeEEEecCCcEEEEEEEecCCcCCCCccceeeEEEEEEECCCCCCcEEEEcC
Q psy4861           6 EEIYEDMVRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVRYKDA   85 (101)
Q Consensus         6 ~~~~~aRL~~~~~~gAW~~~~~~~~d~~qwLQVDL~~~~~It~V~TQGr~~~~~~~~wVt~y~v~ys~dg~~~W~~y~~~   85 (101)
                      ..|++|||+.+.++|||||+.++.....+||||||...+.||.|.||||++.|++.||.+.|+|.|+++| ..|..|++.
T Consensus        51 t~~~~~rl~se~g~GAWCPk~~v~~~~~E~LQvdl~~~hlit~V~TQGR~~~G~G~Efa~~y~I~Y~Rpg-~~Wi~wk~r  129 (807)
T KOG1094|consen   51 TGPQHARLHSEDGSGAWCPKGQVNSKSKEYLQVDLQRLHLITSVETQGRHAGGLGKEFARAYKIRYSRPG-LRWISWKDR  129 (807)
T ss_pred             cccccccccccCCCcccCCCcccCccchhheEEeeeceEEEEEeeeccccCCCccceehhheeeeeccCc-chheeeccc
Confidence            4689999999999999999998877889999999999999999999999999999999999999999999 899999999


Q ss_pred             CCcEEEeCcCCCC
Q psy4861          86 KGNEMYSYVQTGT   98 (101)
Q Consensus        86 ~~~~vF~GN~d~~   98 (101)
                      .|.++..||.|-+
T Consensus       130 ~g~evi~gN~dt~  142 (807)
T KOG1094|consen  130 WGQEVIPGNEDTE  142 (807)
T ss_pred             cCceecCCCCCcc
Confidence            9999999999854



>smart00231 FA58C Coagulation factor 5/8 C-terminal domain, discoidin domain Back     alignment and domain information
>cd00057 FA58C Substituted updates: Jan 31, 2002 Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>PF00754 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000421 Blood coagulation factors V and VIII contain a C-terminal, twice repeated, domain of about 150 amino acids, which is called F5/8 type C, FA58C, or C1/C2- like domain Back     alignment and domain information
>smart00607 FTP eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domain Back     alignment and domain information
>KOG4276|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
2z4f_A173 Solution Structure Of The Discoidin Domain Of Ddr2 2e-09
2wuh_A178 Crystal Structure Of The Ddr2 Discoidin Domain Boun 2e-09
4ag4_A 351 Crystal Structure Of A Ddr1-Fab Complex Length = 35 4e-09
>pdb|2Z4F|A Chain A, Solution Structure Of The Discoidin Domain Of Ddr2 Length = 173 Back     alignment and structure

Iteration: 1

Score = 57.8 bits (138), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 6/74 (8%) Query: 20 GAWCPKNQITTEP---REWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKL 76 GAWCP +I EP +E+++I+LH +H IT G QGR G G EF Y I+Y R Sbjct: 49 GAWCP--EIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGT 106 Query: 77 GKWVRYKDAKGNEM 90 +W+ +++ G ++ Sbjct: 107 -RWISWRNRHGKQV 119
>pdb|2WUH|A Chain A, Crystal Structure Of The Ddr2 Discoidin Domain Bound To A Triple-Helical Collagen Peptide Length = 178 Back     alignment and structure
>pdb|4AG4|A Chain A, Crystal Structure Of A Ddr1-Fab Complex Length = 351 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
4ag4_A 351 Epithelial discoidin domain-containing receptor 1; 5e-14
2qqo_A460 Neuropilin-2; VEGF receptor, semaphorin receptor, 2e-13
2qqo_A 460 Neuropilin-2; VEGF receptor, semaphorin receptor, 6e-08
4deq_A218 Neuropilin-1, vascular endothelial growth factor; 4e-12
2r7e_B770 Coagulation factor VIII; ceruloplasmin fold, cuppe 2e-11
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 5e-06
2wuh_A178 Discoidin domain receptor 2; receptor-peptide comp 3e-11
1sdd_B647 Coagulation factor V; copper-binding protein, cofa 1e-10
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 1e-07
1czt_A160 Protein (coagulation factor V); membrane-binding, 2e-10
2qqi_A 318 Neuropilin-1; VEGF receptor, semaphorin receptor, 6e-10
2qqi_A318 Neuropilin-1; VEGF receptor, semaphorin receptor, 2e-07
2wn3_A 254 Discoidin-1 subunit A; type-H lectin, cell adhesio 8e-10
3hny_M159 Coagulation factor VIII; blood clotting, acute pha 1e-09
3bn6_A158 Lactadherin; anticoagulation, anti-coagulation, an 1e-09
2vm9_A 257 Discoidin-2, discoidin II; DDR, lectin, aggregatio 2e-09
2qqj_A 325 Neuropilin-2; VEGF receptor, semaphorin receptor, 1e-08
2qqj_A325 Neuropilin-2; VEGF receptor, semaphorin receptor, 2e-07
2qqk_A579 Neuropilin-2; VEGF receptor, semaphorin receptor, 4e-08
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 5e-07
2qqm_A450 Neuropilin-1; VEGF receptor, semaphorin receptor, 3e-06
>4ag4_A Epithelial discoidin domain-containing receptor 1; immune system-transferase complex; HET: NAG; 2.80A {Homo sapiens} Length = 351 Back     alignment and structure
 Score = 64.8 bits (157), Expect = 5e-14
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 14  RTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWR 73
            +    GAWCP   +  +  E+++++L  +H++   G QGR   G G EF+ +Y + Y R
Sbjct: 40  ESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR 99

Query: 74  PKLGKWVRYKDAKGNEMYS 92
               +W+ +KD  G E+ S
Sbjct: 100 D-GRRWMGWKDRWGQEVIS 117


>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Length = 460 Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Length = 460 Back     alignment and structure
>4deq_A Neuropilin-1, vascular endothelial growth factor; coagulation factor domain, heparin binding domain, angiogene protein binding-cytokine complex; 2.65A {Homo sapiens} PDB: 1kmx_A 1vgh_A 2vgh_A Length = 218 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Length = 770 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Length = 770 Back     alignment and structure
>2wuh_A Discoidin domain receptor 2; receptor-peptide complex, transferase, nucleotide-binding, tyrosine-protein kinase; 1.60A {Homo sapiens} PDB: 2z4f_A Length = 178 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 Back     alignment and structure
>1czt_A Protein (coagulation factor V); membrane-binding, discoidin family, calcium- independent, blood clotting; 1.87A {Homo sapiens} SCOP: b.18.1.2 PDB: 1czs_A 1czv_A Length = 160 Back     alignment and structure
>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Length = 318 Back     alignment and structure
>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Length = 318 Back     alignment and structure
>2wn3_A Discoidin-1 subunit A; type-H lectin, cell adhesion, discoidin domain, lectin; HET: NGA GAL 1PG; 1.59A {Dictyostelium discoideum} PDB: 2w94_A* 2wn2_A* 2w95_A* Length = 254 Back     alignment and structure
>3hny_M Coagulation factor VIII; blood clotting, acute phase, blood coagulation, calcium, DIS mutation, disulfide bond, glycoprotein, hemophilia; 1.07A {Homo sapiens} PDB: 3hnb_M 3hob_M 1d7p_M 1iqd_C 1cfg_A 1fac_A Length = 159 Back     alignment and structure
>3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A Length = 158 Back     alignment and structure
>2vm9_A Discoidin-2, discoidin II; DDR, lectin, aggregation, cell adhesion; 1.75A {Dictyostelium discoideum} PDB: 2vmc_A* 2vmd_A* 2vme_A* Length = 257 Back     alignment and structure
>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Length = 325 Back     alignment and structure
>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Length = 325 Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Length = 450 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
2wuh_A178 Discoidin domain receptor 2; receptor-peptide comp 99.96
3hny_M159 Coagulation factor VIII; blood clotting, acute pha 99.96
4ag4_A 351 Epithelial discoidin domain-containing receptor 1; 99.95
1czt_A160 Protein (coagulation factor V); membrane-binding, 99.95
4deq_A218 Neuropilin-1, vascular endothelial growth factor; 99.94
3bn6_A158 Lactadherin; anticoagulation, anti-coagulation, an 99.93
2vm9_A 257 Discoidin-2, discoidin II; DDR, lectin, aggregatio 99.93
4gz9_A 577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 99.92
2wn3_A 254 Discoidin-1 subunit A; type-H lectin, cell adhesio 99.91
2qqj_A 325 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.9
2qqi_A 318 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.88
4gz9_A577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 99.88
2qqj_A325 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.87
2qqo_A460 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.86
2qqm_A450 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.86
2r7e_B770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.86
1sdd_B647 Coagulation factor V; copper-binding protein, cofa 99.86
2qqi_A318 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.86
2qqo_A 460 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.85
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.85
2qqk_A579 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.85
2qqm_A 450 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.84
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.84
2w1s_A192 Hyaluronoglucosaminidase; hexosaminidase, family 3 99.84
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.8
2v72_A143 CBM32, EXO-alpha-sialidase; galactose, bacterial p 99.36
2j1a_A150 Hyaluronidase, CBM32; protein-carbohydrate interac 99.13
2jda_A145 Yecbm32; hypothetical protein, carbohydrate- bindi 99.01
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 98.88
4a41_A161 GH89_CBM32-5, alpha-N-acetylglucosaminidase family 98.86
3f2z_A159 Uncharacterized protein BF3579; the present C-term 98.79
4a42_A149 GH89_CBM32-4, alpha-N-acetylglucosaminidase family 98.79
3ggl_A169 Putative chitobiase; X-RAY, structure genomics, NE 98.74
3eyp_A469 Putative alpha-L-fucosidase; structural genomics, 98.61
2v5d_A737 O-GLCNACASE NAGJ; family 32 carbohydrate binding m 98.56
2zxq_A1376 Endo-alpha-N-acetylgalactosaminidase; broken TIM b 98.34
4a3z_A161 GH89_CBM32, alpha-N-acetylglucosaminidase family p 98.28
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.27
3ues_A478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 98.06
1w8o_A601 Bacterial sialidase; 3D-structure, glycosidase, hy 98.03
3lei_A153 Platelet aggregation factor SM-HPAF; lectin domain 97.92
4gwi_A153 Lectinolysin, platelet aggregation factor SM-HPAF; 97.37
3cqo_A293 FBP32; F-lectin, fucolectin, sugar binding protein 97.32
3hnm_A172 Putative chitobiase; PSI-2, protein structure init 97.25
2j1v_A151 Fucolectin-related protein; carbohydrate-binding p 97.17
3cqo_A 293 FBP32; F-lectin, fucolectin, sugar binding protein 97.05
1k12_A158 Lectin; beta barrel, protein carbohydrate complex, 97.02
2j22_A148 Fucolectin-related protein; carbohydrate-binding p 96.91
1tvg_A153 LOC51668 protein; cell cycle, structural genomics, 96.8
2cho_A716 Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro 96.74
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 96.08
2yc2_A139 IFT25, intraflagellar transport protein 25; transp 95.93
2yfu_A155 Carbohydrate binding family 6; sugar binding prote 89.87
3gza_A443 Putative alpha-L-fucosidase; NP_812709.1, structur 87.22
>2wuh_A Discoidin domain receptor 2; receptor-peptide complex, transferase, nucleotide-binding, tyrosine-protein kinase; 1.60A {Homo sapiens} PDB: 2z4f_A Back     alignment and structure
Probab=99.96  E-value=9.7e-30  Score=177.19  Aligned_cols=94  Identities=28%  Similarity=0.625  Sum_probs=80.7

Q ss_pred             CCCCcCcccccCCCCCceeeeCCCCCCCC-CCeEEEecCCcEEEEEEEecCCcCCCCccceeeEEEEEEECCCCCCcEEE
Q psy4861           4 RYEEIYEDMVRTDYNGGAWCPKNQITTEP-REWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVRY   82 (101)
Q Consensus         4 ~y~~~~~aRL~~~~~~gAW~~~~~~~~d~-~qwLQVDL~~~~~It~V~TQGr~~~~~~~~wVt~y~v~ys~dg~~~W~~y   82 (101)
                      ..+.|++|||+.....+||||+.....|. .|||||||++++.|++|+||||.+.+...+||++|+|+||.|| .+|..|
T Consensus        42 ~~~~p~~aRL~~~~~~~aW~a~~~~~~d~~~qWLQVDLg~~~~VtgV~tQG~~~~~~~~~~vt~Y~l~yS~Dg-~~W~~y  120 (178)
T 2wuh_A           42 ESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDG-TRWISW  120 (178)
T ss_dssp             GGGSGGGCBTTCCSTTSSBCCSSCBBTTBCCCCEEEEEEEEEEEEEEEEECCCGGGTCCCCCSEEEEEEESSS-SSCEEC
T ss_pred             cccChhhheecCCCCCCeecCCcCCCCCCCCCEEEEecCCceEEeEEEEecccCCCCccceeEEEEEEEEcCC-CcEEEE
Confidence            35689999999877789999995321245 8999999999999999999999764334689999999999999 999999


Q ss_pred             EcCCCcEEEeCcCCCC
Q psy4861          83 KDAKGNEMYSYVQTGT   98 (101)
Q Consensus        83 ~~~~~~~vF~GN~d~~   98 (101)
                      ++..+.+||.||.|..
T Consensus       121 ~~~~~~kvF~GN~D~~  136 (178)
T 2wuh_A          121 RNRHGKQVLDGNSNPY  136 (178)
T ss_dssp             CCTTSCCCEECCSSSS
T ss_pred             ecCCccccccccCCCC
Confidence            9988889999999974



>3hny_M Coagulation factor VIII; blood clotting, acute phase, blood coagulation, calcium, DIS mutation, disulfide bond, glycoprotein, hemophilia; 1.07A {Homo sapiens} SCOP: b.18.1.2 PDB: 3hnb_M 3hob_M 1d7p_M 1iqd_C 1cfg_A 1fac_A Back     alignment and structure
>4ag4_A Epithelial discoidin domain-containing receptor 1; immune system-transferase complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1czt_A Protein (coagulation factor V); membrane-binding, discoidin family, calcium- independent, blood clotting; 1.87A {Homo sapiens} SCOP: b.18.1.2 PDB: 1czs_A 1czv_A Back     alignment and structure
>4deq_A Neuropilin-1, vascular endothelial growth factor; coagulation factor domain, heparin binding domain, angiogene protein binding-cytokine complex; 2.65A {Homo sapiens} PDB: 1kmx_A 1vgh_A 2vgh_A Back     alignment and structure
>3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A Back     alignment and structure
>2vm9_A Discoidin-2, discoidin II; DDR, lectin, aggregation, cell adhesion; 1.75A {Dictyostelium discoideum} PDB: 2vmc_A* 2vmd_A* 2vme_A* Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>2wn3_A Discoidin-1 subunit A; type-H lectin, cell adhesion, discoidin domain, lectin; HET: NGA GAL 1PG; 1.59A {Dictyostelium discoideum} PDB: 2w94_A* 2wn2_A* 2w95_A* Back     alignment and structure
>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Back     alignment and structure
>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2w1s_A Hyaluronoglucosaminidase; hexosaminidase, family 32 carbohydrate binding module, toxin, secreted, virulence, hydrolase, glycosidase; HET: MSE BTB; 1.45A {Clostridium perfringens} PDB: 2w1q_A* 2w1u_A* 2wdb_A* Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2v72_A CBM32, EXO-alpha-sialidase; galactose, bacterial pathogen, carbohydrate-binding module, sugar-binding protein; HET: GAL; 2.25A {Clostridium perfringens} Back     alignment and structure
>2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* Back     alignment and structure
>2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Back     alignment and structure
>4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* Back     alignment and structure
>3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A Back     alignment and structure
>4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} Back     alignment and structure
>3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Back     alignment and structure
>2zxq_A Endo-alpha-N-acetylgalactosaminidase; broken TIM barrel, glycosidase, hydrolase; 2.00A {Bifidobacterium longum} Back     alignment and structure
>4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>1w8o_A Bacterial sialidase; 3D-structure, glycosidase, hydrolase, beta- propeller; HET: LBT CIT; 1.70A {Micromonospora viridifaciens} SCOP: b.1.18.2 b.18.1.1 b.68.1.1 PDB: 1w8n_A* 1eut_A 1euu_A* 1wcq_A* 2bzd_A* 2ber_A* 1eur_A 1eus_A* Back     alignment and structure
>3lei_A Platelet aggregation factor SM-HPAF; lectin domain of lectinolysin, fucose, blood clotting, nicke; HET: FUC; 1.90A {Streptococcus mitis} PDB: 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>4gwi_A Lectinolysin, platelet aggregation factor SM-HPAF; cholesterol-dependent cytolysins, lewis antigens, F-type LEC glycan binding; HET: BDZ; 1.60A {Streptococcus mitis} PDB: 4gwj_A* 3lei_A* 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Back     alignment and structure
>3hnm_A Putative chitobiase; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, BTR319D.BT_411; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2j1v_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; HET: NAG GAL FUC; 1.45A {Streptococcus pneumoniae} PDB: 2j1r_A* 2j1t_A* 2j1u_A* 2j1s_A* Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Back     alignment and structure
>1k12_A Lectin; beta barrel, protein carbohydrate complex, sugar binding protein; HET: FUC; 1.90A {Anguilla anguilla} SCOP: b.18.1.15 Back     alignment and structure
>2j22_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; 1.8A {Streptococcus pneumoniae} Back     alignment and structure
>1tvg_A LOC51668 protein; cell cycle, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Homo sapiens} SCOP: b.18.1.9 PDB: 1xpw_A Back     alignment and structure
>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Back     alignment and structure
>2yc2_A IFT25, intraflagellar transport protein 25; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_A Back     alignment and structure
>2yfu_A Carbohydrate binding family 6; sugar binding protein; 1.65A {Clostridium thermocellum} PDB: 2y8j_A* 2y9i_A* 2y9s_A 2yb7_A* 2y8m_A 2yfz_A* 2yg0_A* Back     alignment and structure
>3gza_A Putative alpha-L-fucosidase; NP_812709.1, structural genomic center for structural genomics, JCSG; HET: MSE EPE; 1.60A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 101
d2qqia2155 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Hu 0.001
>d2qqia2 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure

class: All beta proteins
fold: Galactose-binding domain-like
superfamily: Galactose-binding domain-like
family: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain)
domain: B1 domain of neuropilin-1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 33.7 bits (76), Expect = 0.001
 Identities = 16/78 (20%), Positives = 28/78 (35%), Gaps = 3/78 (3%)

Query: 14  RTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWR 73
           R +Y    W P        REWI+++L  +  +TA G QG        ++          
Sbjct: 35  RLNYPENGWTP---GEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVS 91

Query: 74  PKLGKWVRYKDAKGNEMY 91
                W+  K+     ++
Sbjct: 92  SNGEDWITIKEGNKPVLF 109


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
d1d7pm_159 C2 domain of factor VIII {Human (Homo sapiens) [Ta 99.94
d1czsa_160 C2 domain of factor V {Human (Homo sapiens) [TaxId 99.94
d1sddb3162 C2 domain of factor V {Cow (Bos taurus) [TaxId: 99 99.94
d2qqia2155 B1 domain of neuropilin-1 {Human (Homo sapiens) [T 99.91
d2qqia1156 C2 domain of factor VIII {Human (Homo sapiens) [Ta 99.89
d1w8oa2142 Sialidase, C-terminal domain {Micromonospora virid 98.32
d1k3ia2162 Galactose oxidase, N-terminal domain {Fungi (Fusar 98.12
d1k12a_158 Fucose binding lectin {European eel (Anguilla angu 97.95
d1tvga_136 Placental protein 25, pp25 {Human (Homo sapiens) [ 97.54
d1jhja_161 APC10/DOC1 subunit of the anaphase-promoting compl 97.1
d1gqpa_194 APC10/DOC1 subunit of the anaphase-promoting compl 95.93
>d1d7pm_ b.18.1.2 (M:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Galactose-binding domain-like
superfamily: Galactose-binding domain-like
family: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain)
domain: C2 domain of factor VIII
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=3.6e-28  Score=164.08  Aligned_cols=89  Identities=15%  Similarity=0.286  Sum_probs=78.6

Q ss_pred             CCcCcccccCCCCCceeeeCCCCCCCCCCeEEEecCCcEEEEEEEecCCcCCCCccceeeEEEEEEECCCCCCcEEEEcC
Q psy4861           6 EEIYEDMVRTDYNGGAWCPKNQITTEPREWIEINLHFVHVITATGVQGRFGNGQGAEFTEAYLIDYWRPKLGKWVRYKDA   85 (101)
Q Consensus         6 ~~~~~aRL~~~~~~gAW~~~~~~~~d~~qwLQVDL~~~~~It~V~TQGr~~~~~~~~wVt~y~v~ys~dg~~~W~~y~~~   85 (101)
                      +.|++||||.....+||||+.   ++.+|||||||++++.|++|+|||+.+. ...+||++|+|+||.|+ ..|..|++.
T Consensus        33 ~~p~~aRLn~~~~~~aW~p~~---~d~~~wlqvDl~~~~~vtgi~tqG~~~~-~~~~~v~~y~l~yS~dg-~~w~~y~~~  107 (159)
T d1d7pm_          33 WSPSKARLHLQGRSNAWRPQV---NNPKEWLQVDFQKTMKVTGVTTQGVKSL-LTSMYVKEFLISSSQDG-HQWTLFFQN  107 (159)
T ss_dssp             ECGGGCBTTCCSTTCSBCCSS---CCTTCCEEEEEEEEEEEEEEEEECEEET-TEEEEEEEEEEEEESSS-SSCEECEET
T ss_pred             cChhheEeCCCCCCCcccCCc---CCcceeEEccCCcceEEEEEEecccCCC-CcceeEEEEEEEEecCC-CeEEEEecC
Confidence            468999999887889999996   4789999999999999999999998543 23579999999999999 999999987


Q ss_pred             CCcEEEeCcCCCCc
Q psy4861          86 KGNEMYSYVQTGTL   99 (101)
Q Consensus        86 ~~~~vF~GN~d~~~   99 (101)
                      .+.+||.||.|+..
T Consensus       108 ~~~~vF~gn~d~~~  121 (159)
T d1d7pm_         108 GKVKVFQGNQDSFT  121 (159)
T ss_dssp             TEECCEECCSSSSC
T ss_pred             CceEEEeeecCCCc
Confidence            77889999999763



>d1czsa_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sddb3 b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qqia2 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qqia1 b.18.1.2 (A:431-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
>d1k12a_ b.18.1.15 (A:) Fucose binding lectin {European eel (Anguilla anguilla) [TaxId: 7936]} Back     information, alignment and structure
>d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhja_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure