Psyllid ID: psy4951

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------119
MLGPHSLKAPLEGQEGLLASSNYYSFSCVIAELQVPGCLSMLRRSWQPLSIPITKSRDEPTQCDMSEGLETRQNLSGPEPLPVLDLTAVMDDKTGDLFISWKPDNASYQDMYKISIKSILLEEEHQKQFLMGFLGDCDNGSKISYVEIETLNGDSNQMFVDKTEYVLESLLPGRKYSINVQAVSNGMESPSFPIIEDLRPIEFGLNISWKSDVNSRQDNFEVIYNRNDTITEDPITVVTTDSKLLLENLYPGAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFTEYSIRYRTEEDKTWVRLPNVGTSLEAEVTDMVPGEKCMIQVNSVSYSVESAHPLQINHTISPNPATYVAALVDASNVTLEFPRPEGRIEYYLVTWRGIGPEATSTELFTKNVTNDPEDKDKHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQSTDSVTLRYTPQNSNHFDFYRFTLSEPDIPVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVADGVLSTPIQRHDRLYPEPITRINATEITDTSVSLTWDSPRGEYNAFEVQYLNTEGFLIQNLTLHTSIVIGDLKPHRNYTFTVIVRSGTESSVLRRSLPVSAIFQTHESLPGKMDRTIVDTWHFVRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISYAQEAACNHNQRLHAKFQLPRVNSKKLKGWPGTLRTDWRSYIYKLQAELGLHMEPETIWKQKMPIPRRCGLNPNSDIIKVNENNIKRINSFNIYFLAPPRPSSQVVPTEVCRTSTTIQIRFRKNYFSEKNGAIIYYTVIVAEDDSKNSSGLEMPSWRDVQAYSVWPPYQVLEPFQFFKNMSVEDFTIGEESCEGKTGYCNGPLKSGSTYKVKIRAFTTPDKFTDTAYSFPISTGWYNFALLGQDQDNTPLVVGITIPFILVLILCMTVFILRSRRKNVRKTTESRNADNMSLQDSIVETSRPIRLENFAEHYRIMSADSDFRFSEEFEELKHVGREQSCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGHNSPRRSGTLIALDRILQSINHSDVVDIFGIVYHMRKERVWMVQTEQQYICIHQCLLAVLEGNENQLPLREIHHNQGYEGLSQPMQFRPLASAVQATG
cccccccccccccccccEEccEEEEEEEEEEEEEccccEEEEEEcccccEEEEEEccccccEEcccccccccEEccccccccEEEEEEEEEccccEEEEEEEccccccccEEEEEEEEEEEEEEcccEEEEEEccccccccEEEEEEEEcccccEEEEEEcccEEEEcccccccEEEEEEEEEEccccccccccccccEEcccEEEEEEcccccccccEEEEEEEEccccccccEEEcccccEEEEcccccccEEEEEEEEEEcccccccEEEEEEEcccccccEEEEEEcccEEEEEEEcccccccEEEEEEEEEcccccEEEEEcccccEEEEEcccccccEEEEEEEEEEccccccccEEEEEEccccccEEEEEEEcccEEEEEEEcccccccEEEEEEEccccccccEEEEEccccccccccccEEEEEEcccccccEEEEEEEEEEcccccccEEEEEEcccccccccEEEEEcccccEEEEEEEccccccccEEEEEEEcccccEEEEEEcccccEEEEcccccccEEEEEEEEEEcccccccEEEEEEccccccccEEEEEEcccEEEEEEEccccccEEEEEEEEEccccEEEEEEcccEEEEcccccccEEEEEEEEEEccccccccccccEEEEEEccccccccccccEEEEcccccccccccEEEEEEcccEEEEEEEcccccccEEEEEEEEEEEEcccccccEEEEEEEEcccccccEEEcccccccccEEEEEEEEEEEEccccccEEEEEEEEEccccccccccccEEEEEEccEEEEEEEEEEEEcccccccccEEEEEEEcccEEEEEEEEEccccccccEEEEEEEEEccccccccccccccHHHcccccccccEEEEcccccccccccEEEEEcccccccccEEEccccccccEEEEEEEEEEcccccccccccccEEcccccccccccccccccEEEEEEHHHHHHHEEEEEEEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHcccccccccccccccccccccccccccccccccEEEEEccccccccEEEEcccccccccccccccEEEEcccccccccccccccEEEEEcccccEEEEEEEccEEEEEEEEHHHHHHcccccccccccccccccccccccEEEEEccccccccc
cccccccccccccccccEEcccccEEEEEccccccccccEEEEEEEccccccccccccccEEccccccccEEEEEcccccccEEEEEEEEcccccEEEEEEcccccccccccccccccccccccEEEEEccccccccccEEEEEEEcccccccccEEccccccEEEEcccccccEEEEEEEEEEccccccccccccccEEcccEEEEEEEccccccccEEEEEEEcccccccEEEEccccccEEEEcccccccEEEEEEEEEEcccccccEEEEEEccccccccEEEEEccccEEEEEEcccccccEEEEEEEEEcccccccEEEEccccccEEEEcccccccEEEEEEEEEEccccccccEEEEEcccccccccEEEEccccEEEEEEccccccEEEEEEEEEcccccccccEEEcccccccccccccccEEEEEccccccEEEEEEEEEEccccccccEEEEEEcccccccccEEEEcccccEEEEEEcccccccEEEEEEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEEEEEcccccccEEEEEEccccccccEEEEEccccEEEEEEccccccEEEEEEEEEccccccEcccccccEEEEEccccccEEEEEEEEEEcccccccccccEEEEEEcccccccccEEEEEccccccccccccccEEEEEccccEEEEEEccccccccccEEEEEEEEEcccccccccccccccccccEEEEEEcccccccccccEEEEEEEEEEccccccccccEEEEcccccccccccccccccccccccccccccEEEEEccccccccEEEEEEEccccEEEEEEEcEEEccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEEEcccccccEEEEEEEEEEcccccccccccccEccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccccccccccccccHHHHHHHHHHHHcccccccHHHHHHccccccccccEEcccccHHHHcccccccccHHHEEEcccccccccccEEEEEcEEEccEEcHHHHHHHHHHHHHHHHHHcEEcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccEccccHHHccccccccccccccHHHHHHHHcc
mlgphslkaplegqegllassnyysfSCVIAELQVPGCLSMLRrswqplsipitksrdeptqcdmsegletrqnlsgpeplpvldltavmddktgdlfiswkpdnasyqDMYKISIKSILLEEEHQKQFLMGFlgdcdngskisYVEIETlngdsnqmfvDKTEYVLESllpgrkysinvqavsngmespsfpiiedlrpiefglniswksdvnsrqDNFEVIYnrndtitedpitvvttdsklllenlypgagySIQVFAIshglrsephdyfqavypkpptnltlektssnavlvkwkepvgsiftEYSIRyrteedktwvrlpnvgtsleaevtdmvpgekcmiQVNSVsysvesahplqinhtispnpaTYVAALVDasnvtlefprpegriEYYLVTWrgigpeatstelftknvtndpedkdkHVHILIDqltpgvkyqFTIRTVSYNLesgvtslsartmplIESEVLVVnnqqstdsvtlrytpqnsnhfdfyrftlsepdipviekaandtdrkvtfnnltpgklynftvwtvadgvlstpiqrhdrlypepitrinateitdtsvsltwdsprgeynafEVQYLNTEGFLIQNLtlhtsivigdlkphrnyTFTVIVRSGtessvlrrslpvsaifqtheslpgkmdrtiVDTWHFVRFfqaekfhpidvqpgditfewslpgseqngvirKFTISYAQEAACNHNQrlhakfqlprvnskklkgwpgtlrtDWRSYIYKLQAElglhmepetiwkqkmpiprrcglnpnsdiikvnennikrinsfniyflapprpssqvvptevcrtsttIQIRFRKNyfsekngaIIYYTVIVAeddsknssglempswrdvqaysvwppyqvlepfqffknmsvedftigeescegktgycngplksgstykVKIRafttpdkftdtaysfpistgwynfallgqdqdntplvvgITIPFILVLILCMTVFILRsrrknvrkttesrnadnmslqdsivetsrpirlenFAEHYrimsadsdfrfSEEFEELKHvgreqsctaadlpcnrpknrftnilpydhsrfklqpvddeegsdyinanyvpghnsprrsgtLIALDRILQSINHSDVVDIFGIVYHMRKERVWMVQTEQQYICIHQCLLAVLEgnenqlplreihhnqgyeglsqpmqfrpLASAVQATG
mlgphslkAPLEGQEGLLASSNYYSFSCVIAELQVPGCLSMLRRSWQPlsipitksrdeptqCDMSEGletrqnlsgpeplPVLDLTAVMDDKTGDLFIswkpdnasyQDMYKISIKSILLEEEHQKQFLMGFLGDCDNGSKISYVEIETlngdsnqmfVDKTEYVLESLLPGRKYSINVQAVSNGMESPSFPIIEDLRPIEFGLNIswksdvnsrQDNFEVIYnrndtitedpitVVTTDSKLLLENLYPGAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTlektssnavlvkwkepvgsifteysiryrteedktwvrlpnvgtsleaevtdmvPGEKCMIQVNSVSYSVESAHPLQINHTISPNPATYVAALVDASNvtlefprpegRIEYYLVTWRGIGPEATSTELFTKnvtndpedkdKHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQSTdsvtlrytpqnsNHFDFYRFTLSEPDIPVIEkaandtdrkvtfnnltpgklynfTVWTVADGVLStpiqrhdrlypepitrinateitdtsvsltwdspRGEYNAFEVQYLNTEGFLIQNLTLHTSIVIGDLKPHRNYTFTVIVRsgtessvlrrsLPVSAIfqtheslpgkmdRTIVDTWHFVRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISYAQEAACNHNQRLhakfqlprvnskklkgwpgtlrtdWRSYIYKLQAELGLHMEPETIWKQKMPIPRRCGLNPNSDIIKVNENNIKRINSFNIYFLApprpssqvvptevcrtsttiqirfrknyfsekngAIIYYTVIVAEDDSKNSSGLEMPSWRDVQAYSVWPPYQVLEPFQFFKNMSVEDFTIGEEScegktgycngplksgstYKVKIRAFTTPDKFTDTAYSFPISTGWYNFALLGQDQDNTPLVVGITIPFILVLILCMTVFilrsrrknvrkttesrnadnmslqdsivetsrPIRLENFAEHYRIMSADSDFRFSEEFEELKHvgreqsctaadlpcnrpknrftnilpydhsrFKLQPVDDEEGSDYINanyvpghnsprrSGTLIALDRILQSINHSDVVDIFGIVYHMRKERVWMVQTEQQYICIHQCLLAVLEGNENQLPLREIHHNQGYEGLSQPMQFRPLASAVQATG
MLGPHSLKAPLEGQEGLLASSNYYSFSCVIAELQVPGCLSMLRRSWQPLSIPITKSRDEPTQCDMSEGLETRQNLSGPEPLPVLDLTAVMDDKTGDLFISWKPDNASYQDMYKISIKSILLEEEHQKQFLMGFLGDCDNGSKISYVEIETLNGDSNQMFVDKTEYVLESLLPGRKYSINVQAVSNGMESPSFPIIEDLRPIEFGLNISWKSDVNSRQDNFEVIYNRNDTITEDPITVVTTDSKLLLENLYPGAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFTEYSIRYRTEEDKTWVRLPNVGTSLEAEVTDMVPGEKCMIQVNSVSYSVESAHPLQINHTISPNPATYVAALVDASNVTLEFPRPEGRIEYYLVTWRGIGPEATSTELFTKNVTNDPEDKDKHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQSTDSVTLRYTPQNSNHFDFYRFTLSEPDIPVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVADGVLSTPIQRHDRLYPEPITRINATEITDTSVSLTWDSPRGEYNAFEVQYLNTEGFLIQNLTLHTSIVIGDLKPHRNYTFTVIVRSGTESSVLRRSLPVSAIFQTHESLPGKMDRTIVDTWHFVRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISYAQEAACNHNQRLHAKFQLPRVNSKKLKGWPGTLRTDWRSYIYKLQAELGLHMEPETIWKQKMPIPRRCGLNPNSDIIKVNENNIKRINSFNIYFLAPPRPSSQVVPTEVCRTSTTIQIRFRKNYFSEKNGAIIYYTVIVAEDDSKNSSGLEMPSWRDVQAYSVWPPYQVLEPFQFFKNMSVEDFTIGEESCEGKTGYCNGPLKSGSTYKVKIRAFTTPDKFTDTAYSFPISTGWYNFALLGQDQDNTPLVVGITIPFILVLILCMTVFILRSRRKNVRKTTESRNADNMSLQDSIVETSRPIRLENFAEHYRIMSAdsdfrfseefeeLKHVGREQSCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGHNSPRRSGTLIALDRILQSINHSDVVDIFGIVYHMRKERVWMVQTEQQYICIHQCLLAVLEGNENQLPLREIHHNQGYEGLSQPMQFRPLASAVQATG
****************LLASSNYYSFSCVIAELQVPGCLSMLRRSWQPLSIP******************************VLDLTAVMDDKTGDLFISWKPDNASYQDMYKISIKSILLEEEHQKQFLMGFLGDCDNGSKISYVEIETLNGDSNQMFVDKTEYVLESLLPGRKYSINVQAVSNGMESPSFPIIEDLRPIEFGLNISWKSDVNSRQDNFEVIYNRNDTITEDPITVVTTDSKLLLENLYPGAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFTEYSIRYRTEEDKTWVRLPNVGTSLEAEVTDMVPGEKCMIQVNSVSYSVESAHPLQINHTISPNPATYVAALVDASNVTLEFPRPEGRIEYYLVTWRGIGPEATSTELFTKNV********KHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQSTDSVTLRYTPQNSNHFDFYRFTLSEPDIPVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVADGVLSTPIQRHDRLYPEPITRINATEITDTSVSLTWDSPRGEYNAFEVQYLNTEGFLIQNLTLHTSIVIGDLKPHRNYTFTVIVRSGTESSVLRRSLPVSAIFQTHESLPGKMDRTIVDTWHFVRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISYAQEAACNHNQRLHAKFQLPRVNSKKLKGWPGTLRTDWRSYIYKLQAELGLHMEPETIWKQKMPIPRRCGLNPNSDIIKVNENNIKRINSFNIYFLAPPRPSSQVVPTEVCRTSTTIQIRFRKNYFSEKNGAIIYYTVIVAE***********PSWRDVQAYSVWPPYQVLEPFQFFKNMSVEDFTIGEESCEGKTGYCNGPLKSGSTYKVKIRAFTTPDKFTDTAYSFPISTGWYNFALLGQDQDNTPLVVGITIPFILVLILCMTVFILRS*****************************IRLENFAEHYRIMSADSDFRF***************CTAADLPCNRPKNRFTNILPYDHSRFKL*********DYINANYVP*******SGTLIALDRILQSINHSDVVDIFGIVYHMRKERVWMVQTEQQYICIHQCLLAVLEGNENQLPLREI**************************
*****SL*************SNYYSFSCVIAELQVPGCLSMLRRSWQPLSIPIT**************************LPVLDLTAVMDDKTGDLFISWKPDNASYQDMYKISIKSILLEEEHQKQFLMGFLGDCDNGSKISYVEIET********FVDKTEYVLESLLPGRKYSINVQA****************RPIEFGLNISWKSDVNSRQDNFEVIYNR**************DSKLLLENLYPGAGYSIQVFAISH************VYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFTEYSIRYR*****************EAEVTDMVPGEKCMIQVNS*************************AALVDASNVTLEFPRPEGRIEYYLVTWRGIGP******************KDKHVHILIDQLTPGVKYQFTIRTV**************T**************QSTDSVTLRYTPQNSNHFDFYRFTLSEP************DRKVTFNNLTPGKLYNFTVWTVAD*************YPEPITRINATEITDTSVSLTWDSPRGEYNAFEVQYLNTEG**********SIVIGDLKPHRNYTFTVIVRSGTE***********AIFQTHESLPGKMDRTIVDTWHFVRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISYAQEA*************LPRVNSKKLKGWPGTLRTDWRSYIYKLQAEL********************GLNPNSDIIKVNENNIKRINSFNIYFLAPPR*****************QIRFRKNYFSEKNGAIIYYTVIVAEDDSK*S**LEMPSWRDVQAYSVWPPYQVLEPFQFFKNMSVEDFTIGEESCEGKTGYCNGPLKSGSTYKVKIRAFTTP***********IS***********DQDNTPLVVGITIPFILVLILCMTVFILRSRRK**************************IRLENFAEHYRIMSADSDFRFSEEFEELKHVGREQSCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGHNSPRRSGTLIALDRILQSINHSDVVDIFGIVYHMRKERVWMVQTEQQYICIHQCLLAVLEGNENQLPLR****************************
MLGPHSLKAPLEGQEGLLASSNYYSFSCVIAELQVPGCLSMLRRSWQPLSIPITKSRDEPTQCDMSEGLETRQNLSGPEPLPVLDLTAVMDDKTGDLFISWKPDNASYQDMYKISIKSILLEEEHQKQFLMGFLGDCDNGSKISYVEIETLNGDSNQMFVDKTEYVLESLLPGRKYSINVQAVSNGMESPSFPIIEDLRPIEFGLNISWKSDVNSRQDNFEVIYNRNDTITEDPITVVTTDSKLLLENLYPGAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFTEYSIRYRTEEDKTWVRLPNVGTSLEAEVTDMVPGEKCMIQVNSVSYSVESAHPLQINHTISPNPATYVAALVDASNVTLEFPRPEGRIEYYLVTWRGIGPEATSTELFTKNVTNDPEDKDKHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQSTDSVTLRYTPQNSNHFDFYRFTLSEPDIPVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVADGVLSTPIQRHDRLYPEPITRINATEITDTSVSLTWDSPRGEYNAFEVQYLNTEGFLIQNLTLHTSIVIGDLKPHRNYTFTVIVRSGTESSVLRRSLPVSAIFQTHESLPGKMDRTIVDTWHFVRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISYAQEAACNHNQRLHAKFQLPRVNSKKLKGWPGTLRTDWRSYIYKLQAELGLHMEPETIWKQKMPIPRRCGLNPNSDIIKVNENNIKRINSFNIYFLAPPR***********RTSTTIQIRFRKNYFSEKNGAIIYYTVIVAEDDSKNSSGLEMPSWRDVQAYSVWPPYQVLEPFQFFKNMSVEDFTIGEESCEGKTGYCNGPLKSGSTYKVKIRAFTTPDKFTDTAYSFPISTGWYNFALLGQDQDNTPLVVGITIPFILVLILCMTVFILRSRR************DNMSLQDSIVETSRPIRLENFAEHYRIMSADSDFRFSEEFEELKHVGREQSCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGHNSPRRSGTLIALDRILQSINHSDVVDIFGIVYHMRKERVWMVQTEQQYICIHQCLLAVLEGNENQLPLREIHHNQGYEGLSQPMQFRPLASAVQATG
****HSLKAPLEGQEGLLASSNYYSFSCVIAELQVPGCLSMLRRSWQPLSIPITKSRDEPTQCDMSEGLETRQNLSGPEPLPVLDLTAVMDDKTGDLFISWKPDNASYQDMYKISIKSILLEEEHQKQFLMGFLGDCDNGSKISYVEIETLNGDSNQMFVDKTEYVLESLLPGRKYSINVQAVSNGMESPSFPIIEDLRPIEFGLNISWKSDVNSRQDNFEVIYNRNDTITEDPITVVTTDSKLLLENLYPGAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFTEYSIRYRTEEDKTWVRLPNVGTSLEAEVTDMVPGEKCMIQVNSVSYSVESAHPLQINHTISPNPATYVAALVDASNVTLEFPRPEGRIEYYLVTWRGIGPEATSTELFTK*VTNDPEDKDKHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQSTDSVTLRYTPQNSNHFDFYRFTLSEPDIPVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVADGVLSTPIQRHDRLYPEPITRINATEITDTSVSLTWDSPRGEYNAFEVQYLNTEGFLIQNLTLHTSIVIGDLKPHRNYTFTVIVRSGTESSVLRRSLPVSAIFQTHESLPGKMDRTIVDTWHFVRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISYAQEA******RLHAKFQLPRVNSKKLKGWPGTLRTDWRSYIYKLQAELGLHMEPETIWKQKMPIPRRCGLNPNSDIIKVNENNIKRINSFNIYFLAPPRPSSQVVPTEVCRTSTTIQIRFRKNYFSEKNGAIIYYTVIVAEDDSKNSSGLEMPSWRDVQAYSVWPPYQVLEPFQFFKNMSVEDFTIGEESCEGKTGYCNGPLKSGSTYKVKIRAFTTPDKFTDTAYSFPISTGWYNFALLGQDQDNTPLVVGITIPFILVLILCMTVFILRSRRKN***TTESRNADNMSLQDSIVETSRPIRLENFAEHYRIMSADSDFRFSEEFEELKHVGREQSCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGHNSPRRSGTLIALDRILQSINHSDVVDIFGIVYHMRKERVWMVQTEQQYICIHQCLLAVLEGNENQLPLREIHHNQGYEGLSQPMQFRPLASAVQAT*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGPHSLKAPLEGQEGLLASSNYYSFSCVIAELQVPGCLSMLRRSWQPLSIPITKSRDEPTQCDMSEGLETRQNLSGPEPLPVLDLTAVMDDKTGDLFISWKPDNASYQDMYKISIKSILLEEEHQKQFLMGFLGDCDNGSKISYVEIETLNGDSNQMFVDKTEYVLESLLPGRKYSINVQAVSNGMESPSFPIIEDLRPIEFGLNISWKSDVNSRQDNFEVIYNRNDTITEDPITVVTTDSKLLLENLYPGAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFTEYSIRYRTEEDKTWVRLPNVGTSLEAEVTDMVPGEKCMIQVNSVSYSVESAHPLQINHTISPNPATYVAALVDASNVTLEFPRPEGRIEYYLVTWRGIGPEATSTELFTKNVTNDPEDKDKHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQSTDSVTLRYTPQNSNHFDFYRFTLSEPDIPVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVADGVLSTPIQRHDRLYPEPITRINATEITDTSVSLTWDSPRGEYNAFEVQYLNTEGFLIQNLTLHTSIVIGDLKPHRNYTFTVIVRSGTESSVLRRSLPVSAIFQTHESLPGKMDRTIVDTWHFVRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISYAQEAACNHNQRLHAKFQLPRVNSKKLKGWPGTLRTDWRSYIYKLQAELGLHMEPETIWKQKMPIPRRCGLNPNSDIIKVNENNIKRINSFNIYFLAPPRPSSQVVPTEVCRTSTTIQIRFRKNYFSEKNGAIIYYTVIVAEDDSKNSSGLEMPSWRDVQAYSVWPPYQVLEPFQFFKNMSVEDFTIGEESCEGKTGYCNGPLKSGSTYKVKIRAFTTPDKFTDTAYSFPISTGWYNFALLGQDQDNTPLVVGITIPFILVLILCMTVFILRSRRKNVRKTTESRNADNMSLQDSIVETSRPIRLENFAEHYRIMSADSDFRFSEEFEELKHVGREQSCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGHNSPRRSGTLIALDRILQSINHSDVVDIFGIVYHMRKERVWMVQTEQQYICIHQCLLAVLEGNENQLPLREIHHNQGYEGLSQPMQFRPLASAVQATG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1189 2.2.26 [Sep-21-2011]
P35992 1631 Tyrosine-protein phosphat no N/A 0.772 0.562 0.551 0.0
B2RU80 1998 Receptor-type tyrosine-pr yes N/A 0.234 0.139 0.330 4e-35
P23467 1997 Receptor-type tyrosine-pr yes N/A 0.231 0.137 0.340 6e-35
O88488 2302 Phosphatidylinositol phos no N/A 0.272 0.140 0.3 1e-27
P0C5E4 2300 Phosphatidylinositol phos no N/A 0.272 0.140 0.292 2e-26
Q9UMZ3 2332 Phosphatidylinositol phos no N/A 0.270 0.138 0.292 2e-26
P70289 1705 Receptor-type tyrosine-pr no N/A 0.220 0.153 0.291 2e-24
Q12913 1337 Receptor-type tyrosine-pr no N/A 0.484 0.430 0.238 4e-24
Q16827 1216 Receptor-type tyrosine-pr no N/A 0.075 0.074 0.549 6e-24
Q64612 1711 Receptor-type tyrosine-pr no N/A 0.216 0.150 0.302 7e-24
>sp|P35992|PTP10_DROME Tyrosine-protein phosphatase 10D OS=Drosophila melanogaster GN=Ptp10D PE=1 SV=3 Back     alignment and function desciption
 Score = 1082 bits (2798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1034 (55%), Positives = 715/1034 (69%), Gaps = 116/1034 (11%)

Query: 80   PLPVLDLTAVMDDKTGDLFISWKPDNASYQDMYKISIKSILLEEEHQKQFLMGFLGDCDN 139
            PLPV +L ++ DDKT  + I+W+ D AS QD Y+I                         
Sbjct: 405  PLPVRNLRSINDDKTNTMIITWEADPASTQDEYRIV------------------------ 440

Query: 140  GSKISYVEIETLNGDSNQMFVDKTEYVLESLLPGRKYSINVQAVSNGMES---------- 189
                 Y E+ET NGD++ +  D+T + LESLLPGR YS++VQAVS  MES          
Sbjct: 441  -----YHELETFNGDTSTLTTDRTRFTLESLLPGRNYSLSVQAVSKKMESNETSIFVVTR 495

Query: 190  PSFPIIEDLRPIEFGLNISWKSDVNSRQDNFEVIYNRNDTITEDPITVVTTDSKLLLENL 249
            PS PIIEDL+ I  GLNISWKSDVNS+Q+ +EV+Y+RN T   D  T  T +S+L+++NL
Sbjct: 496  PSSPIIEDLKSIRMGLNISWKSDVNSKQEQYEVLYSRNGT--SDLRTQKTKESRLVIKNL 553

Query: 250  YPGAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFTE 309
             PGAGY ++VFA+SH LRSEPH YFQAVYP PP N+T+E   SN+VLV W  P    FTE
Sbjct: 554  QPGAGYELKVFAVSHDLRSEPHAYFQAVYPNPPRNMTIETVRSNSVLVHWSPPESGEFTE 613

Query: 310  YSIRYRTEEDKTWVRLPNVGTSLEAEVTDMVPGEKCMIQVNSVSYSVESAHPLQINHTIS 369
            YSIRYRT+ ++ WVRLP+V  S EA++TDM  GEK  IQVN+VS+ VES  P ++N T+ 
Sbjct: 614  YSIRYRTDSEQQWVRLPSV-RSTEADITDMTKGEKYTIQVNTVSFGVESPVPQEVNTTVP 672

Query: 370  PNPATYVAALVDASNVTLEFPRPEGRIEYYLVTWRGIGPEATSTELFTKNVT-NDPEDKD 428
            PNP + +  LVD+ N+TLE+P+PEGR+E Y++ W    P      + TKNV+ N   D  
Sbjct: 673  PNPVSNIIQLVDSRNITLEWPKPEGRVESYILKW---WPSDNPGRVQTKNVSENKSADDL 729

Query: 429  KHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQST--DSV 486
              V +LI +L PGV+Y+F I+T SY + SG+TSL  RTMPLI+S+V+V N ++    D++
Sbjct: 730  STVRVLIGELMPGVQYKFDIQTTSYGILSGITSLYPRTMPLIQSDVVVANGEKEDERDTI 789

Query: 487  TLRYTP--QNSNHFDFYRFTLSEPDIPVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVAD 544
            TL YTP  Q+S+ FD YRF+L + +I   EK ANDTDRKVTF  L PG+LYN TVWTV+ 
Sbjct: 790  TLSYTPTPQSSSKFDIYRFSLGDAEIRDKEKLANDTDRKVTFTGLVPGRLYNITVWTVSG 849

Query: 545  GVLSTPIQRHDRLYPEPITRINATEITDTSVSLTWDSPRGEYNAFEVQYLNTEGFLIQNL 604
            GV S PIQR DRLYPEPIT+++AT ITDT +SL WD P+GEYN F++ YL  +  L QN+
Sbjct: 850  GVASLPIQRQDRLYPEPITQLHATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNM 909

Query: 605  TLHTSIVIGDLKPHRNYTFTVIVRSGTESSVLRRSLPVSAIFQTHESLPGKMDRTIVDTW 664
            T    I I DL+PHRNYTFTV+VRSGTESSVLR S P+SA F T+E++PG++        
Sbjct: 910  TTRNEITISDLRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRV-------- 961

Query: 665  HFVRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISYAQEAACNHNQRLHAKFQ 724
                    E+FHP DVQP +I FEWSLP SE NGVIR+F+I+Y      N N    A  Q
Sbjct: 962  --------ERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAY-----TNINNLTDAGMQ 1008

Query: 725  LPRVNSKKLKGWPGTLRTDWRSYIYKLQAELGLHMEPETIWKQKMPIPRRCGLNPNSDII 784
                 S++  G    L+    +Y++K+QA+  +   PE  ++Q MPI             
Sbjct: 1009 --DFESEEAFGVIKNLKPG-ETYVFKIQAKTAIGFGPEREYRQTMPI------------- 1052

Query: 785  KVNENNIKRINSFNIYFLAPPRPSSQVVPTEVCRTSTTIQIRFRKNYFSEKNGAIIYYTV 844
                             LAPPRP++QVVPTEV R+S+TIQIRFRKNYFS++NG +  YT+
Sbjct: 1053 -----------------LAPPRPATQVVPTEVYRSSSTIQIRFRKNYFSDQNGQVRMYTI 1095

Query: 845  IVAEDDSKNSSGLEMPSWRDVQAYSVWPPYQVLEPFQFFKNMSVEDFTIGEESCEG-KTG 903
            IVAEDD+KN+SGLEMPSW DVQ+YSVW PYQ ++P+  F+N SVEDFTIG E+C+  K G
Sbjct: 1096 IVAEDDAKNASGLEMPSWLDVQSYSVWLPYQAIDPYYPFENRSVEDFTIGTENCDNHKIG 1155

Query: 904  YCNGPLKSGSTYKVKIRAFTTPDKFTDTAYSFPISTGWYNFALLGQDQDNTPLVVGITIP 963
            YCNGPLKSG+TY+VK+RAFT  DKFTDTAYSFPI T          DQDNT L+V IT+P
Sbjct: 1156 YCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQT----------DQDNTSLIVAITVP 1205

Query: 964  FILVLILCMTVFILRSRRKNVRKTT-ESRNADNMSLQDSIVETSRPIRLENFAEHYRIMS 1022
              ++L+L +T+   + RR N RKTT +SR  DNMSL DS++E +RPI ++NFAEHYR+MS
Sbjct: 1206 LTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMS 1265

Query: 1023 ADSDFRFSEEFEELKHVGREQSCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSD 1082
            ADSDFRFSEEFEELKHVGR+Q CT ADLPCNRPKNRFTNILPYDHSRFKLQPVDD+EGSD
Sbjct: 1266 ADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSD 1325

Query: 1083 YINANYVPGHNSPR 1096
            YINANYVPGHNSPR
Sbjct: 1326 YINANYVPGHNSPR 1339
May have a role in axon outgrowth and guidance.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|B2RU80|PTPRB_MOUSE Receptor-type tyrosine-protein phosphatase beta OS=Mus musculus GN=Ptprb PE=1 SV=1 Back     alignment and function description
>sp|P23467|PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens GN=PTPRB PE=1 SV=3 Back     alignment and function description
>sp|O88488|PTPRQ_RAT Phosphatidylinositol phosphatase PTPRQ OS=Rattus norvegicus GN=Ptprq PE=1 SV=1 Back     alignment and function description
>sp|P0C5E4|PTPRQ_MOUSE Phosphatidylinositol phosphatase PTPRQ OS=Mus musculus GN=Ptprq PE=1 SV=1 Back     alignment and function description
>sp|Q9UMZ3|PTPRQ_HUMAN Phosphatidylinositol phosphatase PTPRQ OS=Homo sapiens GN=PTPRQ PE=1 SV=2 Back     alignment and function description
>sp|P70289|PTPRV_MOUSE Receptor-type tyrosine-protein phosphatase V OS=Mus musculus GN=Ptprv PE=2 SV=1 Back     alignment and function description
>sp|Q12913|PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens GN=PTPRJ PE=1 SV=3 Back     alignment and function description
>sp|Q16827|PTPRO_HUMAN Receptor-type tyrosine-protein phosphatase O OS=Homo sapiens GN=PTPRO PE=1 SV=2 Back     alignment and function description
>sp|Q64612|PTPRV_RAT Receptor-type tyrosine-protein phosphatase V OS=Rattus norvegicus GN=Ptprv PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1189
347971538 1967 AGAP004246-PB [Anopheles gambiae str. PE 0.770 0.465 0.581 0.0
347971536 1515 AGAP004246-PA [Anopheles gambiae str. PE 0.770 0.604 0.581 0.0
157131409 1523 receptor protein-tyrosine phosphatase 10 0.772 0.602 0.584 0.0
170039275 1689 receptor protein-tyrosine phosphatase 10 0.771 0.542 0.579 0.0
383850297 1523 PREDICTED: tyrosine-protein phosphatase 0.793 0.619 0.558 0.0
242022109 1531 tyrosine-protein phosphatase 10D precurs 0.794 0.617 0.552 0.0
340722789 1549 PREDICTED: tyrosine-protein phosphatase 0.772 0.592 0.576 0.0
307178534 1562 Tyrosine-protein phosphatase 10D [Campon 0.774 0.589 0.568 0.0
322799537 1528 hypothetical protein SINV_13485 [Solenop 0.772 0.600 0.571 0.0
350418753 1559 PREDICTED: tyrosine-protein phosphatase 0.772 0.588 0.575 0.0
>gi|347971538|ref|XP_003436753.1| AGAP004246-PB [Anopheles gambiae str. PEST] gi|333468713|gb|EGK97027.1| AGAP004246-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1032 (58%), Positives = 724/1032 (70%), Gaps = 116/1032 (11%)

Query: 79   EPLPVLDLTAVMDDKTGDLFISWKPDNASYQDMYKISIKSILLEEEHQKQFLMGFLGDCD 138
            +PLPV  L +  D KTG + ISWKPD  S QD Y                          
Sbjct: 370  KPLPVKQLQSYTDSKTGVITISWKPDELSTQDEY-------------------------- 403

Query: 139  NGSKISYVEIETLNGDSNQMFVDKTEYVLESLLPGRKYSINVQAVSNGMES--------- 189
               +ISY E+ET NGDS+ M  ++T + LESLLPGR YS+ VQA+S  MES         
Sbjct: 404  ---RISYHELETNNGDSSTMSTNQTSFALESLLPGRNYSVTVQALSRKMESNETVIFVVT 460

Query: 190  -PSFPIIEDLRPIEFGLNISWKSDVNSRQDNFEVIYNRNDTITEDPITVVTTDSKLLLEN 248
             PS PIIEDL+ I  GLNISWKSDVNS+QD +EV Y RND  T D  TV+TT+S+L+  N
Sbjct: 461  RPSSPIIEDLKSIREGLNISWKSDVNSKQDKYEVTYTRND--TNDGKTVLTTESRLVFTN 518

Query: 249  LYPGAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFT 308
            LYPGAGY ++VFA+SHGLRSEPH YFQAVYP PP N+T+EK +SN+VLV WK P  S FT
Sbjct: 519  LYPGAGYEVKVFAVSHGLRSEPHSYFQAVYPNPPRNMTIEKVTSNSVLVHWKPPERSEFT 578

Query: 309  EYSIRYRTEEDKTWVRLPNVGTSLEAEVTDMVPGEKCMIQVNSVSYSVESAHPLQINHTI 368
            EYSIRYRTE +K W+RLP+V  + EA+VTDM PGEK  IQVN+VSY VES +P Q+N T+
Sbjct: 579  EYSIRYRTESEKQWIRLPSVKAT-EADVTDMTPGEKYTIQVNTVSYGVESPNPQQVNQTV 637

Query: 369  SPNPATYVAALVDASNVTLEFPRPEGRIEYYLVTWRGI-GPEATSTELFTKNVTNDPEDK 427
             PNP + +A LVD++N+TLEFPRPEGR+E Y++ W     PE  S + FT+  T  P   
Sbjct: 638  RPNPVSNIAPLVDSNNITLEFPRPEGRVETYIIHWWPTEQPEQVSMKNFTEVNTKPP--- 694

Query: 428  DKHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQSTDSVT 487
               V +LI  L  GV Y F I+T+SY L S +T L  RTMPLI+SEV++VNN  + D VT
Sbjct: 695  --LVRLLIGDLMSGVMYNFKIQTISYGLTSDLTKLQTRTMPLIQSEVVIVNNMHTRDMVT 752

Query: 488  LRY--TPQNSNHFDFYRFTLSEPDIPVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVADG 545
            L Y  TPQ S+ FD YRF+L +P IP  EK ANDTDRKVTF  LTPG+LYN TVWTV+  
Sbjct: 753  LSYTPTPQQSSKFDLYRFSLGDPSIPDKEKLANDTDRKVTFTGLTPGRLYNITVWTVSGK 812

Query: 546  VLSTPIQRHDRLYPEPITRINATEITDTSVSLTWDSPRGEYNAFEVQYLNTEGFLIQNLT 605
            V S PIQR DR++P+PIT + AT I DT ++L WD P+GEY +FEVQYL  +   +QN T
Sbjct: 813  VSSQPIQRQDRMFPDPITMLEATSINDTWIALKWDIPKGEYTSFEVQYLMNDSHYVQNYT 872

Query: 606  LHTSIVIGDLKPHRNYTFTVIVRSGTESSVLRRSLPVSAIFQTHESLPGKMDRTIVDTWH 665
            ++  I I DLKPHRNYT TV+VRSGTESSVLR SLP+SA FQT E+LPG+MD        
Sbjct: 873  VNNHITITDLKPHRNYTITVVVRSGTESSVLRVSLPISANFQTKEALPGRMD-------- 924

Query: 666  FVRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISYAQEAACNHNQRLHAKFQL 725
                    KF PID+QP +ITFEWSLP +EQNG+IR+FTI+Y  + +  H Q    +   
Sbjct: 925  --------KFAPIDIQPSEITFEWSLPPNEQNGIIRQFTITYGLDGS-QHTQVKDFRPNE 975

Query: 726  PRVNSKKLKGWPGTLRTDWRSYIYKLQAELGLHMEPETIWKQKMPIPRRCGLNPNSDIIK 785
             R + K L+  PG      +SY++++QA+  +   PE IWKQKMPI              
Sbjct: 976  LRGSIKALQ--PG------KSYVFRIQAKTAIGYGPEHIWKQKMPI-------------- 1013

Query: 786  VNENNIKRINSFNIYFLAPPRPSSQVVPTEVCRTSTTIQIRFRKNYFSEKNGAIIYYTVI 845
                            LAPP+P +QVVPTEV  ++TTI+IRFRK+YFS++NG +  YT+I
Sbjct: 1014 ----------------LAPPKPETQVVPTEVGSSATTIEIRFRKHYFSDQNGVVTTYTII 1057

Query: 846  VAEDDSKNSSGLEMPSWRDVQAYSVWPPYQVLEPFQFFKNMSVEDFTIGEESCEG-KTGY 904
            +AEDDSKN+SGLEMPSWRDVQ+YSVWPPYQV+EP+  FKN SVEDFTIG E+C+  KTGY
Sbjct: 1058 IAEDDSKNASGLEMPSWRDVQSYSVWPPYQVIEPYYPFKNSSVEDFTIGTENCDAKKTGY 1117

Query: 905  CNGPLKSGSTYKVKIRAFTTPDKFTDTAYSFPISTGWYNFALLGQDQDNTPLVVGITIPF 964
            CNGPLKSG+TYKVK+RAFT PDKFTDTAYS+PI T           QDNT L+V IT+P 
Sbjct: 1118 CNGPLKSGTTYKVKVRAFTAPDKFTDTAYSYPIRTA----------QDNTSLIVSITVPL 1167

Query: 965  ILVLILCMTVFILRSRRKNVRKTTESRNADNMSLQDSIVETSRPIRLENFAEHYRIMSAD 1024
            +++ +L   V  LR RR   RKTTE R  DNMSL DS +ETSRP+ ++NFAEHYR+MSAD
Sbjct: 1168 LIIAMLVGVVLFLRRRRHTGRKTTEQRTNDNMSLPDSTIETSRPVLVKNFAEHYRMMSAD 1227

Query: 1025 SDFRFSEEFEELKHVGREQSCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYI 1084
            SDFRFSEEFEELKH+GR+Q CT ADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYI
Sbjct: 1228 SDFRFSEEFEELKHIGRDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYI 1287

Query: 1085 NANYVPGHNSPR 1096
            NANYVPGHNSPR
Sbjct: 1288 NANYVPGHNSPR 1299

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|347971536|ref|XP_313165.5| AGAP004246-PA [Anopheles gambiae str. PEST] gi|333468712|gb|EAA08669.6| AGAP004246-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157131409|ref|XP_001662235.1| receptor protein-tyrosine phosphatase 10d [Aedes aegypti] gi|108871560|gb|EAT35785.1| AAEL012083-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|170039275|ref|XP_001847466.1| receptor protein-tyrosine phosphatase 10d [Culex quinquefasciatus] gi|167862867|gb|EDS26250.1| receptor protein-tyrosine phosphatase 10d [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|383850297|ref|XP_003700732.1| PREDICTED: tyrosine-protein phosphatase 10D-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242022109|ref|XP_002431484.1| tyrosine-protein phosphatase 10D precursor, putative [Pediculus humanus corporis] gi|212516772|gb|EEB18746.1| tyrosine-protein phosphatase 10D precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340722789|ref|XP_003399784.1| PREDICTED: tyrosine-protein phosphatase 10D-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307178534|gb|EFN67223.1| Tyrosine-protein phosphatase 10D [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322799537|gb|EFZ20845.1| hypothetical protein SINV_13485 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350418753|ref|XP_003491955.1| PREDICTED: tyrosine-protein phosphatase 10D-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1189
FB|FBgn0004370 1631 Ptp10D "Protein tyrosine phosp 0.457 0.333 0.554 0.0
FB|FBgn0004368 1767 Ptp4E "Protein tyrosine phosph 0.534 0.359 0.422 3.3e-241
UNIPROTKB|F1N8A2 2001 PTPRB "Uncharacterized protein 0.154 0.091 0.364 1.8e-65
UNIPROTKB|J3QT52 1907 PTPRB "Receptor-type tyrosine- 0.374 0.233 0.257 1.1e-64
UNIPROTKB|P23467 1997 PTPRB "Receptor-type tyrosine- 0.374 0.222 0.257 1.5e-64
UNIPROTKB|F8VU56 2127 PTPRB "Receptor-type tyrosine- 0.374 0.209 0.257 2.2e-64
UNIPROTKB|F5H3G6 1907 PTPRB "Receptor-type tyrosine- 0.159 0.099 0.365 2.8e-62
RGD|1305922 2000 Ptprb "protein tyrosine phosph 0.389 0.231 0.258 9.8e-62
UNIPROTKB|F6UUL8 2215 PTPRB "Uncharacterized protein 0.388 0.208 0.236 1.3e-58
UNIPROTKB|E1BFE2 2286 E1BFE2 "Uncharacterized protei 0.374 0.194 0.258 2.1e-58
FB|FBgn0004370 Ptp10D "Protein tyrosine phosphatase 10D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1622 (576.0 bits), Expect = 0., Sum P(5) = 0.
 Identities = 322/581 (55%), Positives = 413/581 (71%)

Query:   142 KISYVEIETLNGDSNQMFVDKTEYVLESLLPGRKYSINVQAVSNGMES----------PS 191
             +I Y E+ET NGD++ +  D+T + LESLLPGR YS++VQAVS  MES          PS
Sbjct:   438 RIVYHELETFNGDTSTLTTDRTRFTLESLLPGRNYSLSVQAVSKKMESNETSIFVVTRPS 497

Query:   192 FPIIEDLRPIEFGLNISWKSDVNSRQDNFEVIYNRNDTITEDPITVVTTDSKLLLENLYP 251
              PIIEDL+ I  GLNISWKSDVNS+Q+ +EV+Y+RN T   D  T  T +S+L+++NL P
Sbjct:   498 SPIIEDLKSIRMGLNISWKSDVNSKQEQYEVLYSRNGT--SDLRTQKTKESRLVIKNLQP 555

Query:   252 GAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFTEYS 311
             GAGY ++VFA+SH LRSEPH YFQAVYP PP N+T+E   SN+VLV W  P    FTEYS
Sbjct:   556 GAGYELKVFAVSHDLRSEPHAYFQAVYPNPPRNMTIETVRSNSVLVHWSPPESGEFTEYS 615

Query:   312 IRYRTEEDKTWVRLPNVGTSLEAEVTDMVPGEKCMIQVNSVSYSVESAHPLQINHTISPN 371
             IRYRT+ ++ WVRLP+V  S EA++TDM  GEK  IQVN+VS+ VES  P ++N T+ PN
Sbjct:   616 IRYRTDSEQQWVRLPSV-RSTEADITDMTKGEKYTIQVNTVSFGVESPVPQEVNTTVPPN 674

Query:   372 PATYVAALVDASNVTLEFPRPEGRIEYYLVTWRGIGPEATSTELFTKNVT-NDPEDKDKH 430
             P + +  LVD+ N+TLE+P+PEGR+E Y++ W    P      + TKNV+ N   D    
Sbjct:   675 PVSNIIQLVDSRNITLEWPKPEGRVESYILKW---WPSDNPGRVQTKNVSENKSADDLST 731

Query:   431 VHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQST--DSVTL 488
             V +LI +L PGV+Y+F I+T SY + SG+TSL  RTMPLI+S+V+V N ++    D++TL
Sbjct:   732 VRVLIGELMPGVQYKFDIQTTSYGILSGITSLYPRTMPLIQSDVVVANGEKEDERDTITL 791

Query:   489 RYTP--QNSNHFDFYRFTLSEPDIPVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVADGV 546
              YTP  Q+S+ FD YRF+L + +I   EK ANDTDRKVTF  L PG+LYN TVWTV+ GV
Sbjct:   792 SYTPTPQSSSKFDIYRFSLGDAEIRDKEKLANDTDRKVTFTGLVPGRLYNITVWTVSGGV 851

Query:   547 LSTPIQRHDRLYPEPITRINATEITDTSVSLTWDSPRGEYNAFEVQYLNTEGFLIQNLTL 606
              S PIQR DRLYPEPIT+++AT ITDT +SL WD P+GEYN F++ YL  +  L QN+T 
Sbjct:   852 ASLPIQRQDRLYPEPITQLHATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTT 911

Query:   607 HTSIVIGDLKPHRNYTFTVIVRSGTESSVLRRSLPVSAIFQTHESLPGKMDRTIVDTWHF 666
                I I DL+PHRNYTFTV+VRSGTESSVLR S P+SA F T+E++PG+++R        
Sbjct:   912 RNEITISDLRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVER-------- 963

Query:   667 VRFFQAEKFHPIDVQPGDITFEWSLPGSEQNGVIRKFTISY 707
                     FHP DVQP +I FEWSLP SE NGVIR+F+I+Y
Sbjct:   964 --------FHPTDVQPSEINFEWSLPSSEANGVIRQFSIAY 996
GO:0005001 "transmembrane receptor protein tyrosine phosphatase activity" evidence=ISS;NAS
GO:0005886 "plasma membrane" evidence=ISS;NAS
GO:0004725 "protein tyrosine phosphatase activity" evidence=ISS;NAS;IDA
GO:0006470 "protein dephosphorylation" evidence=IMP;NAS;IDA
GO:0008045 "motor neuron axon guidance" evidence=IGI
GO:0004728 "receptor signaling protein tyrosine phosphatase activity" evidence=NAS
GO:0004721 "phosphoprotein phosphatase activity" evidence=IDA
GO:0007616 "long-term memory" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IGI
GO:0030424 "axon" evidence=IDA
GO:0007417 "central nervous system development" evidence=IGI
GO:0045177 "apical part of cell" evidence=IDA
FB|FBgn0004368 Ptp4E "Protein tyrosine phosphatase 4E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8A2 PTPRB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J3QT52 PTPRB "Receptor-type tyrosine-protein phosphatase beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P23467 PTPRB "Receptor-type tyrosine-protein phosphatase beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8VU56 PTPRB "Receptor-type tyrosine-protein phosphatase beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H3G6 PTPRB "Receptor-type tyrosine-protein phosphatase beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305922 Ptprb "protein tyrosine phosphatase, receptor type, B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6UUL8 PTPRB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BFE2 E1BFE2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer3.1.3.480.824

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1189
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 2e-20
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 2e-18
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 1e-16
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 8e-16
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 5e-15
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 5e-14
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 5e-14
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 4e-13
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 6e-09
smart0006083 smart00060, FN3, Fibronectin type 3 domain 8e-09
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 9e-09
pfam0004184 pfam00041, fn3, Fibronectin type III domain 2e-08
smart0006083 smart00060, FN3, Fibronectin type 3 domain 1e-07
pfam0004184 pfam00041, fn3, Fibronectin type III domain 2e-07
COG5599 302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 7e-06
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 4e-05
PHA02738 320 PHA02738, PHA02738, hypothetical protein; Provisio 1e-04
PHA02747 312 PHA02747, PHA02747, protein tyrosine phosphatase; 4e-04
PHA02742 303 PHA02742, PHA02742, protein tyrosine phosphatase; 5e-04
pfam0004184 pfam00041, fn3, Fibronectin type III domain 0.001
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 0.002
pfam0004184 pfam00041, fn3, Fibronectin type III domain 0.003
pfam0004184 pfam00041, fn3, Fibronectin type III domain 0.003
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information 
 Score = 92.0 bits (229), Expect = 2e-20
 Identities = 36/70 (51%), Positives = 48/70 (68%), Gaps = 2/70 (2%)

Query: 1029 FSEEFEELKHVGRE-QSCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINAN 1087
              EEFE+L  +  + +SCT A  P NR KNR+ ++LPYDH+R KL+P    EGSDYINA+
Sbjct: 2    LEEEFEKLDRLKPDDESCTVAAFPENRDKNRYKDVLPYDHTRVKLKP-PPGEGSDYINAS 60

Query: 1088 YVPGHNSPRR 1097
            Y+ G N P+ 
Sbjct: 61   YIDGPNGPKA 70

Length = 259
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1189
KOG4221|consensus1381 100.0
KOG4221|consensus1381 100.0
KOG4228|consensus 1087 100.0
KOG4228|consensus1087 99.96
KOG0791|consensus374 99.96
KOG3513|consensus1051 99.96
KOG0790|consensus600 99.95
KOG3513|consensus1051 99.94
PHA02740298 protein tyrosine phosphatase; Provisional 99.94
PHA02742303 protein tyrosine phosphatase; Provisional 99.94
PHA02746323 protein tyrosine phosphatase; Provisional 99.93
PHA02747312 protein tyrosine phosphatase; Provisional 99.93
PHA02738320 hypothetical protein; Provisional 99.92
KOG0793|consensus1004 99.87
KOG0792|consensus1144 99.86
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 99.85
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 99.83
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.68
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 99.64
KOG0196|consensus996 99.63
KOG4222|consensus1281 99.57
KOG4222|consensus 1281 99.52
KOG0789|consensus415 99.49
KOG0196|consensus996 99.38
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 99.19
KOG4258|consensus1025 99.07
KOG4258|consensus1025 98.98
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 98.9
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 98.78
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 98.4
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 98.32
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 98.32
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 98.2
KOG4802|consensus516 98.06
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.04
KOG4802|consensus516 97.81
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.76
cd0006393 FN3 Fibronectin type 3 domain; One of three types 97.74
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.71
COG3401343 Fibronectin type 3 domain-containing protein [Gene 97.56
COG3401343 Fibronectin type 3 domain-containing protein [Gene 97.52
KOG3632|consensus1335 96.91
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 96.56
KOG0613|consensus1205 95.89
KOG3632|consensus 1335 95.83
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 95.67
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 95.28
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 95.25
KOG4367|consensus699 95.12
KOG4367|consensus699 95.08
KOG4152|consensus830 94.91
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 94.73
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 94.7
KOG4806|consensus454 94.53
KOG1720|consensus225 94.51
KOG1225|consensus525 93.96
PF15102146 TMEM154: TMEM154 protein family 93.71
KOG0613|consensus 1205 93.66
KOG4806|consensus454 93.08
PTZ00242166 protein tyrosine phosphatase; Provisional 91.4
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 89.47
KOG4152|consensus830 89.35
COG4733952 Phage-related protein, tail component [Function un 89.22
COG4733952 Phage-related protein, tail component [Function un 88.53
KOG1225|consensus525 86.57
PF07353184 Uroplakin_II: Uroplakin II; InterPro: IPR009952 Th 83.63
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 80.13
>KOG4221|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.2e-44  Score=424.08  Aligned_cols=542  Identities=19%  Similarity=0.275  Sum_probs=410.1

Q ss_pred             CCCCc-eeeecccccEEEEEeeCCC--CCCceEEEEEEEeCCCCCccceEEeeeccEEEEcCCCCCCeEEEEEEEEeCCc
Q psy4951         190 PSFPI-IEDLRPIEFGLNISWKSDV--NSRQDNFEVIYNRNDTITEDPITVVTTDSKLLLENLYPGAGYSIQVFAISHGL  266 (1189)
Q Consensus       190 P~~p~-~~~~~~~~~si~lsW~~p~--~~~i~~Y~V~~~~~~~~~~~~~~~~~~~~s~~i~~L~p~t~Y~v~V~a~~~~~  266 (1189)
                      |++|+ +.......+.|.++|.+|.  ++.+..|.+.|.......++...........++.+|+|.+.|.|+|.|.|.-+
T Consensus       428 ~sap~~lv~~~~~srfi~~tw~~p~~~~g~i~~~~v~~~~~~~~rer~~~tss~g~~~tv~nl~p~t~Y~~rv~A~n~~g  507 (1381)
T KOG4221|consen  428 PSAPRDLVANLVSSRFIQLTWRPPAQISGNISTYTVFYKVEGDVRERLQNTSSPGIQVTVQNLSPLTMYFFRVRAKNEAG  507 (1381)
T ss_pred             ccCCcceecccccceeEEEeecCccccCCCcceEEEEEecCCchhhhheeccCCceEEEeeecccceeEEEEEeccCccc
Confidence            34444 3444467889999999773  67889999998876655543333444448899999999999999999999533


Q ss_pred             cCCc-eeeecccCCCCCcceEEEeeeCCeEEEEeeCCC--CCcccEEEEEEEeCCCcceEEeccCCCccEEEecCCCCCC
Q psy4951         267 RSEP-HDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPV--GSIFTEYSIRYRTEEDKTWVRLPNVGTSLEAEVTDMVPGE  343 (1189)
Q Consensus       267 ~s~~-~~~~~~t~p~pP~~l~v~~~t~~sv~vsW~~p~--~g~i~~Y~V~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t  343 (1189)
                      ...+ ..+...++|.+|..+.+...+..++.+.|.+|.  |+.|++|++.|...+.+.+..+...  .++++|.||.|.|
T Consensus       508 ~g~sS~pLkV~t~pEgp~~~~a~ats~~ti~v~WepP~~~n~~I~~yk~~ys~~~~~~~~~~~~n--~~e~ti~gL~k~T  585 (1381)
T KOG4221|consen  508 SGESSAPLKVTTQPEGPVQLQAYATSPTTILVTWEPPPFGNGPITGYKLFYSEDDTGKELRVENN--ATEYTINGLEKYT  585 (1381)
T ss_pred             CCccCCceEEecCCCCCccccccccCcceEEEEecCCCCCCCCceEEEEEEEcCCCCceEEEecC--ccEEEeecCCCcc
Confidence            2222 223445666666669999999999999999998  8899999999999877777666544  4899999999999


Q ss_pred             eEEEEEEEEEcCccCCCceeEEe----ecCCCCccce-EEeecCcEEEEEeeCC-----CcceeEEEEEEEeeccCCCCc
Q psy4951         344 KCMIQVNSVSYSVESAHPLQINH----TISPNPATYV-AALVDASNVTLEFPRP-----EGRIEYYLVTWRGIGPEATST  413 (1189)
Q Consensus       344 ~Y~~~V~A~~~~g~s~~~~~~~~----~t~p~pp~~l-~~~~~~~sv~lsW~~p-----~g~i~~Y~V~~~~~~~~~~~~  413 (1189)
                      +|.|+|.|.|..|.+..+..+.+    ..|..||.++ ....++++|+|+|.+|     +|.+.+|+|+|+.   .....
T Consensus       586 eY~~~vvA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~itgYkIRy~~---~~~~~  662 (1381)
T KOG4221|consen  586 EYSIRVVAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQITGYKIRYRK---LSRED  662 (1381)
T ss_pred             ceEEEEEEecCCCCCCCCCceEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCcccccceEEEEEEEecc---cCccc
Confidence            99999999999888876554433    3466788888 6677889999999998     6889999999993   33333


Q ss_pred             ceEeeeecCCCCCCCCceEEEecCCCCCCeEEEEEEEEeCCccCcceEEE-EEc--------CCCCccceEEEeeccCCC
Q psy4951         414 ELFTKNVTNDPEDKDKHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLS-ART--------MPLIESEVLVVNNQQSTD  484 (1189)
Q Consensus       414 ~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~v~V~a~~~~~~s~~~~~~-~~t--------~P~~p~~~~v~~~~~t~~  484 (1189)
                      ......+.      ++.+.+.+.+|+|++.|.|+|.|.+-.|.++++... +.|        .|.+|..+.+   ....+
T Consensus       663 ~~~~t~v~------~n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~aeT~~~d~~e~vp~~ps~l~~---~~g~~  733 (1381)
T KOG4221|consen  663 EVNETVVK------GNTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSAETPESDLDERVPGKPSELHV---HPGSN  733 (1381)
T ss_pred             ccceeecc------cchhhhHhhcCCCCceEEEEEEEeccCCCCCcccceeccCccccccccCCCCCceeee---ccCce
Confidence            22222222      266789999999999999999999987777665432 233        2233443444   34789


Q ss_pred             EEEEEEEcCC--CCCeeEEEEEEEcCCC--CeEEEEecCCcceEEEeCCCCCCeEEEEEEEEeCCcCCCcEEEee--c--
Q psy4951         485 SVTLRYTPQN--SNHFDFYRFTLSEPDI--PVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVADGVLSTPIQRHD--R--  556 (1189)
Q Consensus       485 sv~vsW~p~~--~g~i~~Y~V~~~~~~~--~~~~~~~~~~~~~~~l~~L~p~t~Y~v~V~a~~~~~~S~~~~~~~--~--  556 (1189)
                      ++.++|+|+.  +-.+.+|+|.|+...+  ....+.+......+.|+.|+|+..|.|+++|+|..+.+.+..-..  +  
T Consensus       734 si~vsW~Pp~~~~~~vrgY~ig~r~g~~~p~~~tIrl~~~~s~y~l~~Le~~~~YvVkL~AfNn~gdG~p~y~~~~tR~~  813 (1381)
T KOG4221|consen  734 SIVVSWTPPPHPNIVVRGYKIGYRPGSGIPDTGTIRLDEKVSYYNLEQLEPNRDYVVKLRAFNNHGDGNPIYESVKTRSA  813 (1381)
T ss_pred             eEEEEeCCCCChhhhhcceEEeeecccCCCCCccEEecceeeEEEEEecccCceEEEEEEEeccCCCCcceeeeeeeccC
Confidence            9999999765  3467899999965433  244566778889999999999999999999999877766654322  2  


Q ss_pred             --------cCCCCCcceEEEEEeCcEEEEEeeC-CCC--CCceEEEEEEcC--CC--eEEEeeccccEEEEcCCCCCCEE
Q psy4951         557 --------LYPEPITRINATEITDTSVSLTWDS-PRG--EYNAFEVQYLNT--EG--FLIQNLTLHTSIVIGDLKPHRNY  621 (1189)
Q Consensus       557 --------t~p~~P~~l~v~~v~~~sv~l~W~~-p~g--~i~~Y~V~~~~~--~~--~~~~~~~~~~~~~l~~L~p~t~Y  621 (1189)
                              ++..+|..+++...+.++|.+.|.. .+.  ....|.|.|...  .+  ........+.++.+.+|+|.+.|
T Consensus       814 ~~~~~~v~tp~~ppvgv~A~~~S~tsI~v~w~~~~~~t~~~~~yTVr~~~~gi~~~~~~~~~~~t~ls~~v~glkpnt~y  893 (1381)
T KOG4221|consen  814 TDPTSPVDTPMLPPVGVRANALSSTSIRVTWADNKDQTTDNRIYTVRWSLTGIRNGTLYRYDNSTDLSYLVGGLKPNTPY  893 (1381)
T ss_pred             CCcCCcCCCCCCCcccccccccccceEEEEEecCCCccccceEEEEEEeecccccceeEEEecccccceeccCcCcCChh
Confidence                    1335778888888999999999998 443  567899999632  22  23345567889999999999999


Q ss_pred             EEEEEEEeCCCcceeeeccceeEEEEeccCCCCCcccccccccceeecccccceeeeecc-cceEEEEecCCCCCCCCcc
Q psy4951         622 TFTVIVRSGTESSVLRRSLPVSAIFQTHESLPGKMDRTIVDTWHFVRFFQAEKFHPIDVQ-PGDITFEWSLPGSEQNGVI  700 (1189)
Q Consensus       622 ~~~V~A~~~~g~~~~~~s~~~s~~~~T~~~~P~~~~~~~~~~~~~~~~~~~~~l~~~~~~-~tsv~l~W~~P~~~~ng~i  700 (1189)
                      .|.|.++-.++   ...+...++..+|.+.+|..|+               .++++.... ++++.+.|.+|. ++||.|
T Consensus       894 Efav~~~~~~~---r~stwsmsv~~~tle~~P~sPP---------------~d~tv~p~e~P~~v~v~WqPp~-e~nG~I  954 (1381)
T KOG4221|consen  894 EFAVMVVKRNR---RESTWSMSVENRTLELVPSSPP---------------RDLTVQPDEKPTTVIVHWQPPT-EPNGEI  954 (1381)
T ss_pred             hhhhhhhhccC---cCCcccceeeeeecccCCCCCC---------------hhceecccCCCCccccccCCCc-CCCCce
Confidence            99999876332   0144555667889998887653               466666554 799999999887 679999


Q ss_pred             eEEEEEEeccCcccceeeeeeeeecCcceeeEEeC-CCCCCcccceEEEEEEEEEecCCCCccccceeeeec
Q psy4951         701 RKFTISYAQEAACNHNQRLHAKFQLPRVNSKKLKG-WPGTLRTDWRSYIYKLQAELGLHMEPETIWKQKMPI  771 (1189)
Q Consensus       701 ~~Y~i~y~~~~~~~~~~~~~~~~~~~~~~~~~i~~-~pg~~~~~~t~Y~~~V~A~~~~G~g~~s~~~~~~t~  771 (1189)
                      ++|+|.|..+......+.....+. ++..++.+.+ .|+      +.|.|+|.|+|..|.|++|..+...++
T Consensus       955 ~~Yii~Ys~~~n~~~~dWt~~t~~-g~~L~~~v~~l~p~------t~yffkiQAr~~kG~gp~s~~v~y~t~ 1019 (1381)
T KOG4221|consen  955 TEYIIYYSTDGNTPEHDWTIETTA-GAELSHQVPNLDPD------TGYFFKIQARNEKGPGPFSSPVLYETS 1019 (1381)
T ss_pred             eeEEEEEecCCCCchhhceeeecc-cchhhhccCCCCCC------CceEEEEEeeccCCCCccccceeeecc
Confidence            999999977765522222223366 7889999999 999      999999999999999999998888887

>KOG4221|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF07353 Uroplakin_II: Uroplakin II; InterPro: IPR009952 This family contains uroplakin II, which is approximately 180 residues long and seems to be restricted to mammals Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1189
3s3e_A 307 Crystal Structure Of The Catalytic Domain Of Ptp10d 2e-37
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 2e-24
2pi7_A 312 Structure Of The Catalytic Domain Of The Chick Reti 4e-18
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 1e-10
2h02_A 313 Structural Studies Of Protein Tyrosine Phosphatase 5e-18
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 1e-11
2g59_A 297 Crystal Structure Of The Catalytic Domain Of Protei 6e-18
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 6e-11
2gjt_A 295 Crystal Structure Of The Human Receptor Phosphatase 7e-18
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 3e-11
2ahs_A 295 Crystal Structure Of The Catalytic Domain Of Human 2e-15
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 1e-11
2h03_A 291 Structural Studies Of Protein Tyrosine Phosphatase 2e-15
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 1e-11
2nz6_A 316 Crystal Structure Of The Ptprj Inactivating Mutant 3e-12
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 3e-10
2cfv_A 316 Crystal Structure Of Human Protein Tyrosine Phospha 3e-12
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 3e-10
3i36_A 342 Crystal Structure Of Rat Protein Tyrosine Phosphata 2e-11
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 2e-10
2fh7_A 595 Crystal Structure Of The Phosphatase Domains Of Hum 5e-11
2fh7_A 595 Crystal Structure Of The Phosphatase Domains Of Hum 8e-08
3sr9_A 583 Crystal Structure Of Mouse Ptpsigma Length = 583 6e-11
3sr9_A 583 Crystal Structure Of Mouse Ptpsigma Length = 583 7e-08
1fnf_A368 Fragment Of Human Fibronectin Encompassing Type-Iii 1e-10
1fnf_A368 Fragment Of Human Fibronectin Encompassing Type-Iii 3e-06
2c7s_A 313 Crystal Structure Of Human Protein Tyrosine Phospha 2e-10
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 2e-06
2nlk_A 627 Crystal Structure Of D1 And D2 Catalytic Domains Of 8e-10
1lar_A 575 Crystal Structure Of The Tandem Phosphatase Domains 1e-09
2h4v_A 320 Crystal Structure Of The Human Tyrosine Receptor Ph 2e-09
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 6e-09
3qcm_A 310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-09
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 6e-09
3qcb_A 310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-09
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 6e-09
2pbn_A 313 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-09
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 5e-09
2hy3_A 313 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-09
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 9e-09
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 5e-09
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 9e-09
2ooq_A 286 Crystal Structure Of The Human Receptor Phosphatase 1e-08
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 7e-07
1rpm_A 278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 2e-08
1yfo_A 302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 2e-08
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 8e-06
1ygr_A 610 Crystal Structure Of The Tandem Phosphatase Domain 3e-08
3t1w_A375 Structure Of The Four-Domain Fragment Fn7b89 Of Onc 9e-08
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 2e-07
2qcj_A313 Native Structure Of Lyp Length = 313 2e-07
3brh_A 310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 3e-07
2p6x_A 309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 3e-07
3h2x_A 302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 3e-07
2jjd_A 599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 6e-07
2jjd_A 599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 3e-04
4gh7_B285 Crystal Structure Of Anticalin N7a In Complex With 1e-06
3ps5_A 595 Crystal Structure Of The Full-Length Human Protein 1e-06
2b3o_A 532 Crystal Structure Of Human Tyrosine Phosphatase Shp 1e-06
4gry_A 288 Crystal Structure Of Shp1 Catalytic Domain With Jak 2e-06
1gwz_A 299 Crystal Structure Of The Catalytic Domain Of The Pr 2e-06
1fpr_A 284 Crystal Structure Of The Complex Formed Between The 2e-06
4gs0_A 308 Crystal Structure Of Shp1 Catalytic Domain With Jak 2e-06
1c86_A 298 Crystal Structure Of Protein Tyrosine Phosphatase 1 3e-06
1gfy_A 298 Residue 259 Is A Key Determinant Of Substrate Speci 3e-06
2gee_A203 Crystal Structure Of Human Type Iii Fibronectin Ext 6e-06
3a5k_A 304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 1e-05
1g1f_A 298 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-05
3zv2_A 320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 1e-05
1ptv_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-05
1oeo_X 321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 1e-05
1i57_A 310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 1e-05
3eu0_A 327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 1e-05
1ptu_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-05
1een_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-05
1aax_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-05
1pa1_A 310 Crystal Structure Of The C215d Mutant Of Protein Ty 1e-05
2nt7_A 299 Crystal Structure Of Ptp1b-inhibitor Complex Length 1e-05
2azr_A 299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 1e-05
1bzh_A 298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 1e-05
1ecv_A 298 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-05
1g7g_A 298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 1e-05
2cm2_A 304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 1e-05
1g7f_A 298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 1e-05
2fjm_A 310 The Structure Of Phosphotyrosine Phosphatase 1b In 1e-05
1l8g_A 321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 1e-05
1q6j_A 310 The Structure Of Phosphotyrosine Phosphatase 1b In 1e-05
1bzc_A 321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 1e-05
2cma_A 327 Structural Basis For Inhibition Of Protein Tyrosine 1e-05
1nl9_A 321 Potent, Selective Protein Tyrosine Phosphatase 1b I 1e-05
1bzj_A 297 Human Ptp1b Complexed With Tpicooh Length = 297 1e-05
3qkp_A 321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 1e-05
3sme_A 300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 1e-05
2f6f_A 302 The Structure Of The S295f Mutant Of Human Ptp1b Le 1e-05
1a5y_A 330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 1e-05
1lqf_A 295 Structure Of Ptp1b In Complex With A Peptidic Bisph 1e-05
4i8n_A 354 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-05
3cwe_A 290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 2e-05
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 7e-05
2oc3_A 303 Crystal Structure Of The Catalytic Domain Of Human 1e-04
1nwl_A 298 Crystal Structure Of The Ptp1b Complexed With Sp734 2e-04
3r8q_A290 Structure Of Fibronectin Domain 12-14 Length = 290 2e-04
1fnh_A271 Crystal Structure Of Heparin And Integrin Binding S 3e-04
1l8k_A 314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 7e-04
3ew3_B221 The 1:2 Complex Between A Nterminal Elongated Prola 7e-04
3npz_B220 Prolactin Receptor (Prlr) Complexed With The Natura 7e-04
1f6f_B210 Crystal Structure Of The Ternary Complex Between Ov 7e-04
2shp_A 525 Tyrosine Phosphatase Shp-2 Length = 525 8e-04
3d42_A 308 Crystal Structure Of Heptp In Complex With A Monoph 8e-04
3b7o_A 316 Crystal Structure Of The Human Tyrosine Phosphatase 9e-04
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure 
Iteration: 1

 Score =  155 bits (391), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 76/92 (82%)
Query: 1005 TSRPIRLENFAEHYRIMSAXXXXXXXXXXXXLKHVGREQSCTAADLPCNRPKNRFTNILP 1064
             SRPI ++NFAEHYR+MSA            LKHVGR+Q CT ADLPCNRPKNRFTNILP
Sbjct: 22   ASRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILP 81
Query: 1065 YDHSRFKLQPVDDEEGSDYINANYVPGHNSPR 1096
            YDHSRFKLQPVDD+EGSDYINANYVPGHNSPR
Sbjct: 82   YDHSRFKLQPVDDDEGSDYINANYVPGHNSPR 113
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 Back     alignment and structure
>pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|3T1W|A Chain A, Structure Of The Four-Domain Fragment Fn7b89 Of Oncofetal Fibronectin Length = 375 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|4GH7|B Chain B, Crystal Structure Of Anticalin N7a In Complex With Oncofetal Fibronectin Fragment Fn7b8 Length = 285 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|2GEE|A Chain A, Crystal Structure Of Human Type Iii Fibronectin Extradomain B And Domain 8 Length = 203 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|3R8Q|A Chain A, Structure Of Fibronectin Domain 12-14 Length = 290 Back     alignment and structure
>pdb|1FNH|A Chain A, Crystal Structure Of Heparin And Integrin Binding Segment Of Human Fibronectin Length = 271 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|3EW3|B Chain B, The 1:2 Complex Between A Nterminal Elongated Prolactin And Cellular Domain Of The Rat Prolactin Receptor Length = 221 Back     alignment and structure
>pdb|3NPZ|B Chain B, Prolactin Receptor (Prlr) Complexed With The Natural Hormone (Prl) Length = 220 Back     alignment and structure
>pdb|1F6F|B Chain B, Crystal Structure Of The Ternary Complex Between Ovine Placental Lactogen And The Extracellular Domain Of The Rat Prolactin Receptor Length = 210 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1189
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 1e-51
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 8e-45
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 4e-12
2gjt_A 295 Receptor-type tyrosine-protein phosphatase PTPro; 2e-43
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 2e-22
3i36_A 342 Vascular protein tyrosine phosphatase 1; PTP, hydr 3e-43
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 4e-22
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 5e-42
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-41
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-40
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 9e-32
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 7e-27
1yfo_A 302 D1, receptor protein tyrosine phosphatase alpha; h 2e-41
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 1e-20
2ooq_A 286 Receptor-type tyrosine-protein phosphatase T; prot 8e-41
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 8e-21
3s3e_A 307 Tyrosine-protein phosphatase 10D; differentiation, 9e-41
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 7e-23
2hc1_A 291 Receptor-type tyrosine-protein phosphatase beta; p 2e-39
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 1e-20
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 3e-39
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-26
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-18
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 3e-17
2oc3_A 303 Tyrosine-protein phosphatase non-receptor type 18; 1e-38
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 4e-18
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 3e-38
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 5e-20
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-18
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 4e-17
2h4v_A 320 Receptor-type tyrosine-protein phosphatase gamma; 3e-36
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 3e-20
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 2e-35
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 3e-21
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 8e-19
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 7e-18
2pa5_A 314 Tyrosine-protein phosphatase non-receptor type 9; 3e-35
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 6e-21
2i1y_A 301 Receptor-type tyrosine-protein phosphatase; recept 1e-34
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 1e-19
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 1e-34
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 2e-22
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 1e-18
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-18
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-33
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 4e-32
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 8e-31
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-25
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 4e-11
2bzl_A 325 Tyrosine-protein phosphatase, non-receptor type 14 2e-32
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 1e-20
1wch_A 315 Protein tyrosine phosphatase, non-receptor type 13 2e-31
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 2e-20
1jln_A 297 STEP-like ptpase, protein tyrosine phosphatase, re 3e-31
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 8e-20
2p6x_A 309 Tyrosine-protein phosphatase non-receptor type 22; 5e-31
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 5e-20
2cm2_A 304 Tyrosine-protein phosphatase non-receptor type 1; 2e-30
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 1e-17
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-29
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 6e-29
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 6e-28
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-27
1l8k_A 314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 2e-29
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 5e-21
2b49_A 287 Protein tyrosine phosphatase, non-receptor type 3; 1e-28
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 1e-20
1zc0_A 309 Tyrosine-protein phosphatase, non-receptor type 7; 5e-28
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 8e-20
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 2e-27
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 4e-21
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 3e-19
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 5e-13
3b7o_A 316 Tyrosine-protein phosphatase non-receptor type 11; 2e-27
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 5e-19
3m4u_A 306 Tyrosine specific protein phosphatase, putative; p 7e-27
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 1e-20
2cjz_A 305 Human protein tyrosine phosphatase PTPN5; protein 2e-26
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 1e-20
2i75_A 320 Tyrosine-protein phosphatase non-receptor type 4; 3e-26
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 3e-20
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 9e-26
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-25
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-21
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-14
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-10
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 6e-07
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-05
1fpr_A 284 Protein-tyrosine phosphatase 1C; protein tyrosine 5e-25
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 1e-19
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 7e-25
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 2e-17
1p15_A 253 Protein-tyrosine phosphatase alpha; transmembrane, 4e-24
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 7e-21
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 5e-24
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 3e-20
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 9e-23
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 2e-19
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 8e-20
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-17
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 8e-15
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-10
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 8e-10
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-19
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-19
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-17
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 5e-16
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 5e-11
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-09
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 4e-19
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 2e-09
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 6e-09
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 7e-05
1lyv_A 306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 1e-17
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 5e-15
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-17
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 8e-14
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-09
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 9e-09
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-16
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-09
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-06
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 2e-05
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-04
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 6e-16
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-12
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 5e-12
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 4e-06
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-05
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 1e-15
1g4w_R 383 Protein tyrosine phosphatase SPTP; virulence facto 2e-14
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 5e-15
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 2e-14
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 2e-11
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 3e-08
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 1e-07
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 6e-05
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 8e-15
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 6e-14
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 5e-13
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 4e-12
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 9e-11
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 3e-07
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 2e-14
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 1e-04
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 7e-14
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 4e-09
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 8e-09
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-13
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 7e-10
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-08
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 6e-06
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 2e-13
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 7e-10
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 2e-04
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 4e-13
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 1e-09
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 3e-06
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 1e-04
2erj_C247 Cytokine receptor common gamma chain; immune syste 1e-12
2erj_C247 Cytokine receptor common gamma chain; immune syste 1e-06
2erj_C247 Cytokine receptor common gamma chain; immune syste 2e-04
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 1e-12
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 1e-06
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 3e-12
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 2e-10
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 1e-09
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 2e-04
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 7e-04
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 3e-12
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 1e-09
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 4e-09
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 6e-06
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-04
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 3e-12
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 6e-07
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-06
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 9e-05
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 3e-12
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 6e-10
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-08
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-06
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 3e-06
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 7e-06
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 4e-12
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-09
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 8e-04
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 4e-12
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 7e-06
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 2e-04
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 7e-04
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 6e-12
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 1e-06
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 9e-12
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 5e-07
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 9e-05
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 3e-11
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 6e-07
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 1e-04
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 3e-04
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 4e-11
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 4e-09
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 3e-06
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-04
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 5e-11
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-10
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-05
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-05
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 8e-05
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 5e-11
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-07
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-05
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 1e-10
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-10
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-07
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 4e-06
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 8e-06
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 3e-10
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 1e-07
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 3e-05
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 3e-10
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 3e-09
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 7e-05
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-04
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-04
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 3e-10
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 2e-09
3k2m_C101 Monobody HA4; engineered binding protein, antibody 6e-10
3k2m_C101 Monobody HA4; engineered binding protein, antibody 4e-06
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 6e-10
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 9e-09
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 1e-09
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 8e-07
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 1e-04
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 1e-09
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 1e-05
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 4e-04
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 2e-09
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 2e-09
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 1e-06
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 4e-04
3t04_D103 Monobody 7C12; engineered binding protein, antibod 3e-09
3t04_D103 Monobody 7C12; engineered binding protein, antibod 2e-08
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 4e-09
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 2e-05
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 6e-09
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 7e-09
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 1e-07
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 3e-05
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 4e-05
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 1e-04
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 4e-04
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 7e-09
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 5e-06
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 8e-09
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 1e-08
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 2e-08
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 2e-08
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-08
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 6e-06
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 2e-08
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 1e-07
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-08
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 4e-04
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 3e-08
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 6e-07
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 3e-08
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 4e-06
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 3e-08
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 3e-08
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 4e-06
1x4x_A106 Fibronectin type-III domain containing protein 3A; 4e-08
1x4x_A106 Fibronectin type-III domain containing protein 3A; 9e-06
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 5e-08
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 6e-05
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 6e-08
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 3e-05
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 6e-08
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 6e-08
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-04
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 6e-08
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 5e-04
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 1e-07
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-06
1x5x_A109 Fibronectin type-III domain containing protein 3A; 1e-07
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-07
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 8e-04
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 1e-07
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 8e-06
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 2e-07
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 2e-07
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 6e-05
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-07
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 8e-07
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 2e-07
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 2e-07
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 3e-04
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 2e-07
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 2e-07
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 3e-07
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 8e-04
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 3e-07
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 1e-04
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 3e-07
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 3e-07
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 3e-07
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 8e-05
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 4e-07
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 1e-05
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 5e-07
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 2e-05
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 5e-07
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 7e-06
1x3d_A118 Fibronectin type-III domain containing protein 3A; 6e-07
1x3d_A118 Fibronectin type-III domain containing protein 3A; 8e-04
2gys_A419 Cytokine receptor common beta chain; dimer of inte 7e-07
2gys_A419 Cytokine receptor common beta chain; dimer of inte 7e-05
2gys_A419 Cytokine receptor common beta chain; dimer of inte 3e-04
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 9e-07
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 5e-05
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-06
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-04
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 1e-06
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 2e-06
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 4e-05
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 1e-06
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 1e-06
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 1e-06
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 2e-06
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 1e-05
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-06
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 2e-06
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 2e-06
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 2e-06
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 3e-06
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 3e-06
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 3e-06
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 4e-06
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 4e-06
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 4e-06
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 6e-06
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 8e-06
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 5e-04
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-05
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 2e-05
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 2e-05
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 2e-05
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 7e-04
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-05
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 3e-05
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 4e-05
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 2e-04
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 4e-05
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 5e-05
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 5e-05
2crm_A120 Fibronectin type-III domain containing protein 3A; 7e-05
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 8e-05
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 1e-04
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 2e-04
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 2e-04
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 2e-04
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 3e-04
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 6e-04
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 8e-04
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 8e-04
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
 Score =  185 bits (472), Expect = 1e-51
 Identities = 76/400 (19%), Positives = 146/400 (36%), Gaps = 49/400 (12%)

Query: 82  PVLDLTAVMDDKTGDLFISWKPDNASYQDMYKISIKSILLEEEHQKQFLMGFLGDCDNGS 141
           P  +L    +  TG L +SW+         Y+I+      ++ +  + ++          
Sbjct: 5   PPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVH--------- 55

Query: 142 KISYVEIETLNGDSNQMFVDKTEYVLESLLPGRKYSINVQAVSNGMES--------PSFP 193
                              D++    ++L PG +Y+++V  V +  ES        P  P
Sbjct: 56  ------------------ADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPEVP 97

Query: 194 IIEDLRPIEFG---LNISWKSDVNSRQDNFEVIY-NRNDTITEDPITVVTTDSKLLLENL 249
            + DL  ++     + + W    +S    + +      + I      V ++     +  L
Sbjct: 98  QLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGL 157

Query: 250 YPGAGYSIQVFAISHGLRSEPHDYFQAVYPKPPTNLTLEKTSSNAVLVKWKEPVGSIFTE 309
            PG  Y I V  + +G  S P    Q     PPT+L       + + V W  P     T 
Sbjct: 158 EPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTN 217

Query: 310 YSIRYRTEEDKTWVRLPNV-GTSLEAEVTDMVPGEKCMIQVNSVSYSVESAHPLQINHTI 368
           + +RY   +++  V   ++  +     +T+++PG + ++ V+SV    ES        T 
Sbjct: 218 FLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTG 277

Query: 369 SPNPATYVAALVDASNVTLEFPRPEGRIEYYLVTWRGIGPEATSTELFTKNVTNDPEDKD 428
             +P     + + A++ T+ +  P   I  Y +      PE  S       V +      
Sbjct: 278 LDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHH---PEHFSGRPREDRVPHS----- 329

Query: 429 KHVHILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMP 468
               I +  LTPG +Y  +I  ++   ES +      T+ 
Sbjct: 330 -RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVS 368
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Length = 229 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1189
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 100.0
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 100.0
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 100.0
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 100.0
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 100.0
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 100.0
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 100.0
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 100.0
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 100.0
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 99.97
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 99.97
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.97
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.97
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.97
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.97
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.97
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.96
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.96
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.96
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.96
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.95
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.95
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 99.95
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 99.95
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 99.95
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.94
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 99.94
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 99.94
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.94
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.94
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.93
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 99.93
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 99.93
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 99.93
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.93
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.93
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.92
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.92
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.92
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.92
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.92
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 99.92
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.92
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 99.92
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.92
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 99.91
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.91
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.91
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.91
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.91
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.91
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.91
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.91
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.91
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.91
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.9
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.9
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.9
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.87
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.85
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.84
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.83
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.83
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.82
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.82
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.82
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.8
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.8
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.79
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.79
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.79
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.79
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.78
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.78
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.78
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.78
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 99.77
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.77
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.77
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.77
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.76
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.76
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.76
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.75
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.75
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.75
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.75
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.75
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.73
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.72
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.72
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.71
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.69
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.69
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.69
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.69
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.66
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.6
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.57
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.57
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.56
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.55
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.55
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.52
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.47
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.43
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.4
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.4
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.39
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.35
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.34
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.26
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.26
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.25
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.25
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.25
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.23
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.21
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.21
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.21
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.2
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.19
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.18
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.17
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.17
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.17
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.17
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.17
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.17
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.15
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.15
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.14
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.13
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.13
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.13
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.13
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.12
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.12
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.12
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.12
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.12
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.12
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.12
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.11
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.11
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.11
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.11
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.11
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.11
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.11
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.1
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.1
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.1
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.1
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.1
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.1
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.1
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.1
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.1
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.1
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.09
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.09
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.09
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.08
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.08
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.08
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.08
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.08
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.07
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.07
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.07
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.07
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.07
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.07
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.07
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.07
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.07
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.07
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.07
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.06
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.06
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.06
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.06
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.06
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.06
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.06
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.06
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.06
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.06
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.06
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.06
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.05
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.05
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.05
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.05
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.05
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.05
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.05
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.05
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.05
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.04
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.04
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.04
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.04
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.04
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.04
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.04
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.03
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.03
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.03
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.03
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.03
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.03
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.02
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.02
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.02
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.02
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.02
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.01
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.01
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.01
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.01
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.01
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.01
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.01
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.0
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.0
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.0
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.0
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 98.99
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 98.99
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 98.99
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 98.98
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 98.97
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 98.97
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 98.97
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 98.97
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 98.96
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 98.96
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 98.96
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 98.96
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 98.96
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 98.95
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 98.94
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 98.94
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 98.94
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 98.93
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 98.93
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 98.92
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 98.92
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 98.92
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 98.92
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 98.91
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 98.91
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 98.91
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 98.9
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 98.9
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 98.89
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 98.89
2erj_C247 Cytokine receptor common gamma chain; immune syste 98.89
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 98.89
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 98.89
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 98.88
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 98.87
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 98.86
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 98.84
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 98.84
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 98.83
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.81
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 98.77
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 98.77
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 98.76
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 98.75
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 98.74
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 98.74
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 98.73
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.72
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.7
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 98.7
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 98.69
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 98.69
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 98.66
2erj_C247 Cytokine receptor common gamma chain; immune syste 98.63
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 98.63
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.57
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 98.57
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.5
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 98.5
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 98.49
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 98.49
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.46
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.45
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.41
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 98.4
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.39
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.38
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 98.37
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.35
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 98.31
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 98.31
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 98.3
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.28
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.27
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.25
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.22
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.14
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 98.14
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.07
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.07
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.06
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 98.06
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 98.05
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 98.03
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.02
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 97.98
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 97.85
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 97.81
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 97.73
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 97.58
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 97.55
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 97.55
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 97.48
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 97.39
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 96.24
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 95.62
3b4n_A344 Endo-pectate lyase; pectin, galacturonic acid, rig 95.62
3b4n_A344 Endo-pectate lyase; pectin, galacturonic acid, rig 95.57
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 95.45
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 95.2
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 95.17
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 95.02
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 94.95
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 94.24
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 94.22
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 93.6
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 93.6
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 93.39
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 92.78
2uvf_A608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 92.42
2q05_A195 Late protein H1, dual specificity protein phosphat 92.05
2uvf_A608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 92.03
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 90.82
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 90.66
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 90.45
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 88.95
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 88.93
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 88.55
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 88.28
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 87.77
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 87.59
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 87.32
3cm3_A176 Late protein H1, dual specificity protein phosphat 86.64
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 83.92
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 82.99
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 82.92
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 81.45
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
Probab=100.00  E-value=6.8e-37  Score=357.31  Aligned_cols=356  Identities=21%  Similarity=0.261  Sum_probs=293.8

Q ss_pred             CCCCCcceEEEeeeCC-eEEEEeeCCCCCcccEEEEEEEeCCCc--ceEEeccCCCccEEEecCCCCCCeEEEEEEEEEc
Q psy4951         278 YPKPPTNLTLEKTSSN-AVLVKWKEPVGSIFTEYSIRYRTEEDK--TWVRLPNVGTSLEAEVTDMVPGEKCMIQVNSVSY  354 (1189)
Q Consensus       278 ~p~pP~~l~v~~~t~~-sv~vsW~~p~~g~i~~Y~V~~~~~~~~--~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~~~  354 (1189)
                      |+.||.+|++...+.+ ++.|+|++|.++.+.+|+|+|+..++.  .+.........+++.+++|.|++.|.|+|+|.+.
T Consensus         2 P~~~P~~l~~~~~~~~~sv~l~W~~~~~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~a~~~   81 (375)
T 3t1w_A            2 PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKD   81 (375)
T ss_dssp             CCCCCEEEEEEEETTTTEEEEEEECCSCSSCCEEEEEEEETTCTTSCCEEEEEETTCCEEEECCCCTTCCEEEEEEEEET
T ss_pred             CCCCCCccEEEecCCCeEEEEEEeCCCCCCeeeEEEEEEECCCCCCcceeEEcCCCccEEEEcCCcCCCEEEEEEEEEcC
Confidence            6789999999999999 999999999877899999999987542  2233334445689999999999999999999999


Q ss_pred             CccCCCceeEEeecCCCCccce-EEeecCcEEEEEeeCCC-cceeEEEEEEEeeccCCCCcceEeeeecCCCCCCCCceE
Q psy4951         355 SVESAHPLQINHTISPNPATYV-AALVDASNVTLEFPRPE-GRIEYYLVTWRGIGPEATSTELFTKNVTNDPEDKDKHVH  432 (1189)
Q Consensus       355 ~g~s~~~~~~~~~t~p~pp~~l-~~~~~~~sv~lsW~~p~-g~i~~Y~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  432 (1189)
                      ++.+..........+| +|.++ ....+.+++.|+|+++. +.+.+|.|+|.   ..+.........+..      ..++
T Consensus        82 ~g~s~~~~~~~~~~~p-~p~~l~~~~~~~~si~l~W~~~~~~~i~~Y~v~~~---~~~~~~~~~~~~~~~------~~~~  151 (375)
T 3t1w_A           82 DKESVPISDTIIPEVP-QLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVV---AAGEGIPIFEDFVDS------SVGY  151 (375)
T ss_dssp             TEECCCEEEEECCCCC-CCSCCEEECCCSSEEEEECCCCCCTTEEEEEEEEE---ESSSCCSCEEEEECT------TCCE
T ss_pred             CCCCCcEEeeEcCCCC-CCceEEEEecCCCeEEEEEECCCCCCceEEEEEEE---ECCCCCceeEEEcCC------Ccce
Confidence            9888755444433444 46666 66778999999999984 68999999998   333332222223322      5678


Q ss_pred             EEecCCCCCCeEEEEEEEEeCCccCcceEEEEEcCCCCccceEEEeeccCCCEEEEEEEcCCCCCeeEEEEEEEcCC--C
Q psy4951         433 ILIDQLTPGVKYQFTIRTVSYNLESGVTSLSARTMPLIESEVLVVNNQQSTDSVTLRYTPQNSNHFDFYRFTLSEPD--I  510 (1189)
Q Consensus       433 ~~i~~L~p~t~Y~v~V~a~~~~~~s~~~~~~~~t~P~~p~~~~v~~~~~t~~sv~vsW~p~~~g~i~~Y~V~~~~~~--~  510 (1189)
                      +.+.+|.|++.|.|+|+|.+..|.+.+......+.|++|.++.+..  .+.+++.|+|+++.++.+.+|+|+|+..+  .
T Consensus       152 ~~i~~L~p~t~Y~~~V~a~~~~g~s~~s~~~~~t~~~~p~~l~~~~--~~~~si~l~W~~p~~~~i~~Y~v~~~~~~~~~  229 (375)
T 3t1w_A          152 YTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTN--IGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEE  229 (375)
T ss_dssp             EEEECCCTTCEEEEEEEEEETTEECCCEEEEEECCCCCCEEEEEES--CCSSCEEEEEECCSSCCCCEEEEEEEEGGGTT
T ss_pred             EEEeCCCCCCEEEEEEEEEeCCcccCCeeeeeecCCCCCceeEEEe--cccCEEEEEEcCCCCCCccEEEEEEEeCCCCC
Confidence            9999999999999999999999999988888888777777776654  48999999999766678999999998654  3


Q ss_pred             CeEEEEecCCcceEEEeCCCCCCeEEEEEEEEeCCcCCCcEEEeeccCCCCCcceEEEEEeCcEEEEEeeCCCCCCceEE
Q psy4951         511 PVIEKAANDTDRKVTFNNLTPGKLYNFTVWTVADGVLSTPIQRHDRLYPEPITRINATEITDTSVSLTWDSPRGEYNAFE  590 (1189)
Q Consensus       511 ~~~~~~~~~~~~~~~l~~L~p~t~Y~v~V~a~~~~~~S~~~~~~~~t~p~~P~~l~v~~v~~~sv~l~W~~p~g~i~~Y~  590 (1189)
                      .+.........+++.+.+|.|++.|.|+|+|.++.+.+.+......+.|.+|.++.+..++.+++.|+|++|.+.+.+|.
T Consensus       230 ~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~~~~g~s~~~~~~~~t~p~~P~~l~~~~~~~~sv~l~W~~p~~~~~~Y~  309 (375)
T 3t1w_A          230 DVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYR  309 (375)
T ss_dssp             CCEEEEECTTCCEEEECSCCTTCEEEEEEEEEETTEECCCEEEEEECCCCCCEEEEEESCCSSCEEEEEECCSSCCSEEE
T ss_pred             CcEEEEcCCCcCEEEeCCCCCCCEEEEEEEEEcCCCcCCceeeEEecCCCCCCccEeeeccCCEEEEEECCCCcceeeEE
Confidence            44555666778999999999999999999999999999998888889999999999998999999999999999999999


Q ss_pred             EEEEcCCC----eEEEeeccccEEEEcCCCCCCEEEEEEEEEeCCCcceeeeccceeEEEEecc
Q psy4951         591 VQYLNTEG----FLIQNLTLHTSIVIGDLKPHRNYTFTVIVRSGTESSVLRRSLPVSAIFQTHE  650 (1189)
Q Consensus       591 V~~~~~~~----~~~~~~~~~~~~~l~~L~p~t~Y~~~V~A~~~~g~~~~~~s~~~s~~~~T~~  650 (1189)
                      |.|...++    .........+.+++.||.|++.|.|+|+|+++.|     .+.+.+..+.|..
T Consensus       310 v~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~~~~G-----~s~p~s~~~~~~~  368 (375)
T 3t1w_A          310 IRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGRE-----ESPLLIGQQSTVS  368 (375)
T ss_dssp             EEEEETTCCSSCEEEEEETTCCEEEECSCCTTCEEEEEEEEEETTE-----ECCCEEEEEECCC
T ss_pred             EEEEECCCCCcceeEEcCCCccEEEECCCCCCCEEEEEEEEECCCC-----CCCceeeeeEEee
Confidence            99988753    2333446788999999999999999999999998     8888888777653
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1189
d1lara1 317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 1e-25
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 1e-13
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-25
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 6e-13
d1yfoa_ 288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 6e-25
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 8e-13
d2f71a1 297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 1e-23
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 9e-11
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 2e-21
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 1e-13
d1l8ka_ 273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 5e-21
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-13
d1p15a_ 245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 2e-19
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 1e-12
d1jlna_ 297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 2e-19
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 3e-13
d1wcha_ 308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 2e-18
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 3e-13
d2shpa1 307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 6e-18
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 8e-12
d1fpra_ 284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 9e-18
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-12
d1lyva_ 283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 1e-11
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 1e-08
d2pt0a1 313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 2e-11
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 5e-11
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 7e-04
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 5e-10
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 8e-08
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 1e-05
d1erna2105 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor 3e-07
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 5e-07
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 5e-06
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 0.003
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 5e-07
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 2e-06
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 2e-06
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 2e-06
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 2e-04
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 2e-04
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 3e-06
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 3e-04
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 3e-06
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 0.002
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 0.002
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 3e-06
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 7e-06
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 5e-04
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 4e-06
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 1e-05
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 0.004
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 1e-05
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 0.003
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 2e-05
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 3e-05
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 2e-05
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 6e-05
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 3e-05
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-05
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 1e-04
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 4e-05
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 6e-05
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 6e-04
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 6e-05
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 6e-05
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 8e-04
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 6e-05
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 0.003
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 6e-05
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 9e-05
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 7e-05
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 4e-04
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 9e-05
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 1e-04
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 1e-04
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 1e-04
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 8e-04
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 1e-04
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 2e-04
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 2e-04
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 3e-04
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 3e-04
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 4e-04
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 3e-04
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 5e-04
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 0.004
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 5e-04
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 7e-04
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 0.002
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 8e-04
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 0.001
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 0.001
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 0.001
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 0.001
d3d85d394 b.1.2.1 (D:212-305) The p40 domain of interleukin- 0.002
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 0.002
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 0.002
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 0.002
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 0.002
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 0.002
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 0.002
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 0.004
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: RPTP Lar
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  106 bits (266), Expect = 1e-25
 Identities = 43/170 (25%), Positives = 79/170 (46%), Gaps = 11/170 (6%)

Query: 1011 LENFAEHYRIMSADSDFRFSEEFEELKHVGREQSCTAADLPCNRPKNRFTNILPYDHSRF 1070
            + + A++   + A+   +FS+E+E +   G++ +   ++L  N+PKNR+ N++ YDHSR 
Sbjct: 2    ITDLADNIERLKANDGLKFSQEYESID-PGQQFTWENSNLEVNKPKNRYANVIAYDHSRV 60

Query: 1071 KLQPVDDEEGSDYINANYVPGHNSPRR--------SGTLIALDRILQSINHSDVVDIFGI 1122
             L  +D   GSDYINANY+ G+               T+    R++     + VV +  +
Sbjct: 61   ILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRL 120

Query: 1123 VYHMRK--ERVWMVQTEQQYICIHQCLLAVLEGNENQLPLREIHHNQGYE 1170
                R   ++ W  +  +    I   LL  +E     +    +H +   E
Sbjct: 121  EEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGSSE 170
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1189
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 99.96
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 99.95
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 99.94
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 99.94
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 99.94
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 99.93
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 99.93
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 99.93
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 99.92
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 99.76
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.61
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.32
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.24
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.21
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.21
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.2
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.2
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.19
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.18
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.18
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.18
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.17
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.17
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.16
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.15
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.15
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.14
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.14
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.14
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.14
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.14
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.14
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.14
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.12
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.12
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.12
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.12
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.11
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.11
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.11
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.1
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.1
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.09
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.09
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.09
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.09
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.09
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.09
d2crza197 Fibronectin type-III domain containing protein 3a, 99.08
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.08
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.07
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.07
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.07
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.07
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.07
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.07
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.07
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.07
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.06
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.06
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.06
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.06
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.06
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.06
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.05
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.05
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.04
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.03
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.02
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.02
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.02
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.02
d2crza197 Fibronectin type-III domain containing protein 3a, 99.02
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.01
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.01
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.0
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.99
d2crma1107 Fibronectin type-III domain containing protein 3a, 98.99
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.99
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.98
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 98.97
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.97
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.97
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.96
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.95
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.95
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 98.94
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 98.94
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.94
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.93
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.93
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 98.92
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.91
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 98.91
d1va9a1109 Down syndrome cell adhesion molecule-like protein 98.9
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.9
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 98.9
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.89
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 98.89
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.89
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.89
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 98.89
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.89
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.88
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 98.88
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.88
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.87
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.87
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.86
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.85
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.85
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.83
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.83
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 98.82
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 98.8
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 98.8
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 98.79
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.79
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.76
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 98.76
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 98.76
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.75
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.75
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.75
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 98.74
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 98.74
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 98.73
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 98.7
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 98.69
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.65
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.64
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 98.63
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.61
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 98.6
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 98.6
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 98.59
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 98.58
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.58
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 98.57
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.57
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.57
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.57
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.56
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.54
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 98.53
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.48
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.48
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.46
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.38
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.37
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 98.36
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.29
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.29
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.21
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.21
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.11
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.1
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.07
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 97.96
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 97.72
d2pt0a1 313 Myo-inositol hexaphosphate phosphohydrolase (phyta 96.84
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 95.44
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 94.9
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 94.75
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 94.39
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 94.29
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 93.67
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 93.66
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 93.35
d2hfta1106 Extracellular region of human tissue factor {Human 93.16
d1a21a1103 Extracellular region of human tissue factor {Rabbi 92.88
d2hfta1106 Extracellular region of human tissue factor {Human 92.75
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 92.53
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 92.44
d1a21a1103 Extracellular region of human tissue factor {Rabbi 92.2
d2c4fu1116 Extracellular region of human tissue factor {Human 90.82
d2c4fu1116 Extracellular region of human tissue factor {Human 90.21
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 90.18
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 89.75
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 85.15
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: RPTP Lar
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=1.1e-30  Score=289.24  Aligned_cols=155  Identities=37%  Similarity=0.722  Sum_probs=143.9

Q ss_pred             hhhHHHHHHHHHhCCCcchHHHHHHccccCCCcceecccCCCCCCCCCCCCCCCCCCCeEEecCCCCCCCCcccccccCC
Q psy4951        1011 LENFAEHYRIMSADSDFRFSEEFEELKHVGREQSCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVP 1090 (1189)
Q Consensus      1011 ~~~~~~~~~~~~~~~~~~~~~E~~~l~~~~~~~~~~~~~~~~n~~knR~~~v~~~d~~RV~L~~~~~~~~~dYInAs~v~ 1090 (1189)
                      +.+|.++++++++++..+|.+||+.|.. ....++.++..++|+.||||.||+||||+||+|+..++.+++||||||||+
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~e~~~i~~-~~~~~~~~~~~~~N~~KNR~~~i~p~D~sRV~L~~~~~~~~~~YInAs~v~   80 (317)
T d1lara1           2 ITDLADNIERLKANDGLKFSQEYESIDP-GQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYID   80 (317)
T ss_dssp             HHHHHHHHHHHSSTTTHHHHHHHHHCCC-CCCCCCHHHHSTTTGGGCSSTTCCCCTTTBCCCCCCTTSTTTTCCSEEEEE
T ss_pred             HHHHHHHHHHHhhCccchHHHHHHhCCC-CCCcchhhccChhhhhhcCCCCCCCCcCcEEEecCCCCCCcccceeeeEee
Confidence            6789999999999988899999999975 556788899999999999999999999999999987777889999999999


Q ss_pred             CCCCCC--------------------------------------------------------------------------
Q psy4951        1091 GHNSPR-------------------------------------------------------------------------- 1096 (1189)
Q Consensus      1091 ~~~~~~-------------------------------------------------------------------------- 1096 (1189)
                      |+...+                                                                          
T Consensus        81 g~~~~~~fI~tQ~Pl~~T~~dFW~MV~e~~v~~IVmL~~~~e~~~~kc~~Ywp~~~~~~~g~~~v~~~~~~~~~~~~~r~  160 (317)
T d1lara1          81 GYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRT  160 (317)
T ss_dssp             ETTEEEEEEEECCCCTTTHHHHHHHHHHTTCCEEEECSCSEETTEECCCCCSCSSSEEEETTEEEEEEEEEECSSEEEEE
T ss_pred             cCCCCCEEEEECCCchHhHHHHHHHHHhcccceEEEeccccccCccccccCCCCCCceEeeeEEEEEEEEEECCCeEEEE
Confidence            998654                                                                          


Q ss_pred             -------------------------------------------------------------CcceEEeHHHHHHHhcCCC
Q psy4951        1097 -------------------------------------------------------------RSGTLIALDRILQSINHSD 1115 (1189)
Q Consensus      1097 -------------------------------------------------------------rtg~fi~~~~~~~~~~~~~ 1115 (1189)
                                                                                   |||+|||+|+++++++.++
T Consensus       161 l~v~~~~~~~~r~V~h~~y~~Wpd~~~P~~~~~~l~~i~~v~~~~~~~~~PivVHCs~GvGRtG~f~al~~~~~~l~~~~  240 (317)
T d1lara1         161 FALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEK  240 (317)
T ss_dssp             EEEEETTSCCEEEEEEEEECCSCSSSCCSCSHHHHHHHHHHHHHSCTTCCCEEEESSSSSSHHHHHHHHHHHHHHHHHHS
T ss_pred             EEEEECCCCceEEEEEEEecCcccCCCCCCHHHHHHHHHHHHHhhcCCCCcEEEEecccccceeeeehhHhHHHHHhcCC
Confidence                                                                         9999999999999999999


Q ss_pred             CCCHHHHHHHHHhCccccccChhhhhhHHHHHHHHHhcCCCcCCccccccc
Q psy4951        1116 VVDIFGIVYHMRKERVWMVQTEQQYICIHQCLLAVLEGNENQLPLREIHHN 1166 (1189)
Q Consensus      1116 ~~dv~~~v~~~r~~R~~~v~~~~Qy~f~y~~~~~~~~~~~~~~~~~~~~~~ 1166 (1189)
                      .+||+++|++||+||++|||+.+||.|||++|++|+..++++++.+++...
T Consensus       241 ~vdv~~~v~~lR~qR~~~V~t~~QY~fiy~~lle~~~~~~~~~~~~~~~~~  291 (317)
T d1lara1         241 TVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLYAH  291 (317)
T ss_dssp             CCCHHHHHHHHHTTSTTSSCSHHHHHHHHHHHHHHHHHCCCCEEGGGHHHH
T ss_pred             CCCHHHHHHHHHhhcccccCCHHHHHHHHHHHHHHHHhCCCCCcHHHHHHH
Confidence            999999999999999999999999999999999999999998888776655
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure