Psyllid ID: psy4998


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPALHIAAKKDDCKAAALLLENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANVNNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETTIVTTTVTTIEEKYRVVAPEAMQEVYMSDSEDEGGRKQ
cccccccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHHcccEEEcccccccccccc
ccHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHcHccccccccccccccHHHHHHHccccEEEEEEccccccccccc
MAAQENHDGVVRYLLskggnqtlatedgfTPLAVAMQQGHDRVVAVLLEndtkgkvklpalhIAAKKDDCKAAALLLendhspdvksnshftplHIAAHYGNTNIAELLIQKHANvnnqakhnitplhVACKWGKVAMVELLISkganieaktrdgltplhcaarsghdNVIDILIEKGAALYsktkagftplhiashfGQLNMVRYLVENganvnattnlgytplhqasqQGRVLIIDLLlgagaqpnattnhgQTALNIAQKLGYISVIETLKIVTETTIVTTTVTTIEEKYRVVAPEAMQEVYmsdsedeggrkq
MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPALHIAAKKDDCKAAALLLENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANVNNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIvtettivtttvttieekyrvvapeamqevymsdsedeggrkq
MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPALHIaakkddckaaalllENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANVNNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISvietlkivtettivtttvttieeKYRVVAPEAMQEVYMSDSEDEGGRKQ
*********VVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPALHIAAKKDDCKAAALLLEN*********SHFTPLHIAAHYGNTNIAELLIQKHANVNNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETT*************************************
MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPALHIAAKKDDCKAAALLLENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANVNNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETTIVTTTVTTIEEKYRVVAPEAMQEVYMSD*********
********GVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPALHIAAKKDDCKAAALLLENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANVNNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETTIVTTTVTTIEEKYRVVAPEAMQEV*************
****ENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPALHIAAKKDDCKAAALLLENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANVNNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETTIVTTTVTTIEEKYRVVAPEAMQEVYMSD*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPALHIAAKKDDCKAAALLLENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANVNNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETTIVTTTVTTIEEKYRVVAPEAMQEVYMSDSEDEGGRKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query318 2.2.26 [Sep-21-2011]
Q12955 4377 Ankyrin-3 OS=Homo sapiens yes N/A 0.836 0.060 0.580 8e-86
G5E8K5 1961 Ankyrin-3 OS=Mus musculus yes N/A 0.836 0.135 0.583 5e-85
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.861 0.069 0.567 6e-81
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.861 0.070 0.563 7e-80
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.833 0.140 0.529 2e-76
Q02357 1862 Ankyrin-1 OS=Mus musculus no N/A 0.833 0.142 0.529 3e-76
Q8NFD2765 Ankyrin repeat and protei no N/A 0.864 0.359 0.342 6e-39
Q4UMH61179 Putative ankyrin repeat p yes N/A 0.827 0.223 0.355 5e-36
Q8BZ25745 Ankyrin repeat and protei no N/A 0.817 0.348 0.343 2e-35
Q9ERK0786 Receptor-interacting seri no N/A 0.861 0.348 0.344 2e-30
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function desciption
 Score =  317 bits (812), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 159/274 (58%), Positives = 206/274 (75%)

Query: 1   MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPA 60
           MAAQENH  VV++LL  G +Q+LATEDGFTPLAVA+QQGHD+VV++LLENDTKGKV+LPA
Sbjct: 146 MAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA 205

Query: 61  LHIAAKKDDCKAAALLLENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANVNNQA 120
           LHIAA+KDD KAAALLL+ND++ DV+S S FTPLHIAAHYGN N+A LL+ + A V+  A
Sbjct: 206 LHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTA 265

Query: 121 KHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGA 180
           +++ITPLHVA K G   MV+LL+ +GA I+AKTRDGLTPLHC ARSGH+ V+++L+++ A
Sbjct: 266 RNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAA 325

Query: 181 ALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDL 240
            + SKTK G +PLH+A+    LN V+ L+++   V+  TN   T LH A+  G   +  +
Sbjct: 326 PILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKV 385

Query: 241 LLGAGAQPNATTNHGQTALNIAQKLGYISVIETL 274
           LL   A PNA   +G T L+IA K   I V+E L
Sbjct: 386 LLDKKANPNAKALNGFTPLHIACKKNRIKVMELL 419




Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments.
Homo sapiens (taxid: 9606)
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description
>sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
332022332 7686 Ankyrin-2 [Acromyrmex echinatior] 0.849 0.035 0.686 1e-103
345488337 7482 PREDICTED: hypothetical protein LOC10012 0.849 0.036 0.689 1e-102
340713436 6672 PREDICTED: hypothetical protein LOC10064 0.849 0.040 0.682 1e-102
350425715 4893 PREDICTED: hypothetical protein LOC10074 0.849 0.055 0.682 1e-102
383847150 874 PREDICTED: ankyrin-2 [Megachile rotundat 0.849 0.308 0.682 1e-98
322778809 1346 hypothetical protein SINV_06859 [Solenop 0.849 0.200 0.678 3e-98
189235752 2692 PREDICTED: similar to ankyrin 2,3/unc44 0.849 0.100 0.664 2e-97
161082106 4189 ankyrin 2, isoform J [Drosophila melanog 0.852 0.064 0.582 3e-97
161082096 4114 ankyrin 2, isoform F [Drosophila melanog 0.852 0.065 0.582 3e-97
320545662 4329 ankyrin 2, isoform S [Drosophila melanog 0.852 0.062 0.582 4e-97
>gi|332022332|gb|EGI62644.1| Ankyrin-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/274 (68%), Positives = 211/274 (77%)

Query: 1   MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPA 60
           MAAQENHD VV+YLL KG NQTLATEDGFTPLAVAMQQGHD+VVAVLLENDT+GKV+LPA
Sbjct: 107 MAAQENHDSVVKYLLCKGANQTLATEDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPA 166

Query: 61  LHIAAKKDDCKAAALLLENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANVNNQA 120
           LHIAAKKDDCKAAALLL+NDH+PDV S S FTPLHIAAHYGN  IA LL  K A+VN  A
Sbjct: 167 LHIAAKKDDCKAAALLLQNDHNPDVTSKSGFTPLHIAAHYGNDRIASLLYDKGADVNFAA 226

Query: 121 KHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGA 180
           KHNITP+HVA KWGK+ MV LL+SKGANIEAKTRDGLTPLHCAARSGH  V+DILIEKGA
Sbjct: 227 KHNITPMHVAAKWGKIKMVNLLMSKGANIEAKTRDGLTPLHCAARSGHHEVVDILIEKGA 286

Query: 181 ALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDL 240
            + SKTK G  PLH+AS    ++  R L+ + A V+  T    T LH A+  G V +  L
Sbjct: 287 PIGSKTKNGLAPLHMASQGDHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKL 346

Query: 241 LLGAGAQPNATTNHGQTALNIAQKLGYISVIETL 274
           LL   A PNA   +G T L+IA K   I V+E L
Sbjct: 347 LLDRNADPNARALNGFTPLHIACKKNRIKVVELL 380




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345488337|ref|XP_001606081.2| PREDICTED: hypothetical protein LOC100122475 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340713436|ref|XP_003395249.1| PREDICTED: hypothetical protein LOC100642686 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350425715|ref|XP_003494210.1| PREDICTED: hypothetical protein LOC100742486, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|383847150|ref|XP_003699218.1| PREDICTED: ankyrin-2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|322778809|gb|EFZ09225.1| hypothetical protein SINV_06859 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|189235752|ref|XP_001807645.1| PREDICTED: similar to ankyrin 2,3/unc44 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|161082106|ref|NP_001097538.1| ankyrin 2, isoform J [Drosophila melanogaster] gi|158028469|gb|ABW08487.1| ankyrin 2, isoform J [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|161082096|ref|NP_001097535.1| ankyrin 2, isoform F [Drosophila melanogaster] gi|158028467|gb|ABW08485.1| ankyrin 2, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|320545662|ref|NP_001189064.1| ankyrin 2, isoform S [Drosophila melanogaster] gi|318069159|gb|ADV37501.1| ankyrin 2, isoform S [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
WB|WBGene00006780 6994 unc-44 [Caenorhabditis elegans 0.830 0.037 0.568 8.9e-74
UNIPROTKB|F1NJ80 1699 ANK3 "Uncharacterized protein" 0.830 0.155 0.549 6.9e-71
UNIPROTKB|F1NNX8 1737 ANK3 "Uncharacterized protein" 0.830 0.151 0.549 7.3e-71
UNIPROTKB|F1NNX6 1824 ANK3 "Uncharacterized protein" 0.830 0.144 0.549 8.1e-71
UNIPROTKB|F1NNX7 1915 ANK3 "Uncharacterized protein" 0.830 0.137 0.549 9e-71
ZFIN|ZDB-GENE-041010-165 3538 ank2b "ankyrin 2b, neuronal" [ 0.827 0.074 0.550 1.2e-70
UNIPROTKB|F1NA51 2890 ANK3 "Uncharacterized protein" 0.830 0.091 0.549 1.8e-70
UNIPROTKB|K7GLA8 1847 ANK3 "Uncharacterized protein" 0.830 0.142 0.541 4.5e-70
MGI|MGI:88026 1961 Ank3 "ankyrin 3, epithelial" [ 0.830 0.134 0.545 9.3e-70
RGD|620156 843 Ank2 "ankyrin 2, neuronal" [Ra 0.827 0.311 0.538 1.4e-69
WB|WBGene00006780 unc-44 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 766 (274.7 bits), Expect = 8.9e-74, P = 8.9e-74
 Identities = 150/264 (56%), Positives = 191/264 (72%)

Query:     1 MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTKGKVKLPA 60
             MAAQENH+ VV+YLL  G NQ L+TEDGFTPLAVA+QQGHDRVVAVLLEND+KGKV+LPA
Sbjct:   138 MAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPA 197

Query:    61 LHIXXXXXXXXXXXXXXENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANVNNQA 120
             LHI              +N+H+PDV S S FTPLHIAAHYG+ N+ +LL++K ANVN QA
Sbjct:   198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA 257

Query:   121 KHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGA 180
             +HNI+PLHVA KWG+  M  LL+S+GA I+++T+D LTPLHCAARSGHD V+D+L+ +GA
Sbjct:   258 RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGA 317

Query:   181 ALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDL 240
              + +KTK G  PLH+A+    ++  R L+ + A V+  T    TPLH A+  G V +  L
Sbjct:   318 PISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKL 377

Query:   241 LLGAGAQPNATTNHGQTALNIAQK 264
             LL   A PN+   +G T L+IA K
Sbjct:   378 LLDRSADPNSRALNGFTPLHIACK 401


GO:0007165 "signal transduction" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0040017 "positive regulation of locomotion" evidence=IMP
GO:0040018 "positive regulation of multicellular organism growth" evidence=IMP
GO:0010171 "body morphogenesis" evidence=IMP
GO:0040011 "locomotion" evidence=IMP
GO:0040010 "positive regulation of growth rate" evidence=IMP
GO:0007126 "meiosis" evidence=IMP
GO:0016358 "dendrite development" evidence=IMP
GO:0007411 "axon guidance" evidence=IMP
GO:0016328 "lateral plasma membrane" evidence=IDA
GO:0033563 "dorsal/ventral axon guidance" evidence=IGI
GO:0050839 "cell adhesion molecule binding" evidence=IPI
UNIPROTKB|F1NJ80 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX8 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX6 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX7 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-165 ank2b "ankyrin 2b, neuronal" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NA51 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|K7GLA8 ANK3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:88026 Ank3 "ankyrin 3, epithelial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620156 Ank2 "ankyrin 2, neuronal" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
G5E8K5ANK3_MOUSENo assigned EC number0.58390.83640.1356yesN/A
Q12955ANK3_HUMANNo assigned EC number0.58020.83640.0607yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-40
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-39
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-36
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-36
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-34
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-28
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-25
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-25
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-23
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-22
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-22
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-22
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-21
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 9e-20
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-19
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-18
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-18
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-16
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-16
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-15
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 6e-15
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-14
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 6e-14
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 4e-13
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 9e-13
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-12
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 7e-12
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 8e-12
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-11
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 9e-11
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 1e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-09
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-09
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-08
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-08
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-08
PHA02716 764 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provi 4e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-08
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 5e-08
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 5e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-07
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 3e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 8e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 9e-07
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-06
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 2e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-06
PHA02989 494 PHA02989, PHA02989, ankyrin repeat protein; Provis 4e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-06
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
smart0024830 smart00248, ANK, ankyrin repeats 2e-05
PHA02989 494 PHA02989, PHA02989, ankyrin repeat protein; Provis 3e-05
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 4e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 9e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 2e-04
PHA02795437 PHA02795, PHA02795, ankyrin-like protein; Provisio 2e-04
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 3e-04
smart0024830 smart00248, ANK, ankyrin repeats 3e-04
smart0024830 smart00248, ANK, ankyrin repeats 3e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 3e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 5e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 7e-04
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 0.001
PHA02743166 PHA02743, PHA02743, Viral ankyrin protein; Provisi 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 0.003
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 0.003
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  137 bits (347), Expect = 1e-40
 Identities = 55/126 (43%), Positives = 87/126 (69%)

Query: 117 NNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILI 176
           N + +   TPLH+A   G + +V+LL+  GA++ AK  DG TPLH AA++GH  ++ +L+
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLL 60

Query: 177 EKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVL 236
           EKGA + ++ K G TPLH+A+  G L++V+ L+++GA+VNA    G TPLH A++ G + 
Sbjct: 61  EKGADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLE 120

Query: 237 IIDLLL 242
           ++ LLL
Sbjct: 121 VVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165089 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165157 PHA02795, PHA02795, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222925 PHA02743, PHA02743, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 318
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510|consensus 929 100.0
KOG0510|consensus 929 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG4177|consensus 1143 100.0
KOG0508|consensus 615 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
KOG0508|consensus 615 100.0
KOG4177|consensus 1143 100.0
KOG0509|consensus 600 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
KOG0509|consensus 600 100.0
PHA02859209 ankyrin repeat protein; Provisional 100.0
PHA02795437 ankyrin-like protein; Provisional 100.0
PHA02795 437 ankyrin-like protein; Provisional 99.98
PHA02859209 ankyrin repeat protein; Provisional 99.97
KOG4369|consensus 2131 99.96
PLN03192823 Voltage-dependent potassium channel; Provisional 99.96
KOG0502|consensus296 99.95
KOG0502|consensus296 99.95
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.95
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.95
KOG0507|consensus 854 99.95
PLN03192823 Voltage-dependent potassium channel; Provisional 99.94
KOG0507|consensus 854 99.93
PHA02743166 Viral ankyrin protein; Provisional 99.92
KOG0505|consensus 527 99.92
PHA02741169 hypothetical protein; Provisional 99.9
KOG0505|consensus 527 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
KOG4369|consensus 2131 99.9
KOG0514|consensus452 99.89
PHA02741169 hypothetical protein; Provisional 99.88
PHA02884300 ankyrin repeat protein; Provisional 99.88
KOG0514|consensus452 99.88
PHA02884300 ankyrin repeat protein; Provisional 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.86
KOG0512|consensus228 99.85
KOG3676|consensus 782 99.84
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.82
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.81
KOG0512|consensus228 99.81
KOG0195|consensus 448 99.78
KOG3676|consensus 782 99.78
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.78
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.77
KOG0195|consensus 448 99.75
KOG4214|consensus117 99.72
KOG4214|consensus117 99.65
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.62
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.59
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.56
KOG1710|consensus 396 99.56
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.55
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.55
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.52
KOG0515|consensus752 99.5
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.47
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.43
KOG0515|consensus752 99.41
KOG1710|consensus396 99.35
KOG0783|consensus 1267 99.07
KOG0818|consensus 669 99.05
KOG0506|consensus622 99.05
KOG0782|consensus1004 99.02
PF1360630 Ank_3: Ankyrin repeat 98.98
KOG0783|consensus 1267 98.91
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.89
PF1360630 Ank_3: Ankyrin repeat 98.84
KOG0782|consensus1004 98.81
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.74
KOG0818|consensus 669 98.72
KOG0506|consensus622 98.71
KOG0522|consensus 560 98.69
KOG0705|consensus749 98.64
KOG3609|consensus 822 98.58
KOG2384|consensus223 98.54
KOG3609|consensus 822 98.53
KOG0705|consensus749 98.52
KOG2384|consensus 223 98.49
KOG0521|consensus785 98.44
KOG0522|consensus 560 98.44
KOG0511|consensus 516 98.42
KOG0521|consensus785 98.22
KOG0511|consensus 516 98.13
KOG0520|consensus 975 98.09
KOG0520|consensus 975 97.83
KOG2505|consensus591 97.81
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.65
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.51
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.28
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.89
KOG2505|consensus591 96.79
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 96.71
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.58
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.03
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.78
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 89.07
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 88.29
PLN03218 1060 maturation of RBCL 1; Provisional 86.13
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 84.39
PLN03218 1060 maturation of RBCL 1; Provisional 82.7
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 82.34
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=5e-47  Score=331.11  Aligned_cols=281  Identities=26%  Similarity=0.318  Sum_probs=263.4

Q ss_pred             CccccChHHHHHHHHhcCCCCCcCCCCCCCHHHHHHHcC---CHHHHHHHHhcCCC----CCCChhHHHHHHhCC-CHHH
Q psy4998           1 MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQG---HDRVVAVLLENDTK----GKVKLPALHIAAKKD-DCKA   72 (318)
Q Consensus         1 lA~~~g~~~~v~~Ll~~g~~~~~~~~~~~t~l~~A~~~g---~~~~~~~ll~~~~~----~~~~~~~l~~A~~~~-~~~~   72 (318)
                      +|+..++.++|++|+++|++++..+..|.||||+|+..|   +.+++++|++.|++    +..|.||||+|+..| +.++
T Consensus        20 ~~~~~~~~~~v~~Ll~~ga~vn~~~~~g~t~Lh~a~~~~~~~~~~iv~~Ll~~Gadin~~~~~g~TpLh~A~~~~~~~~i   99 (471)
T PHA03095         20 LNASNVTVEEVRRLLAAGADVNFRGEYGKTPLHLYLHYSSEKVKDIVRLLLEAGADVNAPERCGFTPLHLYLYNATTLDV   99 (471)
T ss_pred             HcCCCCCHHHHHHHHHcCCCcccCCCCCCCHHHHHHHhcCCChHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCcHHH
Confidence            367889999999999999999999999999999999999   99999999998765    457899999999999 5999


Q ss_pred             HHHHHhCCCCCCCCCCCCchHHHHHH--HcCCHHHHHHHHhccCCcccccCCCChHHHHHHHcC--cHHHHHHHHHcCCC
Q psy4998          73 AALLLENDHSPDVKSNSHFTPLHIAA--HYGNTNIAELLIQKHANVNNQAKHNITPLHVACKWG--KVAMVELLISKGAN  148 (318)
Q Consensus        73 ~~~ll~~~~~~~~~~~~~~~~l~~a~--~~~~~~~~~~ll~~~~~~~~~~~~~~~~l~~a~~~~--~~~~~~~L~~~~~~  148 (318)
                      +++|+++|++++..+..|.||||+|+  ..++.+++++|++.|++++..+..|.||||.|+..+  +.+++++|++.|.+
T Consensus       100 v~lLl~~ga~in~~~~~g~tpLh~a~~~~~~~~~iv~~Ll~~gad~~~~d~~g~tpL~~a~~~~~~~~~iv~~Ll~~g~~  179 (471)
T PHA03095        100 IKLLIKAGADVNAKDKVGRTPLHVYLSGFNINPKVIRLLLRKGADVNALDLYGMTPLAVLLKSRNANVELLRLLIDAGAD  179 (471)
T ss_pred             HHHHHHcCCCCCCCCCCCCCHHHHHhhCCcCCHHHHHHHHHcCCCCCccCCCCCCHHHHHHHcCCCCHHHHHHHHHcCCC
Confidence            99999999999999999999999999  556889999999999999999999999999998866  68999999999999


Q ss_pred             CCccCCCCChHHHHHHHc--CCHHHHHHHHHcCCCCcCCCCCCCcHhHHHhhcCCH--HHHHHHHHcCCCCCcCCCCCCC
Q psy4998         149 IEAKTRDGLTPLHCAARS--GHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQL--NMVRYLVENGANVNATTNLGYT  224 (318)
Q Consensus       149 ~~~~~~~~~~~l~~a~~~--~~~~~~~~ll~~~~~~~~~~~~~~t~l~~a~~~~~~--~~~~~Ll~~g~~~~~~~~~g~t  224 (318)
                      ++..+..|.|+||.++..  +..++++.|++.|++++.++..|.||||+|+..++.  .+++.|++.|++++.++..|.|
T Consensus       180 ~~~~d~~g~t~Lh~~~~~~~~~~~i~~~Ll~~g~~~~~~d~~g~tpLh~Aa~~~~~~~~~v~~ll~~g~din~~d~~g~T  259 (471)
T PHA03095        180 VYAVDDRFRSLLHHHLQSFKPRARIVRELIRAGCDPAATDMLGNTPLHSMATGSSCKRSLVLPLLIAGISINARNRYGQT  259 (471)
T ss_pred             CcccCCCCCCHHHHHHHHCCCcHHHHHHHHHcCCCCcccCCCCCCHHHHHHhcCCchHHHHHHHHHcCCCCCCcCCCCCC
Confidence            998899999999999875  678999999999999999999999999999998874  6888999999999999999999


Q ss_pred             HHHHHHHcCCHhHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHhhhccccc
Q psy4998         225 PLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETT  281 (318)
Q Consensus       225 ~l~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~~~~l~~~~~~~  281 (318)
                      |||+|+..|+.+++++|+++|++++..|..|.||+++|+..|+.+++++|.......
T Consensus       260 pLh~A~~~~~~~~v~~LL~~gad~n~~~~~g~tpl~~A~~~~~~~~v~~LL~~~~~~  316 (471)
T PHA03095        260 PLHYAAVFNNPRACRRLIALGADINAVSSDGNTPLSLMVRNNNGRAVRAALAKNPSA  316 (471)
T ss_pred             HHHHHHHcCCHHHHHHHHHcCCCCcccCCCCCCHHHHHHHhCCHHHHHHHHHhCCCH
Confidence            999999999999999999999999999999999999999999999999998876553



>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 7e-55
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-22
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-29
2xeh_A157 Structural Determinants For Improved Thermal Stabil 7e-29
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-28
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-27
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 8e-15
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 9e-27
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-25
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-13
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 8e-25
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 9e-25
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-24
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-24
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 7e-24
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-23
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-23
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-23
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-23
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-14
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 8e-23
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 4e-22
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 8e-23
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 6e-14
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-22
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-22
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-22
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 1e-21
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-21
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-21
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 9e-20
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 9e-20
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 6e-19
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-18
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-15
1uoh_A226 Human Gankyrin Length = 226 1e-18
1uoh_A226 Human Gankyrin Length = 226 2e-15
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-18
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 4e-18
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 4e-18
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-15
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-17
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-15
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-17
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 6e-17
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-15
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-16
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 1e-16
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-16
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-16
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-16
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-16
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-16
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-15
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-15
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-15
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-14
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-15
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-15
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-14
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-15
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-14
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 7e-15
1wdy_A 285 Crystal Structure Of Ribonuclease Length = 285 4e-05
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 7e-15
4g8k_A 337 Intact Sensor Domain Of Human Rnase L In The Inacti 3e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-14
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-14
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-13
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-13
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 7e-07
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-13
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 6e-06
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-13
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-07
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 2e-13
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 2e-13
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 3e-13
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 2e-12
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 2e-05
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 4e-12
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 4e-11
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 4e-10
2xen_A91 Structural Determinants For Improved Thermal Stabil 4e-11
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 5e-11
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 7e-10
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 4e-10
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 4e-10
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 4e-10
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 4e-10
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 5e-10
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 5e-10
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 4e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 1e-09
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-07
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 1e-09
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 2e-07
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-09
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 2e-09
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 6e-08
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 2e-06
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-09
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-09
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 2e-09
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 5e-07
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 2e-09
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 6e-08
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 2e-06
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-09
3uxg_A172 Crystal Structure Of Rfxank Length = 172 9e-09
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-07
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 9e-09
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 3e-08
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 5e-06
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 9e-09
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-08
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-06
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-08
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-07
1ycs_B239 P53-53bp2 Complex Length = 239 3e-08
1ycs_B239 P53-53bp2 Complex Length = 239 2e-07
1ycs_B239 P53-53bp2 Complex Length = 239 4e-06
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 4e-08
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 4e-08
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-07
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 3e-06
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 8e-08
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 9e-08
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 6e-07
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 1e-07
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 1e-07
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-07
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 6e-07
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 1e-07
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 5e-06
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-07
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 4e-06
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 3e-07
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 7e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 6e-07
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 1e-04
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 7e-06
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 1e-05
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 3e-05
1bi7_B156 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 5e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 6e-05
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 7e-05
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 6e-04
3ljn_A 364 Ankyrin Repeat Protein From Leishmania Major Length 8e-05
3deo_A183 Structural Basis For Specific Substrate Recognition 8e-05
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 9e-05
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 2e-04
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 1e-04
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 1e-04
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 1e-04
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 2e-04
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 1e-04
1dc2_A156 Solution Nmr Structure Of Tumor Suppressor P16ink4a 5e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 8e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 210 bits (535), Expect = 7e-55, Method: Compositional matrix adjust. Identities = 126/318 (39%), Positives = 175/318 (55%), Gaps = 9/318 (2%) Query: 1 MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDT----KGKV 56 +AA+E H V LL K +Q T+ GFTPL VA + G RV +LLE D GK Sbjct: 119 IAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN 178 Query: 57 KLPALHIXXXXXXXXXXXXXXENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANV 116 L LH+ SP + + +TPLHIAA +A L+Q + Sbjct: 179 GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSA 238 Query: 117 NNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILI 176 N ++ +TPLH+A + G MV LL+SK AN + GLTPLH A+ GH V D+LI Sbjct: 239 NAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI 298 Query: 177 EKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVL 236 + G + + T+ G+TPLH+ASH+G + +V++L+++ A+VNA T LGY+PLHQA+QQG Sbjct: 299 KHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTD 358 Query: 237 IIDLLLGAGAQPNATTNHGQTALNIAQKLGYISXXXXXXXXXXXXXXXXXXXXXXXKYRV 296 I+ LLL GA PN ++ G T L IA++LGYIS K+R+ Sbjct: 359 IVTLLLKNGASPNEVSSDGTTPLAIAKRLGYIS----VTDVLKVVTDETSFVLVSDKHRM 414 Query: 297 VAPEAMQEVYMSDSEDEG 314 PE + E+ + SEDEG Sbjct: 415 SFPETVDEI-LDVSEDEG 431
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|1BI7|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structure Of The Cdk6-P16ink4a Tumor Suppressor Complex Length = 156 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|1DC2|A Chain A, Solution Nmr Structure Of Tumor Suppressor P16ink4a, 20 Structures Length = 156 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-104
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-93
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-90
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-83
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-29
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-85
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-51
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-79
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-75
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-74
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-70
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-61
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-79
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-72
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-66
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-55
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 9e-34
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-77
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-76
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-76
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-62
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-54
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-54
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-74
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-67
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-55
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-32
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-73
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-71
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-67
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-47
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-72
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-72
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-69
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-65
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-55
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-72
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-70
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-49
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-72
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-72
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-66
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-55
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-54
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-38
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-72
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-71
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-59
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-33
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-70
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-62
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-38
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-25
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-70
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-66
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-62
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-62
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-33
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-25
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-69
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-63
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-62
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-22
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 6e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-69
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-68
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-43
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-67
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-65
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-41
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-35
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-65
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-58
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-57
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-41
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-65
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-59
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-53
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-49
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-38
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-64
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-59
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-53
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-33
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-62
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-57
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-49
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-43
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-17
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-61
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-59
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-47
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-37
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-36
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-60
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-58
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-50
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-42
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-42
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-60
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-59
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-56
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-55
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-41
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-19
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-58
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-57
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-49
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-41
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-10
2rfa_A232 Transient receptor potential cation channel subfa 2e-56
2rfa_A232 Transient receptor potential cation channel subfa 9e-53
2rfa_A232 Transient receptor potential cation channel subfa 2e-26
2rfa_A232 Transient receptor potential cation channel subfa 1e-14
2rfa_A 232 Transient receptor potential cation channel subfa 4e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-55
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-54
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-50
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-41
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-55
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-55
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-50
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-55
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-49
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-49
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-42
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-35
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-55
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-53
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-48
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-35
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-54
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-51
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-48
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-40
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-27
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-53
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-50
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-39
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-39
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-27
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-53
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-48
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-47
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-38
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-32
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-53
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-50
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-19
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 9e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-51
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-46
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-46
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-43
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-31
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-50
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-48
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-41
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-41
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-48
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-46
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-42
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-41
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-27
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-14
2etb_A256 Transient receptor potential cation channel subfam 2e-47
2etb_A256 Transient receptor potential cation channel subfam 2e-41
2etb_A256 Transient receptor potential cation channel subfam 9e-29
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-47
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-47
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-42
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-37
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-23
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-45
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-36
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-35
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-29
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-44
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-43
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-40
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-31
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-27
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-43
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-41
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-41
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-36
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-27
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-09
2pnn_A273 Transient receptor potential cation channel subfa 2e-43
2pnn_A273 Transient receptor potential cation channel subfa 5e-39
2pnn_A273 Transient receptor potential cation channel subfa 2e-34
2pnn_A273 Transient receptor potential cation channel subfa 4e-27
2pnn_A273 Transient receptor potential cation channel subfa 3e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-43
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-41
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-37
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-36
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-19
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-42
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-36
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-28
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-17
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-38
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-34
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-30
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-35
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-34
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-33
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-27
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-15
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-35
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-31
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-27
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-34
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-34
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-30
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-26
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-19
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-17
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-16
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-16
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-18
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-17
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-15
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-17
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-16
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 7e-15
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-14
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-14
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-13
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  310 bits (797), Expect = e-104
 Identities = 135/318 (42%), Positives = 193/318 (60%), Gaps = 9/318 (2%)

Query: 1   MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLEN----DTKGKV 56
           +AA+E H   V  LL K  +Q   T+ GFTPL VA + G  RV  +LLE     +  GK 
Sbjct: 119 IAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN 178

Query: 57  KLPALHIAAKKDDCKAAALLLENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANV 116
            L  LH+A   ++     LLL    SP   + + +TPLHIAA      +A  L+Q   + 
Sbjct: 179 GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSA 238

Query: 117 NNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILI 176
           N ++   +TPLH+A + G   MV LL+SK AN     + GLTPLH  A+ GH  V D+LI
Sbjct: 239 NAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI 298

Query: 177 EKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVL 236
           + G  + + T+ G+TPLH+ASH+G + +V++L+++ A+VNA T LGY+PLHQA+QQG   
Sbjct: 299 KHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTD 358

Query: 237 IIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETTIVTTTVTTIEEKYRV 296
           I+ LLL  GA PN  ++ G T L IA++LGYISV + LK+VT+     T+   + +K+R+
Sbjct: 359 IVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTD----ETSFVLVSDKHRM 414

Query: 297 VAPEAMQEVYMSDSEDEG 314
             PE + E+ +  SEDEG
Sbjct: 415 SFPETVDEI-LDVSEDEG 431


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
1awc_B153 Protein (GA binding protein beta 1); complex (tran 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.96
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.87
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.78
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 86.63
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=6.1e-53  Score=364.51  Aligned_cols=307  Identities=42%  Similarity=0.689  Sum_probs=203.2

Q ss_pred             ccccChHHHHHHHHhcCCCCCcCCCCCCCHHHHHHHcCCHHHHHHHHhcCCC----CCCChhHHHHHHhCCCHHHHHHHH
Q psy4998           2 AAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTK----GKVKLPALHIAAKKDDCKAAALLL   77 (318)
Q Consensus         2 A~~~g~~~~v~~Ll~~g~~~~~~~~~~~t~l~~A~~~g~~~~~~~ll~~~~~----~~~~~~~l~~A~~~~~~~~~~~ll   77 (318)
                      |++.|+.++|++|+++|++++..+..|.||||+|+..|+.+++++|++.+..    +..+.||||+|+..|+.+++++|+
T Consensus        87 A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll  166 (437)
T 1n11_A           87 AARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLL  166 (437)
T ss_dssp             HHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHH
T ss_pred             HHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHHHHH
Confidence            6666777777777777777666666666666666666666666666665432    333445555555555555555555


Q ss_pred             hCCCCCCCCCCCCc---------------------------------hHHHHHHHcCCHHHHHHHHhccCCcccccCCCC
Q psy4998          78 ENDHSPDVKSNSHF---------------------------------TPLHIAAHYGNTNIAELLIQKHANVNNQAKHNI  124 (318)
Q Consensus        78 ~~~~~~~~~~~~~~---------------------------------~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~  124 (318)
                      ++|.+++..+..|.                                 ||||+|+..++.+++++|++.+.+++..+..|.
T Consensus       167 ~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~  246 (437)
T 1n11_A          167 ERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGV  246 (437)
T ss_dssp             HTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCC
T ss_pred             hCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCC
Confidence            55555555444444                                 555555555555555555555555555555566


Q ss_pred             hHHHHHHHcCcHHHHHHHHHcCCCCCccCCCCChHHHHHHHcCCHHHHHHHHHcCCCCcCCCCCCCcHhHHHhhcCCHHH
Q psy4998         125 TPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQLNM  204 (318)
Q Consensus       125 ~~l~~a~~~~~~~~~~~L~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~t~l~~a~~~~~~~~  204 (318)
                      |||+.|+..|+.+++++|++.+.+++..+..|.||||+|+..|+.+++++|+++|++++..+..|.||||+|+..|+.++
T Consensus       247 t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~  326 (437)
T 1n11_A          247 TPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKL  326 (437)
T ss_dssp             CHHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHSSCSHH
T ss_pred             CHHHHHHHCCCHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCCCCCCCCCHHHHHHHcCcHHH
Confidence            66666666666666666666666666666677777777777777777777777777777777778888888888888888


Q ss_pred             HHHHHHcCCCCCcCCCCCCCHHHHHHHcCCHhHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHhhhccccceec
Q psy4998         205 VRYLVENGANVNATTNLGYTPLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETTIVT  284 (318)
Q Consensus       205 ~~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~~~~l~~~~~~~~~~  284 (318)
                      +++|+++|++++.++..|.||||+|+..|+.+++++|+++|++++.+|..|.||+++|.+.|+.+++++|+.......  
T Consensus       327 v~~Ll~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~g~~~~~~~l~~~~~~~~--  404 (437)
T 1n11_A          327 VKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETS--  404 (437)
T ss_dssp             HHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHHHHCCCCS--
T ss_pred             HHHHHhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHhcccccc--
Confidence            888888888888888888888888888888888888888888888888888888888888888888888876654322  


Q ss_pred             cchhhhccccccccccccceeeeecccc
Q psy4998         285 TTVTTIEEKYRVVAPEAMQEVYMSDSED  312 (318)
Q Consensus       285 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~  312 (318)
                        .....++++...++.+.+.+...+++
T Consensus       405 --~~~~~~~~~~~~~~~~~~~~~~~~~~  430 (437)
T 1n11_A          405 --FVLVSDKHRMSFPETVDEILDVSEDE  430 (437)
T ss_dssp             --SCC----CCCCCCCCCCC--------
T ss_pred             --ccccchhcccCCccccchhhcccccc
Confidence              23355677777888888866555444



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 318
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-56
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-49
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-45
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-44
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-34
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-38
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-33
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-23
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-35
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-34
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-29
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-28
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-29
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-25
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-20
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-14
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-27
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-27
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-27
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-16
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-27
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-20
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-19
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.004
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-26
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-23
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-18
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-24
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-20
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-09
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-21
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-21
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-21
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-19
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-18
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-17
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-17
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-15
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.001
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-17
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-15
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-13
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-16
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-16
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-13
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-11
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 4e-13
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 4e-12
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 5e-12
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-12
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-10
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-10
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.004
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-10
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-09
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-08
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 6e-09
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 3e-07
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 7e-07
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 3e-05
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  185 bits (470), Expect = 3e-56
 Identities = 130/308 (42%), Positives = 186/308 (60%), Gaps = 8/308 (2%)

Query: 1   MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLEN----DTKGKV 56
           +AA+E H   V  LL K  +Q   T+ GFTPL VA + G  RV  +LLE     +  GK 
Sbjct: 105 IAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN 164

Query: 57  KLPALHIAAKKDDCKAAALLLENDHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQKHANV 116
            L  LH+A   ++     LLL    SP   + + +TPLHIAA      +A  L+Q   + 
Sbjct: 165 GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSA 224

Query: 117 NNQAKHNITPLHVACKWGKVAMVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILI 176
           N ++   +TPLH+A + G   MV LL+SK AN     + GLTPLH  A+ GH  V D+LI
Sbjct: 225 NAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI 284

Query: 177 EKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNATTNLGYTPLHQASQQGRVL 236
           + G  + + T+ G+TPLH+ASH+G + +V++L+++ A+VNA T LGY+PLHQA+QQG   
Sbjct: 285 KHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTD 344

Query: 237 IIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETTIVTTTVTTIEEKYRV 296
           I+ LLL  GA PN  ++ G T L IA++LGYISV + LK+VT+     T+   + +K+R+
Sbjct: 345 IVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTD----ETSFVLVSDKHRM 400

Query: 297 VAPEAMQE 304
             PE + E
Sbjct: 401 SFPETVDE 408


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 100.0
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.98
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.95
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=6.9e-48  Score=328.06  Aligned_cols=281  Identities=42%  Similarity=0.683  Sum_probs=229.0

Q ss_pred             CccccChHHHHHHHHhcCCCCCcCCCCCCCHHHHHHHcCCHHHHHHHHhcCCC----CCCChhHHHHHHhCCCHHHHHH-
Q psy4998           1 MAAQENHDGVVRYLLSKGGNQTLATEDGFTPLAVAMQQGHDRVVAVLLENDTK----GKVKLPALHIAAKKDDCKAAAL-   75 (318)
Q Consensus         1 lA~~~g~~~~v~~Ll~~g~~~~~~~~~~~t~l~~A~~~g~~~~~~~ll~~~~~----~~~~~~~l~~A~~~~~~~~~~~-   75 (318)
                      +||..|++++|++|+++|++++..|..|.||||+|+..|+.+++++|+++|++    +..+.|||++|+..|+.+++++ 
T Consensus         6 ~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~~~~g~t~L~~A~~~g~~~~~~~L   85 (408)
T d1n11a_           6 VASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLL   85 (408)
T ss_dssp             HHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHHHHHHH
T ss_pred             HHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHH
Confidence            48999999999999999999999999999999999999999999999998654    4556677777777766655554 


Q ss_pred             -----------------------------------------------------------------HHhCCCCCCCCCCCC
Q psy4998          76 -----------------------------------------------------------------LLENDHSPDVKSNSH   90 (318)
Q Consensus        76 -----------------------------------------------------------------ll~~~~~~~~~~~~~   90 (318)
                                                                                       |++++.+++..+..+
T Consensus        86 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~  165 (408)
T d1n11a_          86 LENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNG  165 (408)
T ss_dssp             HHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSC
T ss_pred             HHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCCCCcCCCcC
Confidence                                                                             444455555555566


Q ss_pred             chHHHHHHHcCCHHHHHHHHhccCCcccccC---------------------------------CCChHHHHHHHcCcHH
Q psy4998          91 FTPLHIAAHYGNTNIAELLIQKHANVNNQAK---------------------------------HNITPLHVACKWGKVA  137 (318)
Q Consensus        91 ~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~---------------------------------~~~~~l~~a~~~~~~~  137 (318)
                      .+||++|+..++.+++++|+++|++++..+.                                 .+.||++.|+..+..+
T Consensus       166 ~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~~~~~~~  245 (408)
T d1n11a_         166 LTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAE  245 (408)
T ss_dssp             CCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHH
T ss_pred             chHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHHHHhCcHh
Confidence            6666666666666666666666655433222                                 2334455555555555


Q ss_pred             HHHHHHHcCCCCCccCCCCChHHHHHHHcCCHHHHHHHHHcCCCCcCCCCCCCcHhHHHhhcCCHHHHHHHHHcCCCCCc
Q psy4998         138 MVELLISKGANIEAKTRDGLTPLHCAARSGHDNVIDILIEKGAALYSKTKAGFTPLHIASHFGQLNMVRYLVENGANVNA  217 (318)
Q Consensus       138 ~~~~L~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~g~~~~~  217 (318)
                      +++++...+...+..+..|.+|++.++..++.+++++|+++|++++..+..+.|||+.++..++.++++++++.|++++.
T Consensus       246 ~~~~~~~~~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~~~~~~~~~t~L~~~~~~~~~~~~~~ll~~g~~in~  325 (408)
T d1n11a_         246 MVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNA  325 (408)
T ss_dssp             HHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHSSCSHHHHHHHHTTCCTTC
T ss_pred             HhhhhhccccccccccCCCCChhhhhhhcCcHHHHHHHHHCCCccccccccccccchhhcccCcceeeeeeccccccccc
Confidence            55555555555556666778899999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCHHHHHHHcCCHhHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHhhhccccc
Q psy4998         218 TTNLGYTPLHQASQQGRVLIIDLLLGAGAQPNATTNHGQTALNIAQKLGYISVIETLKIVTETT  281 (318)
Q Consensus       218 ~~~~g~t~l~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~~~~l~~~~~~~  281 (318)
                      +|..|.||||+|++.|+.+++++|+++|+|++.+|..|.|||++|++.|+.++|++|+......
T Consensus       326 ~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~~~~~~iv~~L~~~~~~~  389 (408)
T d1n11a_         326 KTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDET  389 (408)
T ss_dssp             CCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHHHHCCCC
T ss_pred             cCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHHHhcc
Confidence            9999999999999999999999999999999999999999999999999999999998775543



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure