Psyllid ID: psy5046

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MGPHLVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFSPHVDDTVILNSRLDPTSSSWMKSCSCVSSSLA
ccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccEEEEccccccccccEEEccccccccccccEEEccccccccc
ccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccEEEEccEEEEEcccccccccEEEEcccccccccEEEEEccccccccc
mgphlvdgrrsYFEQCVNPINLALFIDAYIRRtdlnisrdlenrtctqtlgmpvmnitgafsphvddtvilnsrldptssswmkscscvsssla
MGPHLVDGRRSYFEQCVNPINLALFIDAYIRRtdlnisrdlENRTCTQTLGMPVMNITGAFSPHVDDTVILNSrldptssswmkscscvsssla
MGPHLVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFSPHVDDTVILNSRLDPTssswmkscscvsssLA
********RRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFSPHVDDTVILNS*********************
*GPHLVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRD*******QTLGMPVMNITGAFSPHVDDTVILNSRLDPTSSSWMKSCSCVSSS**
********RRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFSPHVDDTVILNSRLDP*****************
*GPHLVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFSPHVDDTVILNSRLDPTSSSWMKSCSCVS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPHLVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFSPHVDDTVILNSRLDPTSSSWMKSCSCVSSSLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query94 2.2.26 [Sep-21-2011]
Q4R4Q3394 Protein NDRG1 OS=Macaca f N/A N/A 0.882 0.210 0.416 9e-09
Q92597394 Protein NDRG1 OS=Homo sap yes N/A 0.882 0.210 0.416 9e-09
Q6DFS4387 Protein NDRG3 OS=Xenopus yes N/A 0.893 0.217 0.411 9e-09
Q6JE36394 Protein NDRG1 OS=Rattus n yes N/A 0.882 0.210 0.416 2e-08
Q62433394 Protein NDRG1 OS=Mus musc yes N/A 0.882 0.210 0.416 2e-08
Q3SYX0384 Protein NDRG1 OS=Bos taur yes N/A 0.882 0.216 0.404 2e-08
Q7ZWV3396 Protein NDRG1-B OS=Xenopu N/A N/A 0.904 0.214 0.383 5e-08
Q66IG4395 Protein NDRG1 OS=Xenopus no N/A 0.882 0.210 0.392 6e-08
Q6GQL1375 Protein NDRG3 OS=Xenopus N/A N/A 0.893 0.224 0.383 1e-07
Q641F2396 Protein NDRG1-A OS=Xenopu N/A N/A 0.904 0.214 0.360 5e-07
>sp|Q4R4Q3|NDRG1_MACFA Protein NDRG1 OS=Macaca fascicularis GN=Ndrg1 PE=2 SV=1 Back     alignment and function desciption
 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 5   LVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFSPH 64
           +V   R +    +NP NL LFI+AY  R DL I R +   T T TL  P + + G  SP 
Sbjct: 207 VVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPG-THTVTLQCPALLVVGDSSPA 265

Query: 65  VDDTVILNSRLDPTSSSWMKSCSC 88
           VD  V  NS+LDPT ++ +K   C
Sbjct: 266 VDAVVECNSKLDPTKTTLLKMADC 289
Stress-responsive protein involved in hormone responses, cell growth, and differentiation. Acts as a tumor suppressor in many cell types. Necessary but not sufficient for p53/TP53-mediated caspase activation and apoptosis. Has a role in cell trafficking notably of the Schwann cell and is necessary for the maintenance and development of the peripheral nerve myelin sheath. Required for vesicular recycling of CDH1 and TF. May also function in lipid trafficking. Protects cells from spindle disruption damage. Functions in p53/TP53-dependent mitotic spindle checkpoint. Regulates microtubule dynamics and maintains euploidy.
Macaca fascicularis (taxid: 9541)
>sp|Q92597|NDRG1_HUMAN Protein NDRG1 OS=Homo sapiens GN=NDRG1 PE=1 SV=1 Back     alignment and function description
>sp|Q6DFS4|NDRG3_XENTR Protein NDRG3 OS=Xenopus tropicalis GN=ndrg3 PE=2 SV=1 Back     alignment and function description
>sp|Q6JE36|NDRG1_RAT Protein NDRG1 OS=Rattus norvegicus GN=Ndrg1 PE=1 SV=1 Back     alignment and function description
>sp|Q62433|NDRG1_MOUSE Protein NDRG1 OS=Mus musculus GN=Ndrg1 PE=1 SV=1 Back     alignment and function description
>sp|Q3SYX0|NDRG1_BOVIN Protein NDRG1 OS=Bos taurus GN=NDRG1 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZWV3|NDR1B_XENLA Protein NDRG1-B OS=Xenopus laevis GN=ndrg1-b PE=2 SV=1 Back     alignment and function description
>sp|Q66IG4|NDRG1_XENTR Protein NDRG1 OS=Xenopus tropicalis GN=ndrg1 PE=2 SV=1 Back     alignment and function description
>sp|Q6GQL1|NDRG3_XENLA Protein NDRG3 OS=Xenopus laevis GN=ndrg3 PE=2 SV=1 Back     alignment and function description
>sp|Q641F2|NDR1A_XENLA Protein NDRG1-A OS=Xenopus laevis GN=ndrg1-a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
91080001 421 PREDICTED: similar to Misexpression supp 0.893 0.199 0.662 3e-25
383865146 474 PREDICTED: protein NDRG3-like [Megachile 0.893 0.177 0.662 3e-25
270004618 467 hypothetical protein TcasGA2_TC003984 [T 0.893 0.179 0.662 3e-25
307191741 368 Protein NDRG3 [Harpegnathos saltator] 0.893 0.228 0.651 1e-24
307180851 383 Protein NDRG3 [Camponotus floridanus] 0.893 0.219 0.662 2e-24
322798809 383 hypothetical protein SINV_01907 [Solenop 0.893 0.219 0.651 6e-24
345497246 476 PREDICTED: protein NDRG3-like [Nasonia v 0.893 0.176 0.651 1e-23
380029331 417 PREDICTED: protein NDRG3-like [Apis flor 0.893 0.201 0.639 1e-23
328779207 474 PREDICTED: protein NDRG3-like isoform 1 0.893 0.177 0.639 1e-23
340714827 474 PREDICTED: protein NDRG3-like [Bombus te 0.893 0.177 0.639 1e-23
>gi|91080001|ref|XP_971273.1| PREDICTED: similar to Misexpression suppressor of KSR 2 CG15669-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 66/86 (76%), Gaps = 2/86 (2%)

Query: 5   LVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLE--NRTCTQTLGMPVMNITGAFS 62
           LV   +SYFE+ VNP NLALFID+Y+RRTDLNI R+L+   R  + TL MPVMNITG+ S
Sbjct: 310 LVQVYKSYFERNVNPTNLALFIDSYVRRTDLNIQRELDPTKRKESTTLKMPVMNITGSLS 369

Query: 63  PHVDDTVILNSRLDPTSSSWMKSCSC 88
           PHVDDTV  N RLDPT+SSWMK   C
Sbjct: 370 PHVDDTVTFNGRLDPTNSSWMKISDC 395

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383865146|ref|XP_003708036.1| PREDICTED: protein NDRG3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|270004618|gb|EFA01066.1| hypothetical protein TcasGA2_TC003984 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307191741|gb|EFN75183.1| Protein NDRG3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307180851|gb|EFN68689.1| Protein NDRG3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322798809|gb|EFZ20356.1| hypothetical protein SINV_01907 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345497246|ref|XP_001600170.2| PREDICTED: protein NDRG3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380029331|ref|XP_003698329.1| PREDICTED: protein NDRG3-like [Apis florea] Back     alignment and taxonomy information
>gi|328779207|ref|XP_396456.4| PREDICTED: protein NDRG3-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|340714827|ref|XP_003395925.1| PREDICTED: protein NDRG3-like [Bombus terrestris] gi|350415000|ref|XP_003490499.1| PREDICTED: protein NDRG3-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
FB|FBgn0043070 485 MESK2 "Misexpression suppresso 0.787 0.152 0.538 3.9e-15
WB|WBGene00013020343 Y48G10A.3 [Caenorhabditis eleg 0.765 0.209 0.48 1.1e-10
UNIPROTKB|Q6DFS4387 ndrg3 "Protein NDRG3" [Xenopus 0.787 0.191 0.44 3.7e-08
UNIPROTKB|E9PDL6324 NDRG1 "Protein NDRG1" [Homo sa 0.723 0.209 0.463 7.1e-08
UNIPROTKB|Q92597394 NDRG1 "Protein NDRG1" [Homo sa 0.723 0.172 0.463 1e-07
MGI|MGI:1341799394 Ndrg1 "N-myc downstream regula 0.723 0.172 0.463 1.3e-07
RGD|1307303394 Ndrg1 "N-myc downstream regula 0.723 0.172 0.463 1.3e-07
UNIPROTKB|Q7ZWV3396 ndrg1-b "Protein NDRG1-B" [Xen 0.797 0.189 0.407 2.2e-07
UNIPROTKB|F1MS38384 NDRG1 "Protein NDRG1" [Bos tau 0.776 0.190 0.432 2.7e-07
UNIPROTKB|Q66IG4395 ndrg1 "Protein NDRG1" [Xenopus 0.776 0.184 0.418 2.8e-07
FB|FBgn0043070 MESK2 "Misexpression suppressor of KSR 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 199 (75.1 bits), Expect = 3.9e-15, P = 3.9e-15
 Identities = 42/78 (53%), Positives = 53/78 (67%)

Query:     5 LVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLE----NRTCTQTLGMPVMNITGA 60
             LV   + +FE+ VNP NLA+ I+AYI R DL+++R       + T   TL MPV+NITG+
Sbjct:   226 LVQMYKQHFERGVNPTNLAMLINAYIHRNDLHLARTPPGTPGSETAATTLKMPVINITGS 285

Query:    61 FSPHVDDTVILNSRLDPT 78
              SPHVDDTV  N RLDPT
Sbjct:   286 LSPHVDDTVTFNGRLDPT 303
GO:0046579 "positive regulation of Ras protein signal transduction" evidence=IGI
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
WB|WBGene00013020 Y48G10A.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DFS4 ndrg3 "Protein NDRG3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|E9PDL6 NDRG1 "Protein NDRG1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q92597 NDRG1 "Protein NDRG1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1341799 Ndrg1 "N-myc downstream regulated gene 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307303 Ndrg1 "N-myc downstream regulated 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q7ZWV3 ndrg1-b "Protein NDRG1-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1MS38 NDRG1 "Protein NDRG1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q66IG4 ndrg1 "Protein NDRG1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
pfam03096284 pfam03096, Ndr, Ndr family 3e-17
>gnl|CDD|190521 pfam03096, Ndr, Ndr family Back     alignment and domain information 
 Score = 73.5 bits (181), Expect = 3e-17
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 7/88 (7%)

Query: 3   PHLVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFS 62
             +V   R + ++ +NP NL L+++AY  R DL I R             PV+ + G  S
Sbjct: 179 SDIVQEYRKFLKERLNPKNLQLYLEAYNNRRDLTIERG-------GLETCPVLLVVGDKS 231

Query: 63  PHVDDTVILNSRLDPTSSSWMKSCSCVS 90
           PHVD  V  NS+LDPT ++ +K   C  
Sbjct: 232 PHVDAVVECNSKLDPTKTTLLKVADCGG 259

This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3. Their similarity was previously noted. The precise molecular and cellular function of members of this family is still unknown. Yet, they are known to be involved in cellular differentiation events. The Ndr1 group was the first to be discovered. Their expression is repressed by the proto-oncogenes N-myc and c-myc, and in line with this observation, Ndr1 protein expression is down-regulated in neoplastic cells, and is reactivated when differentiation is induced by chemicals such as retinoic acid. Ndr2 and Ndr3 expression is not under the control of N-myc or c-myc. Ndr1 expression is also activated by several chemicals: tunicamycin and homocysteine induce Ndr1 in human umbilical endothelial cells; nickel induces Ndr1 in several cell types. Members of this family are found in wide variety of multicellular eukaryotes, including an Ndr1 type protein in Helianthus annuus (sunflower), known as Sf21. Interestingly, the highest scoring matches in the noise are all alpha/beta hydrolases pfam00561, suggesting that this family may have an enzymatic function (Bateman A pers. obs.). Length = 284

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 94
KOG2931|consensus326 100.0
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 100.0
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 96.04
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 96.03
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 95.74
PRK10349256 carboxylesterase BioH; Provisional 95.17
PRK07581339 hypothetical protein; Validated 94.58
PRK08775343 homoserine O-acetyltransferase; Provisional 94.47
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 94.4
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 94.39
PLN02824294 hydrolase, alpha/beta fold family protein 94.35
PHA02857276 monoglyceride lipase; Provisional 93.91
PRK10673255 acyl-CoA esterase; Provisional 93.42
KOG1454|consensus326 93.22
PLN02385349 hydrolase; alpha/beta fold family protein 92.94
PLN02894402 hydrolase, alpha/beta fold family protein 92.69
PRK03592295 haloalkane dehalogenase; Provisional 91.89
PRK06489360 hypothetical protein; Provisional 91.37
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 90.54
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 90.46
PLN02298330 hydrolase, alpha/beta fold family protein 90.26
PLN02679360 hydrolase, alpha/beta fold family protein 90.24
TIGR03611257 RutD pyrimidine utilization protein D. This protei 90.23
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 90.22
PLN02578354 hydrolase 89.41
PLN02511388 hydrolase 89.31
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 89.12
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 88.53
PRK00870302 haloalkane dehalogenase; Provisional 87.83
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 85.01
PRK10985324 putative hydrolase; Provisional 84.39
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 83.92
PRK03204286 haloalkane dehalogenase; Provisional 83.25
PLN03084383 alpha/beta hydrolase fold protein; Provisional 83.1
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 82.57
PLN02965255 Probable pheophorbidase 82.37
PRK00175379 metX homoserine O-acetyltransferase; Provisional 82.31
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 82.03
PRK10749330 lysophospholipase L2; Provisional 81.55
PRK06765389 homoserine O-acetyltransferase; Provisional 80.26
>KOG2931|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.2e-37  Score=239.36  Aligned_cols=88  Identities=39%  Similarity=0.562  Sum_probs=84.5

Q ss_pred             ChHHHHHHHHHHHhcCCHHHHHHHHHHHccccCCcccccccccCCCcccccceEEEccCCCCCccchhhhcccCCCCcee
Q psy5046           2 GPHLVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFSPHVDDTVILNSRLDPTSSS   81 (94)
Q Consensus         2 n~dlv~~yr~~l~~~~N~~Nl~~fi~sy~~R~DL~i~r~~~~~~~~~~Lkc~vLlvvG~~Sp~~~~vv~~ns~ldp~ktt   81 (94)
                      |+||||+||++|.+.+||.||++||+||++|+||+|+|+..+    .|||||||||||++|||+++|||||++|||++||
T Consensus       201 ~~diVq~Yr~~l~~~~N~~Nl~~fl~ayn~R~DL~~~r~~~~----~tlkc~vllvvGd~Sp~~~~vv~~n~~Ldp~~tt  276 (326)
T KOG2931|consen  201 NSDIVQEYRQHLGERLNPKNLALFLNAYNGRRDLSIERPKLG----TTLKCPVLLVVGDNSPHVSAVVECNSKLDPTYTT  276 (326)
T ss_pred             cHHHHHHHHHHHHhcCChhHHHHHHHHhcCCCCccccCCCcC----ccccccEEEEecCCCchhhhhhhhhcccCcccce
Confidence            799999999999999999999999999999999999998753    2999999999999999999999999999999999


Q ss_pred             eEEecCCccccc
Q psy5046          82 WMKSCSCVSSSL   93 (94)
Q Consensus        82 llkv~dcG~lv~   93 (94)
                      ||||+||||++.
T Consensus       277 llk~~d~g~l~~  288 (326)
T KOG2931|consen  277 LLKMADCGGLVQ  288 (326)
T ss_pred             EEEEcccCCccc
Confidence            999999999984

>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
2qmq_A286 Crystal Structure Of A N-Myc Downstream Regulated 2 2e-06
2xmr_A281 Crystal Structure Of Human Ndrg2 Protein Provides I 9e-05
2xms_A281 Crystal Structure Of Human Ndrg2 Protein Provides I 9e-05
2xmq_A281 Crystal Structure Of Human Ndrg2 Protein Provides I 7e-04
>pdb|2QMQ|A Chain A, Crystal Structure Of A N-Myc Downstream Regulated 2 Protein (Ndrg2, Syld, Ndr2, Ai182517, Au040374) From Mus Musculus At 1.70 A Resolution Length = 286 Back     alignment and structure 
Iteration: 1

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 37/74 (50%), Gaps = 5/74 (6%)
Query: 5   LVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFSPH 64
           L+   R   +   N  N+ L+ ++Y  R DLN  R  E      TL  PVM + G  +PH
Sbjct: 186 LIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGET-----TLKCPVMLVVGDQAPH 240
Query: 65  VDDTVILNSRLDPT 78
            D  V  NS+LDPT
Sbjct: 241 EDAVVECNSKLDPT 254
>pdb|2XMR|A Chain A, Crystal Structure Of Human Ndrg2 Protein Provides Insight Into Its Role As A Tumor Suppressor Length = 281 Back     alignment and structure
>pdb|2XMS|A Chain A, Crystal Structure Of Human Ndrg2 Protein Provides Insight Into Its Role As A Tumor Suppressor Length = 281 Back     alignment and structure
>pdb|2XMQ|A Chain A, Crystal Structure Of Human Ndrg2 Protein Provides Insight Into Its Role As A Tumor Suppressor Length = 281 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 5e-13
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Length = 286 Back     alignment and structure
 Score = 61.3 bits (148), Expect = 5e-13
 Identities = 29/86 (33%), Positives = 41/86 (47%), Gaps = 5/86 (5%)

Query: 3   PHLVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFS 62
             L+   R   +   N  N+ L+ ++Y  R DLN  R         TL  PVM + G  +
Sbjct: 184 SELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGG-----ETTLKCPVMLVVGDQA 238

Query: 63  PHVDDTVILNSRLDPTSSSWMKSCSC 88
           PH D  V  NS+LDPT +S++K    
Sbjct: 239 PHEDAVVECNSKLDPTQTSFLKMADS 264

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.08
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 96.72
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 96.44
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 96.13
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 95.93
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 95.92
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 95.79
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 95.7
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 95.66
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 95.65
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 95.62
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 95.58
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 95.23
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 94.89
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 94.89
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 94.82
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 94.71
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 94.61
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 94.6
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 94.58
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 94.37
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 94.34
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 94.31
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 94.29
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 94.1
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 93.99
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 93.98
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 93.85
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 93.83
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 93.8
3llc_A270 Putative hydrolase; structural genomics, joint cen 93.77
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 93.57
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 93.34
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 93.33
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 93.32
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 93.18
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 93.08
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 93.07
1r3d_A264 Conserved hypothetical protein VC1974; structural 92.99
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 92.94
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 92.86
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 92.83
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 92.82
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 92.81
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 92.76
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 92.75
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 92.7
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 92.56
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 92.45
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 92.43
1iup_A282 META-cleavage product hydrolase; aromatic compound 92.4
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 92.3
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 92.28
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 92.26
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 92.14
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 92.0
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 91.9
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 91.88
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 91.82
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 91.8
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 91.66
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 90.7
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 91.37
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 91.3
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 91.2
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 91.15
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 91.13
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 90.69
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 90.61
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 90.59
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 90.49
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 90.47
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 90.0
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 89.89
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 89.68
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 89.45
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 89.18
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 89.04
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 88.97
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 88.95
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 88.49
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 88.07
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 88.05
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 87.9
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 87.73
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 87.67
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 87.34
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 87.1
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 86.84
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 86.65
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 86.32
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 86.05
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 85.99
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 85.76
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 85.58
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 85.5
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 85.45
3bjr_A283 Putative carboxylesterase; structural genomics, jo 84.72
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 84.52
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 84.48
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 84.46
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 84.13
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 84.03
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 83.7
1vkh_A273 Putative serine hydrolase; structural genomics, jo 83.49
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 83.31
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 83.25
3h04_A275 Uncharacterized protein; protein with unknown func 83.22
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 82.89
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 82.52
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 82.05
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 81.89
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 81.84
3ain_A323 303AA long hypothetical esterase; carboxylesterase 81.77
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 81.5
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 80.94
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 80.92
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 80.72
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
Probab=98.08  E-value=1.2e-05  Score=55.82  Aligned_cols=84  Identities=35%  Similarity=0.529  Sum_probs=65.7

Q ss_pred             hHHHHHHHHHHHhcCCHHHHHHHHHHHccccCCcccccccccCCCcccccceEEEccCCCCCccchhhhcccCCCCceee
Q psy5046           3 PHLVDGRRSYFEQCVNPINLALFIDAYIRRTDLNISRDLENRTCTQTLGMPVMNITGAFSPHVDDTVILNSRLDPTSSSW   82 (94)
Q Consensus         3 ~dlv~~yr~~l~~~~N~~Nl~~fi~sy~~R~DL~i~r~~~~~~~~~~Lkc~vLlvvG~~Sp~~~~vv~~ns~ldp~kttl   82 (94)
                      .+..+.+++.+.+...+..+..|+..+....++...++     .++.++||+|+|.|+..+......+.-.++.|...++
T Consensus       184 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~l~~i~~P~lii~G~~D~~~~~~~~~~~~~~~~~~~~  258 (286)
T 2qmq_A          184 SELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERG-----GETTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSF  258 (286)
T ss_dssp             CHHHHHHHHHHHTCTTHHHHHHHHHHHHTCCCCCSEET-----TEECCCSCEEEEEETTSTTHHHHHHHHHHSCGGGEEE
T ss_pred             hHHHHHHHHHHHhcCCcchHHHHHHHHhhhhhhhhhhc-----hhccCCCCEEEEecCCCccccHHHHHHHHhcCCCceE
Confidence            45667777777777788888999999887777654332     3678899999999999999986666666677767899


Q ss_pred             EEecCCccc
Q psy5046          83 MKSCSCVSS   91 (94)
Q Consensus        83 lkv~dcG~l   91 (94)
                      ..+++||=.
T Consensus       259 ~~~~~~gH~  267 (286)
T 2qmq_A          259 LKMADSGGQ  267 (286)
T ss_dssp             EEETTCTTC
T ss_pred             EEeCCCCCc
Confidence            999999843
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 96.1
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 95.9
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 95.82
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 95.14
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 94.95
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 94.84
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 94.67
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 94.59
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 94.51
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 94.29
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 94.28
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 94.19
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 94.16
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 93.97
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 93.82
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 93.38
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 92.97
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 92.88
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 91.95
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 91.56
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 91.55
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 91.54
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 91.36
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 90.89
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 90.73
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 89.11
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 87.18
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 86.13
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 83.61
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 82.58
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 82.34
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carbon-carbon bond hydrolase
domain: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD)
species: Burkholderia xenovorans [TaxId: 36873]

Probab=96.10  E-value=0.015  Score=37.86  Aligned_cols=76  Identities=16%  Similarity=0.150  Sum_probs=47.4

Q ss_pred             HHHHHHHHHHHhcCCHHHHHHHHHHHcc----ccCCcccccccccCCCcccccceEEEccCCCCCc--cchhhhcccCCC
Q psy5046           4 HLVDGRRSYFEQCVNPINLALFIDAYIR----RTDLNISRDLENRTCTQTLGMPVMNITGAFSPHV--DDTVILNSRLDP   77 (94)
Q Consensus         4 dlv~~yr~~l~~~~N~~Nl~~fi~sy~~----R~DL~i~r~~~~~~~~~~Lkc~vLlvvG~~Sp~~--~~vv~~ns~ldp   77 (94)
                      ++.+.+.+.+..  .+.....++.+...    +.|+        .+.++.++||+|++.|+..+..  +...++...+ |
T Consensus       182 ~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~--------~~~l~~i~~P~lii~G~~D~~~~~~~~~~~~~~~-~  250 (283)
T d2rhwa1         182 ELLQGRWEAIQR--QPEHLKNFLISAQKAPLSTWDV--------TARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNI-D  250 (283)
T ss_dssp             HHHHHHHHHHHH--CHHHHHHHHHHHHHSCGGGGCC--------GGGGGGCCSCEEEEEETTCSSSCTHHHHHHHHHS-S
T ss_pred             HHHHHHHHHhhh--hhhhhhhhhhhhhhhhccccch--------HHHHhhCCCCEEEEEeCCCCCcCHHHHHHHHHhC-C
Confidence            444444444443  56666655544432    2232        2336688999999999998776  3445555555 2


Q ss_pred             CceeeEEecCCccc
Q psy5046          78 TSSSWMKSCSCVSS   91 (94)
Q Consensus        78 ~kttllkv~dcG~l   91 (94)
                       ...+..+++||=.
T Consensus       251 -~~~~~~i~~~gH~  263 (283)
T d2rhwa1         251 -DARLHVFSKCGHW  263 (283)
T ss_dssp             -SEEEEEESSCCSC
T ss_pred             -CCEEEEECCCCCc
Confidence             4678999999843
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure