Psyllid ID: psy4868

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MDYLEKPLETKRFNTTDKIELDGLGSDETCTTIGDNSNPGSNLEPEDDQARLRLKRKLQRNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNQRQRGSADPTQAPNNNNNNIVNNNNNSSDGCTPSPAPQVSMDPTDFNR
cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccccEEEEHHccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccc
mdylekpletkrfnttdkieldglgsdetcttigdnsnpgsnlepeDDQARLRLKRKLQRNRTSFTNDQIDNLEKEferthypdvfARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNqrqrgsadptqapnnnnnnivnnnnnssdgctpspapqvsmdptdfnr
mdylekpletkrfnttdkieldglgsDETCttigdnsnpgsnlepedDQARLRLKRklqrnrtsftndqidnlekeferthypDVFARERLAAkiglpeariqvwfsnrrakwrreeklrnqrqrgsadptqapnnnnNNIVNNNNNssdgctpspapqvsmdptdfnr
MDYLEKPLETKRFNTTDKIELDGLGSDETCTTIGDNSNPGSNLEPEDDQArlrlkrklQRNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNQRQRGSADPTQAPnnnnnnivnnnnnSSDGCTPSPAPQVSMDPTDFNR
****************************************************************************FERTHYPDVFARERLAAKIGLPEARIQVWFSNRRA**********************************************************
***************************************************************SFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAK*********************************************************
MDYLEKPLETKRFNTTDKIELDGLGSDETCTTIGDNSNPGSNLEPEDDQARLRLKRKLQRNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWR****************TQAPNNNNNNIVNNNNNSSDGCTPSPAPQVSMDPTDFNR
************************************************************NRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREE****************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYLEKPLETKRFNTTDKIELDGLGSDETCTTIGDNSNPGSNLEPEDDQARLRLKRKLQRNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNQRQRGSADPTQAPNNNNNNIVNNNNNSSDGCTPSPAPQVSMDPTDFNR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
O18381 857 Paired box protein Pax-6 yes N/A 0.633 0.124 0.834 2e-41
P55864 422 Paired box protein Pax-6 N/A N/A 0.603 0.241 0.75 3e-37
Q1LZF1 422 Paired box protein Pax-6 yes N/A 0.597 0.239 0.757 8e-37
P63015 422 Paired box protein Pax-6 yes N/A 0.597 0.239 0.757 8e-37
P26367 422 Paired box protein Pax-6 yes N/A 0.597 0.239 0.757 8e-37
P63016 422 Paired box protein Pax-6 yes N/A 0.597 0.239 0.757 9e-37
P47238416 Paired box protein Pax-6 N/A N/A 0.597 0.242 0.757 1e-36
P47237216 Paired box protein Pax-6 no N/A 0.532 0.416 0.788 2e-36
P26630437 Paired box protein Pax-6 yes N/A 0.550 0.212 0.789 4e-35
O73917437 Paired box protein Pax-6 N/A N/A 0.573 0.221 0.715 4e-35
>sp|O18381|PAX6_DROME Paired box protein Pax-6 OS=Drosophila melanogaster GN=ey PE=2 SV=3 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 91/109 (83%), Positives = 96/109 (88%), Gaps = 2/109 (1%)

Query: 18  KIELDGLGSDETCTTIGDNSNPG-SNL-EPEDDQARLRLKRKLQRNRTSFTNDQIDNLEK 75
           K ELDG  SDET +  G+NSN G SN+   EDDQARL LKRKLQRNRTSFTNDQID+LEK
Sbjct: 388 KKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEK 447

Query: 76  EFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNQRQ 124
           EFERTHYPDVFARERLA KIGLPEARIQVWFSNRRAKWRREEKLRNQR+
Sbjct: 448 EFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRR 496
Involved in eye morphogenesis.
Drosophila melanogaster (taxid: 7227)
>sp|P55864|PAX6_XENLA Paired box protein Pax-6 OS=Xenopus laevis GN=pax6 PE=2 SV=1 Back     alignment and function description
>sp|Q1LZF1|PAX6_BOVIN Paired box protein Pax-6 OS=Bos taurus GN=PAX6 PE=2 SV=1 Back     alignment and function description
>sp|P63015|PAX6_MOUSE Paired box protein Pax-6 OS=Mus musculus GN=Pax6 PE=1 SV=1 Back     alignment and function description
>sp|P26367|PAX6_HUMAN Paired box protein Pax-6 OS=Homo sapiens GN=PAX6 PE=1 SV=2 Back     alignment and function description
>sp|P63016|PAX6_RAT Paired box protein Pax-6 OS=Rattus norvegicus GN=Pax6 PE=2 SV=1 Back     alignment and function description
>sp|P47238|PAX6_COTJA Paired box protein Pax-6 OS=Coturnix coturnix japonica GN=PAX6 PE=2 SV=1 Back     alignment and function description
>sp|P47237|PAX6_CHICK Paired box protein Pax-6 (Fragment) OS=Gallus gallus GN=PAX6 PE=1 SV=1 Back     alignment and function description
>sp|P26630|PAX6_DANRE Paired box protein Pax-6 OS=Danio rerio GN=pax6a PE=2 SV=1 Back     alignment and function description
>sp|O73917|PAX6_ORYLA Paired box protein Pax-6 OS=Oryzias latipes GN=pax6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
270006446 453 eyeless [Tribolium castaneum] 0.668 0.249 0.818 2e-46
160333791 453 eyeless [Tribolium castaneum] gi|1581876 0.668 0.249 0.818 2e-46
328719785 594 PREDICTED: paired box protein Pax-6-like 0.715 0.203 0.7 6e-44
328719783 613 PREDICTED: paired box protein Pax-6-like 0.715 0.197 0.7 7e-44
242009922 293 Homeobox protein orthopedia, putative [P 0.621 0.358 0.831 8e-43
194768292 900 GF22818 [Drosophila ananassae] gi|190618 0.627 0.117 0.842 1e-42
195064323 797 GH24002 [Drosophila grimshawi] gi|193892 0.633 0.134 0.834 1e-42
340728299 826 PREDICTED: paired box protein Pax-6-like 0.621 0.127 0.773 1e-40
263359659 909 hypothetical protein DVIR88_6g0032 [Dros 0.633 0.117 0.844 2e-40
195402299 906 eyeless [Drosophila virilis] gi|19415595 0.633 0.118 0.844 2e-40
>gi|270006446|gb|EFA02894.1| eyeless [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/116 (81%), Positives = 104/116 (89%), Gaps = 3/116 (2%)

Query: 20  ELDGLGSDETCTTIGDNSNPGSNLEPEDDQARLRLKRKLQRNRTSFTNDQIDNLEKEFER 79
           +LDG+ SDET +  GDNSN GS++ P+DDQARLRLKRKLQRNRTSFTNDQID+LEKEFER
Sbjct: 200 DLDGINSDETNS--GDNSNAGSSIGPDDDQARLRLKRKLQRNRTSFTNDQIDSLEKEFER 257

Query: 80  THYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNQRQRGSADPTQAPN 135
           THYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNQR RG+  P + P 
Sbjct: 258 THYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNQR-RGAPAPAEHPG 312

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|160333791|ref|NP_001103907.1| eyeless [Tribolium castaneum] gi|158187657|gb|ABW23132.1| eyeless [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328719785|ref|XP_003246859.1| PREDICTED: paired box protein Pax-6-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328719783|ref|XP_003246858.1| PREDICTED: paired box protein Pax-6-like isoform 1 [Acyrthosiphon pisum] gi|328719787|ref|XP_003246860.1| PREDICTED: paired box protein Pax-6-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242009922|ref|XP_002425731.1| Homeobox protein orthopedia, putative [Pediculus humanus corporis] gi|212509632|gb|EEB12993.1| Homeobox protein orthopedia, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|194768292|ref|XP_001966246.1| GF22818 [Drosophila ananassae] gi|190618548|gb|EDV34072.1| GF22818 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195064323|ref|XP_001996545.1| GH24002 [Drosophila grimshawi] gi|193892091|gb|EDV90957.1| GH24002 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|340728299|ref|XP_003402463.1| PREDICTED: paired box protein Pax-6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|263359659|gb|ACY70495.1| hypothetical protein DVIR88_6g0032 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195402299|ref|XP_002059744.1| eyeless [Drosophila virilis] gi|194155958|gb|EDW71142.1| eyeless [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
FB|FBgn0005558 857 ey "eyeless" [Drosophila melan 0.633 0.124 0.770 8.2e-37
UNIPROTKB|E1BXC6 286 PAX6 "Paired box protein Pax-6 0.597 0.353 0.689 1.3e-31
UNIPROTKB|F1NF66 422 PAX6 "Paired box protein Pax-6 0.597 0.239 0.689 1.3e-31
UNIPROTKB|F1NXF3 436 PAX6 "Paired box protein Pax-6 0.597 0.231 0.689 1.3e-31
UNIPROTKB|Q1LZF1 422 PAX6 "Paired box protein Pax-6 0.597 0.239 0.689 1.3e-31
UNIPROTKB|G3V3Q9 377 PAX6 "Paired box protein Pax-6 0.597 0.267 0.689 1.3e-31
UNIPROTKB|G3V4M3 302 PAX6 "Paired box protein Pax-6 0.597 0.334 0.689 1.3e-31
UNIPROTKB|G3V4N4 286 PAX6 "Paired box gene 6 (Aniri 0.597 0.353 0.689 1.3e-31
UNIPROTKB|G3V5W7162 PAX6 "Paired box protein Pax-6 0.597 0.623 0.689 1.3e-31
UNIPROTKB|P26367 422 PAX6 "Paired box protein Pax-6 0.597 0.239 0.689 1.3e-31
FB|FBgn0005558 ey "eyeless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 405 (147.6 bits), Expect = 8.2e-37, P = 8.2e-37
 Identities = 84/109 (77%), Positives = 89/109 (81%)

Query:    18 KIELDGLGSDETCTTIGDNSNPG-SNL-EPEDDQAXXXXXXXXQRNRTSFTNDQIDNLEK 75
             K ELDG  SDET +  G+NSN G SN+   EDDQA        QRNRTSFTNDQID+LEK
Sbjct:   388 KKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEK 447

Query:    76 EFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNQRQ 124
             EFERTHYPDVFARERLA KIGLPEARIQVWFSNRRAKWRREEKLRNQR+
Sbjct:   448 EFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRR 496
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;TAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0005667 "transcription factor complex" evidence=ISS
GO:0005634 "nucleus" evidence=NAS;TAS
GO:0007455 "eye-antennal disc morphogenesis" evidence=TAS
GO:0016319 "mushroom body development" evidence=IEP;IMP
GO:0048749 "compound eye development" evidence=IMP;NAS;TAS
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0007628 "adult walking behavior" evidence=IMP
GO:0007420 "brain development" evidence=IMP
GO:0008347 "glial cell migration" evidence=IMP
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP;IDA
GO:0043704 "photoreceptor cell fate specification" evidence=IMP
GO:0043565 "sequence-specific DNA binding" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0040018 "positive regulation of multicellular organism growth" evidence=IMP
GO:0030182 "neuron differentiation" evidence=IMP
GO:0043567 "regulation of insulin-like growth factor receptor signaling pathway" evidence=IMP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0048036 "central complex development" evidence=IMP
GO:0048854 "brain morphogenesis" evidence=IMP
UNIPROTKB|E1BXC6 PAX6 "Paired box protein Pax-6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NF66 PAX6 "Paired box protein Pax-6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXF3 PAX6 "Paired box protein Pax-6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZF1 PAX6 "Paired box protein Pax-6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3V3Q9 PAX6 "Paired box protein Pax-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V4M3 PAX6 "Paired box protein Pax-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V4N4 PAX6 "Paired box gene 6 (Aniridia, keratitis), isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V5W7 PAX6 "Paired box protein Pax-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P26367 PAX6 "Paired box protein Pax-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O18381PAX6_DROMENo assigned EC number0.83480.63310.1248yesN/A
P63016PAX6_RATNo assigned EC number0.75720.59760.2393yesN/A
P63015PAX6_MOUSENo assigned EC number0.75720.59760.2393yesN/A
Q1LZF1PAX6_BOVINNo assigned EC number0.75720.59760.2393yesN/A
P26367PAX6_HUMANNo assigned EC number0.75720.59760.2393yesN/A
P26630PAX6_DANRENo assigned EC number0.78940.55020.2128yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
pfam0004657 pfam00046, Homeobox, Homeobox domain 3e-25
smart0038957 smart00389, HOX, Homeodomain 1e-21
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-21
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-09
pfam10037417 pfam10037, MRP-S27, Mitochondrial 28S ribosomal pr 0.003
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 91.4 bits (228), Expect = 3e-25
 Identities = 32/56 (57%), Positives = 42/56 (75%)

Query: 60  RNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRR 115
           R RT+FT +Q++ LEKEFE+  YP    RE LA K+GL E +++VWF NRRAKW+R
Sbjct: 2   RKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|220535 pfam10037, MRP-S27, Mitochondrial 28S ribosomal protein S27 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
KOG0484|consensus125 99.86
KOG0485|consensus268 99.81
KOG0489|consensus261 99.81
KOG0850|consensus245 99.81
KOG0488|consensus309 99.8
KOG0842|consensus307 99.79
KOG0487|consensus308 99.79
KOG2251|consensus228 99.76
KOG0843|consensus197 99.76
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.74
KOG0492|consensus246 99.72
KOG0494|consensus332 99.71
KOG0848|consensus317 99.71
KOG0491|consensus194 99.69
KOG0493|consensus342 99.67
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.62
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.62
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.61
KOG0844|consensus 408 99.61
KOG0486|consensus 351 99.58
KOG3802|consensus398 99.57
KOG0483|consensus198 99.56
COG5576156 Homeodomain-containing transcription factor [Trans 99.55
KOG0847|consensus288 99.47
KOG4577|consensus 383 99.45
KOG0490|consensus235 99.32
KOG0775|consensus304 99.21
KOG0849|consensus354 99.18
KOG1168|consensus385 99.14
KOG0774|consensus334 98.98
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.7
KOG2252|consensus558 98.52
KOG0490|consensus235 98.23
KOG1146|consensus 1406 97.81
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.54
KOG0773|consensus342 96.89
KOG3623|consensus 1007 96.58
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 95.79
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 90.31
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 87.61
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 84.26
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 83.43
PRK03975141 tfx putative transcriptional regulator; Provisiona 81.49
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 81.43
>KOG0484|consensus Back     alignment and domain information 
Probab=99.86  E-value=1.7e-21  Score=133.47  Aligned_cols=70  Identities=53%  Similarity=0.905  Sum_probs=66.1

Q ss_pred             hhhhccCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCchhHhhhhhhhHHHHHHHHHHHHHh
Q psy4868          54 LKRKLQRNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNQR  123 (169)
Q Consensus        54 ~~~k~rr~Rt~~t~~q~~~Le~~F~~~~~p~~~~~~~La~~l~l~~~qV~~WFqNrR~k~kk~~~~~~~~  123 (169)
                      .++|+||-||.|+..||..||+.|...+||++-.|++||..+.|++..|+|||||||+|+||+++.....
T Consensus        13 ekrKQRRIRTTFTS~QLkELErvF~ETHYPDIYTREEiA~kidLTEARVQVWFQNRRAKfRKQEr~a~~~   82 (125)
T KOG0484|consen   13 EKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREEIALKIDLTEARVQVWFQNRRAKFRKQERAAIAK   82 (125)
T ss_pred             HHHHhhhhhhhhhHHHHHHHHHHHHhhcCCcchhHHHHHHhhhhhHHHHHHHHHhhHHHHHHHHHHHHHH
Confidence            4788999999999999999999999999999999999999999999999999999999999998876553

>KOG0485|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 5e-30
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 8e-21
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 3e-20
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 1e-19
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 4e-19
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 1e-17
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 4e-15
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 6e-15
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 8e-14
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 1e-13
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 1e-12
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 7e-10
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 1e-08
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 3e-08
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 4e-08
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 1e-07
2dmq_A80 Solution Structure Of The Homeobox Domain Of LimHOM 1e-07
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 1e-07
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 2e-07
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 2e-07
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 3e-07
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 3e-07
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 3e-07
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 3e-07
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 5e-07
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 6e-07
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 8e-07
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 1e-06
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 2e-06
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 2e-06
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 4e-06
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 4e-06
1hom_A68 Determination Of The Three-Dimensional Structure Of 5e-06
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 5e-06
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 6e-06
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 1e-05
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 1e-05
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 2e-05
1uhs_A72 Solution Structure Of Mouse Homeodomain-Only Protei 3e-05
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 3e-05
2hi3_A73 Solution Structure Of The Homeodomain-Only Protein 4e-05
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 8e-05
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 7e-04
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 7e-04
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure 
Iteration: 1

 Score =  126 bits (317), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 60/66 (90%), Positives = 63/66 (95%)
Query: 59  QRNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEK 118
           QRNRTSFT +QI+ LEKEFERTHYPDVFARERLAAKI LPEARIQVWFSNRRAKWRREEK
Sbjct: 8   QRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 67
Query: 119 LRNQRQ 124
           LRNQR+
Sbjct: 68  LRNQRR 73
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure
>pdb|1UHS|A Chain A, Solution Structure Of Mouse Homeodomain-Only Protein Hop Length = 72 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|2HI3|A Chain A, Solution Structure Of The Homeodomain-Only Protein Hop Length = 73 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 6e-40
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 9e-39
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-37
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-36
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-36
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 8e-36
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 1e-35
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 6e-35
1uhs_A72 HOP, homeodomain only protein; structural genomics 3e-34
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-33
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 1e-32
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 8e-31
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 3e-28
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-26
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-25
3d1n_I151 POU domain, class 6, transcription factor 1; prote 6e-23
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 4e-21
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-20
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-20
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-20
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 3e-20
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 6e-18
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-17
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-16
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 5e-16
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 8e-16
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 9e-16
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-15
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-15
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-15
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 3e-15
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 3e-15
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 4e-15
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 5e-15
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 6e-15
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 7e-15
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 8e-15
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 8e-15
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-14
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 9e-14
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-13
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-13
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 2e-13
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 4e-13
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 9e-13
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-12
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 1e-12
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 9e-12
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-11
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 2e-11
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 2e-11
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 3e-11
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 5e-11
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 9e-11
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 2e-10
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-09
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 4e-08
2e19_A64 Transcription factor 8; homeobox domain, structura 8e-06
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 2e-05
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 9e-05
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
 Score =  129 bits (325), Expect = 6e-40
 Identities = 60/74 (81%), Positives = 64/74 (86%)

Query: 55  KRKLQRNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWR 114
               QRNRTSFT +QI+ LEKEFERTHYPDVFARERLAAKI LPEARIQVWFSNRRAKWR
Sbjct: 4   GSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWR 63

Query: 115 REEKLRNQRQRGSA 128
           REEKLRNQR++   
Sbjct: 64  REEKLRNQRRQSGP 77
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.86
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.85
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.84
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.84
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.84
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.84
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.84
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.84
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.84
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.84
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.83
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.83
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.83
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.83
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.83
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.83
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.83
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.83
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.83
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.82
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.82
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.82
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.82
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.82
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.82
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.82
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.82
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.82
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.82
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.82
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.82
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.81
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.81
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.81
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.81
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.81
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.81
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.81
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.81
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.81
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.8
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.8
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.8
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.8
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.79
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.79
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.79
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.78
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.78
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.78
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.78
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.77
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.77
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.77
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.76
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.76
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.76
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.76
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.75
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.75
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.75
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.75
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.75
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.75
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.74
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.74
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.73
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.73
2e19_A64 Transcription factor 8; homeobox domain, structura 99.72
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.72
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.69
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.66
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.62
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.57
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.56
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.55
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.39
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.87
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 96.8
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 88.89
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 88.2
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 86.84
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 85.4
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 83.32
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.86  E-value=2e-21  Score=129.23  Aligned_cols=67  Identities=90%  Similarity=1.326  Sum_probs=62.6

Q ss_pred             hccCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCchhHhhhhhhhHHHHHHHHHHHHHh
Q psy4868          57 KLQRNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEKLRNQR  123 (169)
Q Consensus        57 k~rr~Rt~~t~~q~~~Le~~F~~~~~p~~~~~~~La~~l~l~~~qV~~WFqNrR~k~kk~~~~~~~~  123 (169)
                      +.++.|+.|+..|+.+|+..|..++||+..++.+||..|||++.+|++||||||+|+|+..+.....
T Consensus         6 ~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNRR~k~kk~~~~~~~~   72 (80)
T 2cue_A            6 SGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQR   72 (80)
T ss_dssp             SSCCCCCCSCHHHHHHHHHHHTTCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCccCHHHHHHHHHHHhccCCCCHHHHHHHHHHhCCCHHHhhHHHHHHHHHHHHHhhhhhcc
Confidence            4578899999999999999999999999999999999999999999999999999999988876654
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 169
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-25
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 8e-22
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-21
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 4e-21
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-20
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 4e-20
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-19
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-19
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-19
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 3e-19
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 4e-19
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 7e-19
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-18
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-18
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 2e-18
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 4e-18
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 7e-18
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-17
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 8e-17
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 8e-17
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 4e-16
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 8e-16
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 2e-15
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 5e-15
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 7e-15
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-14
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 7e-14
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-13
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-13
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 6e-13
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 3e-11
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 3e-09
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Paired box protein pax6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 91.4 bits (227), Expect = 1e-25
 Identities = 60/66 (90%), Positives = 63/66 (95%)

Query: 59  QRNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRREEK 118
           QRNRTSFT +QI+ LEKEFERTHYPDVFARERLAAKI LPEARIQVWFSNRRAKWRREEK
Sbjct: 2   QRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 61

Query: 119 LRNQRQ 124
           LRNQR+
Sbjct: 62  LRNQRR 67
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.88
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.88
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.87
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.87
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.87
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.87
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.87
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.87
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.86
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.86
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.85
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.85
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.85
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.84
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.84
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.83
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.82
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.82
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.82
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.82
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.8
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.8
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.76
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.76
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.76
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.75
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.72
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.72
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.7
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.68
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.67
d1hlva166 DNA-binding domain of centromere binding protein B 93.89
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 87.3
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 83.03
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 81.55
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.88  E-value=1.9e-23  Score=129.08  Aligned_cols=57  Identities=28%  Similarity=0.626  Sum_probs=54.9

Q ss_pred             cCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCchhHhhhhhhhHHHHHH
Q psy4868          59 QRNRTSFTNDQIDNLEKEFERTHYPDVFARERLAAKIGLPEARIQVWFSNRRAKWRR  115 (169)
Q Consensus        59 rr~Rt~~t~~q~~~Le~~F~~~~~p~~~~~~~La~~l~l~~~qV~~WFqNrR~k~kk  115 (169)
                      |+.|+.|+..|+.+|+..|..++||+..++++||..|||++.||+|||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            677999999999999999999999999999999999999999999999999999874
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure