Psyllid ID: psy509

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNYYRSPTPGAAGSKSEEMLPAEYLNSSLALQPQVPPPKATGGKTEEELKEEEELQLALALSQSEAESNKPCV
cccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHccccc
cccccccccccccHHHHcccccccccccccEccccccEcEccEccEEccccccEEcHHHccEEEEEHHHcEEEEEEEcHHHHHHHHHHccccccccccccccccccHHHccccHHHccccccccccccccHHHHcccHHHHHHHHHcHHHHHcccccc
mkaegfqfpvlkesdamfsadtapewmdgdtchrcrttfslvqRKHHCRACGQVFCQlcsskstslpkfgiekEVRVCEDCHEKftnyyrsptpgaagskseemlpaeylnsslalqpqvpppkatggkteeELKEEEELQLALALSQseaesnkpcv
mkaegfqfpvlkesdamFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFtnyyrsptpgaagSKSEEMLPAEYLNSSLALQPQVPPPKATGGKTEEELKEEEELQLAlalsqseaesnkpcv
MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNYYRSPTPGAAGSKSEEMLPAEYLNSSLALQPQVPPPKATGGKTeeelkeeeelqlalalsqseaesNKPCV
*********************TAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNYY*********************************************************************
****GFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHE***************************************************************************
MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNYYRSPTPGAAGSKSEEMLPAEYLNSSLALQPQ***************************************
*****FQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNYY*************************************************ELQLALALSQSEAES*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNYYRSPTPGAAGSKSEEMLPAEYLNSSLALQPQVPPPKATGGKTEEELKEEEELQLALALSQSEAESNKPCV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
Q9JJ50 776 Hepatocyte growth factor- yes N/A 0.892 0.181 0.592 4e-44
Q99LI8 775 Hepatocyte growth factor- yes N/A 0.892 0.181 0.592 4e-44
O14964 777 Hepatocyte growth factor- yes N/A 0.892 0.181 0.585 2e-43
Q0V8S0 777 Hepatocyte growth factor- yes N/A 0.892 0.181 0.585 2e-43
Q960X8 760 Hepatocyte growth factor- no N/A 0.930 0.193 0.608 1e-37
Q0U4Z8 720 Vacuolar protein sorting- N/A N/A 0.544 0.119 0.494 5e-22
A2QWA2 703 Vacuolar protein sorting- yes N/A 0.886 0.199 0.370 1e-21
A1CEK1 714 Vacuolar protein sorting- N/A N/A 0.860 0.190 0.379 2e-21
A1DFP5 729 Vacuolar protein sorting- N/A N/A 0.550 0.119 0.5 2e-21
A4QTV1 713 Vacuolar protein sorting- N/A N/A 0.917 0.203 0.378 2e-21
>sp|Q9JJ50|HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus GN=Hgs PE=1 SV=1 Back     alignment and function desciption
 Score =  176 bits (447), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 107/152 (70%), Gaps = 11/152 (7%)

Query: 1   MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCS 60
           MK EG  FP  KESDAMF+A+ AP+W+D + CHRCR  F +V RKHHCRACGQ+FC  CS
Sbjct: 135 MKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKHHCRACGQIFCGKCS 194

Query: 61  SKSTSLPKFGIEKEVRVCEDCHEKFTNYYRSPTPGAAGSKSEEMLPAEYLNSSLALQPQV 120
           SK +++PKFGIEKEVRVCE C+E+          G A S +E  LP EYL S L+ Q Q+
Sbjct: 195 SKYSTIPKFGIEKEVRVCEPCYEQLNKKAE----GKAASTTE--LPPEYLTSPLSQQSQL 248

Query: 121 PPPKATGGKTEEELKEEEELQLALALSQSEAE 152
           PP      + E  L+EEEELQLALALSQSEAE
Sbjct: 249 PP-----KRDETALQEEEELQLALALSQSEAE 275
Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. Involved in receptor recycling via its association with the CART complex, a multiprotein complex required for efficient transferrin receptor recycling but not for EGFR degradation (By similarity). May contribute to the efficient recruitment of SMADs to the activin receptor complex.
Rattus norvegicus (taxid: 10116)
>sp|Q99LI8|HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus GN=Hgs PE=1 SV=2 Back     alignment and function description
>sp|O14964|HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens GN=HGS PE=1 SV=1 Back     alignment and function description
>sp|Q0V8S0|HGS_BOVIN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Bos taurus GN=HGS PE=2 SV=1 Back     alignment and function description
>sp|Q960X8|HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster GN=Hrs PE=1 SV=1 Back     alignment and function description
>sp|Q0U4Z8|VPS27_PHANO Vacuolar protein sorting-associated protein 27 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VPS27 PE=3 SV=1 Back     alignment and function description
>sp|A2QWA2|VPS27_ASPNC Vacuolar protein sorting-associated protein 27 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=vps27 PE=3 SV=1 Back     alignment and function description
>sp|A1CEK1|VPS27_ASPCL Vacuolar protein sorting-associated protein 27 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=vps27 PE=3 SV=1 Back     alignment and function description
>sp|A1DFP5|VPS27_NEOFI Vacuolar protein sorting-associated protein 27 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=vps27 PE=3 SV=1 Back     alignment and function description
>sp|A4QTV1|VPS27_MAGO7 Vacuolar protein sorting-associated protein 27 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VPS27 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
350398309 817 PREDICTED: hepatocyte growth factor-regu 0.886 0.171 0.697 1e-45
380021056 827 PREDICTED: LOW QUALITY PROTEIN: hepatocy 0.886 0.169 0.684 2e-44
328782914 822 PREDICTED: hepatocyte growth factor-regu 0.886 0.170 0.684 2e-44
270012668 627 hypothetical protein TcasGA2_TC015976 [T 0.905 0.228 0.660 2e-43
91093473 628 PREDICTED: similar to hepatocyte growth 0.905 0.227 0.660 2e-43
307201531 833 Hepatocyte growth factor-regulated tyros 0.867 0.164 0.664 3e-43
417404547 778 Putative membrane trafficking and cell s 0.892 0.181 0.598 3e-43
322796370 830 hypothetical protein SINV_09655 [Solenop 0.867 0.165 0.677 4e-43
354468997 776 PREDICTED: hepatocyte growth factor-regu 0.892 0.181 0.598 4e-43
410981932 780 PREDICTED: LOW QUALITY PROTEIN: hepatocy 0.892 0.180 0.598 5e-43
>gi|350398309|ref|XP_003485155.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate-like [Bombus impatiens] Back     alignment and taxonomy information
 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 106/152 (69%), Positives = 115/152 (75%), Gaps = 12/152 (7%)

Query: 1   MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCS 60
           MKAEG++FP LKESDAMF ADTAP W DGD CHRCR +FS+VQRKHHCRACGQVFC  CS
Sbjct: 135 MKAEGYKFPTLKESDAMFIADTAPAWADGDVCHRCRVSFSMVQRKHHCRACGQVFCSQCS 194

Query: 61  SKSTSLPKFGIEKEVRVCEDCHEKFTNYYRSPTPGAAGSKSEEMLPAEYLNSSLALQPQV 120
           SK ++LPKFGIEKEVRVCE C+EK         P  A  K E  LPAEYLNSSLA Q QV
Sbjct: 195 SKVSTLPKFGIEKEVRVCEACYEKVNK------PSTAQIK-EGDLPAEYLNSSLAQQQQV 247

Query: 121 PPPKATGGKTEEELKEEEELQLALALSQSEAE 152
           PP      KT  EL+EEEEL LA+ALSQSEAE
Sbjct: 248 PP-----RKTAAELQEEEELNLAIALSQSEAE 274

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380021056|ref|XP_003694390.1| PREDICTED: LOW QUALITY PROTEIN: hepatocyte growth factor-regulated tyrosine kinase substrate-like [Apis florea] Back     alignment and taxonomy information
>gi|328782914|ref|XP_393989.4| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate [Apis mellifera] Back     alignment and taxonomy information
>gi|270012668|gb|EFA09116.1| hypothetical protein TcasGA2_TC015976 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91093473|ref|XP_967857.1| PREDICTED: similar to hepatocyte growth factor-regulated tyrosine kinase substrate (hgs) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307201531|gb|EFN81294.1| Hepatocyte growth factor-regulated tyrosine kinase substrate [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|417404547|gb|JAA49020.1| Putative membrane trafficking and cell signaling protein hrs [Desmodus rotundus] Back     alignment and taxonomy information
>gi|322796370|gb|EFZ18911.1| hypothetical protein SINV_09655 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|354468997|ref|XP_003496936.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate isoform 1 [Cricetulus griseus] gi|344250145|gb|EGW06249.1| Hepatocyte growth factor-regulated tyrosine kinase substrate [Cricetulus griseus] Back     alignment and taxonomy information
>gi|410981932|ref|XP_003997318.1| PREDICTED: LOW QUALITY PROTEIN: hepatocyte growth factor-regulated tyrosine kinase substrate [Felis catus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
UNIPROTKB|E2QWE3 782 HGS "Uncharacterized protein" 0.746 0.150 0.564 6.5e-35
UNIPROTKB|O14964 777 HGS "Hepatocyte growth factor- 0.746 0.151 0.564 8e-35
UNIPROTKB|I3L1P5263 HGS "Hepatocyte growth factor- 0.746 0.448 0.564 8.3e-35
UNIPROTKB|E1C396 705 HGS "Uncharacterized protein" 0.746 0.167 0.572 1.4e-34
MGI|MGI:104681 775 Hgs "HGF-regulated tyrosine ki 0.746 0.152 0.572 1.9e-34
RGD|69225 776 Hgs "hepatocyte growth factor- 0.746 0.152 0.572 1.9e-34
ZFIN|ZDB-GENE-030131-6107 773 hgs "hepatocyte growth factor- 0.791 0.161 0.561 3.1e-34
FB|FBgn0031450 760 Hrs "Hepatocyte growth factor 0.759 0.157 0.573 3.7e-34
UNIPROTKB|Q0V8S0 777 HGS "Hepatocyte growth factor- 0.746 0.151 0.564 8.5e-34
WB|WBGene00004101 729 hgrs-1 [Caenorhabditis elegans 0.531 0.115 0.678 2.2e-30
UNIPROTKB|E2QWE3 HGS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 378 (138.1 bits), Expect = 6.5e-35, Sum P(2) = 6.5e-35
 Identities = 70/124 (56%), Positives = 86/124 (69%)

Query:     1 MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCS 60
             MK EG  FP  KESDAMF+A+ AP+W+D + CHRCR  F +V RKHHCRACGQ+FC  CS
Sbjct:   135 MKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKHHCRACGQIFCGKCS 194

Query:    61 SKSTSLPKFGIEKEVRVCEDCHEKFTNYYRSPTPGAAGSKSEEMLPAEYLNSSLALQPQV 120
             SK +++PKFGIEKEVRVCE C+E+          G   S +E  LP EYL S L+ Q Q+
Sbjct:   195 SKYSTIPKFGIEKEVRVCEPCYEQLNK----KAEGKVSSTTE--LPPEYLTSPLSQQSQL 248

Query:   121 PPPK 124
             PP +
Sbjct:   249 PPKR 252
GO:0046426 "negative regulation of JAK-STAT cascade" evidence=IEA
GO:0019904 "protein domain specific binding" evidence=IEA
GO:0005769 "early endosome" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
UNIPROTKB|O14964 HGS "Hepatocyte growth factor-regulated tyrosine kinase substrate" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L1P5 HGS "Hepatocyte growth factor-regulated tyrosine kinase substrate" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C396 HGS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:104681 Hgs "HGF-regulated tyrosine kinase substrate" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|69225 Hgs "hepatocyte growth factor-regulated tyrosine kinase substrate" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6107 hgs "hepatocyte growth factor-regulated tyrosine kinase substrate" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0031450 Hrs "Hepatocyte growth factor regulated tyrosine kinase substrate" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q0V8S0 HGS "Hepatocyte growth factor-regulated tyrosine kinase substrate" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00004101 hgrs-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q99LI8HGS_MOUSENo assigned EC number0.59210.89240.1819yesN/A
Q9JJ50HGS_RATNo assigned EC number0.59210.89240.1817yesN/A
Q0V8S0HGS_BOVINNo assigned EC number0.58550.89240.1814yesN/A
O14964HGS_HUMANNo assigned EC number0.58550.89240.1814yesN/A
Q5BBK9VPS27_EMENINo assigned EC number0.50570.54430.1202yesN/A
Q6CL17VPS27_KLULANo assigned EC number0.54920.44930.1177yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
smart0006468 smart00064, FYVE, Protein present in Fab1, YOTB, V 3e-23
pfam0136368 pfam01363, FYVE, FYVE zinc finger 1e-22
cd0006557 cd00065, FYVE, FYVE domain; Zinc-binding domain; t 2e-21
PTZ00303 1374 PTZ00303, PTZ00303, phosphatidylinositol kinase; P 0.004
>gnl|CDD|214499 smart00064, FYVE, Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information 
 Score = 86.3 bits (214), Expect = 3e-23
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 3/65 (4%)

Query: 23 APEWMDG---DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCE 79
           P W+       C  C   F+L +R+HHCR CG++FC  CSSK   LPK GIE+ VRVC+
Sbjct: 1  RPHWIPDEEVSNCMGCGKEFNLTKRRHHCRNCGRIFCSKCSSKKAPLPKLGIERPVRVCD 60

Query: 80 DCHEK 84
          DC+E 
Sbjct: 61 DCYEN 65

The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PHD finger and the RING finger. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. The FYVE finger functions in the membrane recruitment of cytosolic proteins by binding to phosphatidylinositol 3-phosphate (PI3P), which is prominent on endosomes. The R+HHC+XCG motif is critical for PI3P binding. Length = 68
>gnl|CDD|216454 pfam01363, FYVE, FYVE zinc finger Back     alignment and domain information
>gnl|CDD|238022 cd00065, FYVE, FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>gnl|CDD|140324 PTZ00303, PTZ00303, phosphatidylinositol kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
KOG1818|consensus 634 100.0
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 99.82
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 99.77
cd0006557 FYVE FYVE domain; Zinc-binding domain; targets pro 99.62
KOG1729|consensus288 99.6
KOG1819|consensus990 99.58
PTZ00303 1374 phosphatidylinositol kinase; Provisional 99.54
KOG1842|consensus 505 99.05
KOG1409|consensus404 99.03
KOG1841|consensus 1287 98.95
KOG1843|consensus 473 98.77
KOG1811|consensus 1141 98.04
KOG4424|consensus623 97.91
PF02318118 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 97.67
smart0072626 UIM Ubiquitin-interacting motif. Present in protea 97.56
PF0280918 UIM: Ubiquitin interaction motif; InterPro: IPR003 97.49
KOG0230|consensus 1598 97.47
KOG0230|consensus 1598 97.05
KOG2199|consensus 462 95.9
KOG1841|consensus 1287 93.6
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 93.1
KOG0993|consensus542 92.68
KOG4275|consensus 350 92.1
KOG1729|consensus 288 90.32
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 89.86
smart0015439 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C 89.73
PF1371736 zinc_ribbon_4: zinc-ribbon domain 89.45
PRK00464154 nrdR transcriptional regulator NrdR; Validated 88.69
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 88.68
PF1371937 zinc_ribbon_5: zinc-ribbon domain 87.78
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 86.79
PF1463444 zf-RING_5: zinc-RING finger domain 86.28
KOG0320|consensus187 84.74
PHA0276855 hypothetical protein; Provisional 84.41
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 84.33
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 83.17
KOG3576|consensus267 82.99
KOG2164|consensus 513 82.32
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 82.0
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 81.55
PRK00420112 hypothetical protein; Validated 80.94
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 80.91
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 80.14
>KOG1818|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-34  Score=256.47  Aligned_cols=136  Identities=56%  Similarity=0.926  Sum_probs=122.9

Q ss_pred             CccCCCcCCCCCcccccccCCCCCCcccCCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChh
Q psy509            1 MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCED   80 (158)
Q Consensus         1 l~~~g~~fp~~~~s~~~~~~~~~p~W~~~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~   80 (158)
                      ||.+||+||+.++.|+||+++++|.|+|...|..|.++|++|+||||||+||+|||..|+++.++||.+|+.++||||+.
T Consensus       137 lk~~g~~Fpe~~e~d~mf~~~~~pdW~D~~~C~rCr~~F~~~~rkHHCr~CG~vFC~qcss~s~~lP~~Gi~~~VRVCd~  216 (634)
T KOG1818|consen  137 LKGGGHVFPELDENDAMFDAETAPDWIDSEECLRCRVKFGLTNRKHHCRNCGQVFCGQCSSKSLTLPKLGIEKPVRVCDS  216 (634)
T ss_pred             HhcCCccccccccchhhhcccCCcccccccccceeeeeeeeccccccccccchhhccCccccccCcccccccccceehhh
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHhcccCCCCCCCCCCCCCCCCchhhhccccCCCCCCCCCCCCCCCchhhhcchHHHHHHHHhcHHHHhhc
Q psy509           81 CHEKFTNYYRSPTPGAAGSKSEEMLPAEYLNSSLALQPQVPPPKATGGKTEEELKEEEELQLALALSQSEAESN  154 (158)
Q Consensus        81 C~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~s~~~~~~~~~~~~a~~~~~~~~~~eeedl~~aia~Sl~e~e~~  154 (158)
                      ||+.+.+.    +.+.         .+.++++...++...+.+     .....++|+|||++||+||++|+++.
T Consensus       217 C~E~l~~~----s~~~---------~~~~~~s~~s~~~~~k~r-----~~~~~~keeed~~lAi~lSq~E~~~~  272 (634)
T KOG1818|consen  217 CYELLTRA----SVGE---------KAAALNSKLSPQKTKKDR-----AKALEEKEEEDLSLAIALSQSEAEAA  272 (634)
T ss_pred             hHHHhhhc----ccch---------hhhhhhcccchhhhcccc-----cccccchhhHHHHHHHHHhHHHHHHh
Confidence            99999872    1111         267778888777777666     56778899999999999999999986

>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>KOG1729|consensus Back     alignment and domain information
>KOG1819|consensus Back     alignment and domain information
>PTZ00303 phosphatidylinositol kinase; Provisional Back     alignment and domain information
>KOG1842|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1841|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG1811|consensus Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A Back     alignment and domain information
>smart00726 UIM Ubiquitin-interacting motif Back     alignment and domain information
>PF02809 UIM: Ubiquitin interaction motif; InterPro: IPR003903 The Ubiquitin Interacting Motif (UIM), or 'LALAL-motif', is a stretch of about 20 amino acid residues, which was first described in the 26S proteasome subunit PSD4/RPN-10 that is known to recognise ubiquitin [,] Back     alignment and domain information
>KOG0230|consensus Back     alignment and domain information
>KOG0230|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG1841|consensus Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG0993|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG1729|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>smart00154 ZnF_AN1 AN1-like Zinc finger Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
3zyq_A226 Crystal Structure Of The Tandem Vhs And Fyve Domain 3e-31
1dvp_A220 Crystal Structure Of The Vhs And Fyve Tandem Domain 1e-28
1vfy_A73 Phosphatidylinositol-3-Phosphate Binding Fyve Domai 1e-14
2yqm_A89 Solution Structure Of The Fyve Domain In Zinc Finge 6e-10
2yw8_A82 Crystal Structure Of Human Run And Fyve Domain-Cont 9e-10
3t7l_A90 Crystal Structure Of The Fyve Domain Of Endofin (Zf 3e-09
1z2q_A84 High-Resolution Solution Structure Of The Lm5-1 Fyv 6e-07
1joc_A125 Eea1 Homodimer Of C-Terminal Fyve Domain Bound To I 3e-06
1hyi_A65 Solution Structure Of The Eea1 Fyve Domain Complexe 5e-06
3mpx_A434 Crystal Structure Of The Dh And Ph-1 Domains Of Hum 3e-05
1wfk_A88 Fyve Domain Of Fyve Domain Containing 19 Protein Fr 6e-05
>pdb|3ZYQ|A Chain A, Crystal Structure Of The Tandem Vhs And Fyve Domains Of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) At 1.48 A Resolution Length = 226 Back     alignment and structure 
Iteration: 1

 Score =  130 bits (327), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 55/86 (63%), Positives = 68/86 (79%)
Query: 1   MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCS 60
           MK EG  FP  KESDAMF+A+ AP+W+D + CHRCR  F ++ RKHHCRACGQ+FC  CS
Sbjct: 136 MKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCS 195
Query: 61  SKSTSLPKFGIEKEVRVCEDCHEKFT 86
           SK +++PKFGIEKEVRVCE C+E+  
Sbjct: 196 SKYSTIPKFGIEKEVRVCEPCYEQLN 221
>pdb|1DVP|A Chain A, Crystal Structure Of The Vhs And Fyve Tandem Domains Of Hrs, A Protein Involved In Membrane Trafficking And Signal Transduction Length = 220 Back     alignment and structure
>pdb|1VFY|A Chain A, Phosphatidylinositol-3-Phosphate Binding Fyve Domain Of Vps27p Protein From Saccharomyces Cerevisiae Length = 73 Back     alignment and structure
>pdb|2YQM|A Chain A, Solution Structure Of The Fyve Domain In Zinc Finger Fyve Domain-Containing Protein 12 Length = 89 Back     alignment and structure
>pdb|2YW8|A Chain A, Crystal Structure Of Human Run And Fyve Domain-Containing Protein Length = 82 Back     alignment and structure
>pdb|3T7L|A Chain A, Crystal Structure Of The Fyve Domain Of Endofin (Zfyve16) At 1.1a Resolution Length = 90 Back     alignment and structure
>pdb|1Z2Q|A Chain A, High-Resolution Solution Structure Of The Lm5-1 Fyve Domain From Leishmania Major Length = 84 Back     alignment and structure
>pdb|1JOC|A Chain A, Eea1 Homodimer Of C-Terminal Fyve Domain Bound To Inositol 1,3-Diphosphate Length = 125 Back     alignment and structure
>pdb|1HYI|A Chain A, Solution Structure Of The Eea1 Fyve Domain Complexed With Inositol 1,3-Bisphosphate Length = 65 Back     alignment and structure
>pdb|3MPX|A Chain A, Crystal Structure Of The Dh And Ph-1 Domains Of Human Fgd5 Length = 434 Back     alignment and structure
>pdb|1WFK|A Chain A, Fyve Domain Of Fyve Domain Containing 19 Protein From Mus Musculus Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 3e-31
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 6e-31
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 9e-28
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 3e-27
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 4e-27
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 3e-26
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 9e-25
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 6e-24
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 6e-23
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 2e-14
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 5e-13
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 6e-07
1zbd_B134 Rabphilin-3A; G protein, effector, RABCDR, synapti 5e-05
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 1e-04
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Length = 73 Back     alignment and structure
 Score =  106 bits (266), Expect = 3e-31
 Identities = 34/66 (51%), Positives = 42/66 (63%)

Query: 20 ADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCE 79
          + T  +W+D D C  C   FSL+ RKHHCR+CG VFCQ  SS S  LP  GI + VRVC+
Sbjct: 2  SKTPADWIDSDACMICSKKFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYEPVRVCD 61

Query: 80 DCHEKF 85
           C E +
Sbjct: 62 SCFEDY 67
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Length = 84 Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Length = 220 Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Length = 226 Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Length = 90 Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Length = 82 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Length = 88 Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Length = 125 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Length = 120 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Length = 134 Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Length = 153 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 99.95
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 99.94
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 99.91
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 99.89
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 99.88
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 99.86
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 99.86
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 99.82
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 99.82
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 99.71
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 99.7
2d3g_P26 Ubiquitin interacting motif from hepatocyte growth 98.74
1q0v_A81 Hydrophilic protein; has cysteine rich putative zi 98.38
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 97.71
1zbd_B134 Rabphilin-3A; G protein, effector, RABCDR, synapti 97.28
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 97.06
1q0v_A81 Hydrophilic protein; has cysteine rich putative zi 96.55
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 95.78
2csz_A76 Synaptotagmin-like protein 4; exophilin 2, granuph 95.73
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 95.4
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 95.39
1wff_A85 Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc 95.35
1wfl_A74 Zinc finger protein 216; ZF-AN1 domain, zinc bindi 93.77
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 93.73
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 93.42
2klz_A52 Ataxin-3; UIM, ubiquitin-binding, hydrolase, neuro 93.12
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 92.89
1x4w_A67 Hypothetical protein FLJ13222; ZF-AN1 domain, zinc 92.78
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 91.86
2a20_A62 Regulating synaptic membrane exocytosis protein 2; 91.06
2ysj_A63 Tripartite motif-containing protein 31; ring-type 91.04
1z60_A59 TFIIH basal transcription factor complex P44 subun 90.83
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 90.7
2ect_A78 Ring finger protein 126; metal binding protein, st 90.34
2ysl_A73 Tripartite motif-containing protein 31; ring-type 90.24
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 90.24
2e72_A49 POGO transposable element with ZNF domain; zinc fi 90.12
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 89.67
2ecm_A55 Ring finger and CHY zinc finger domain- containing 89.62
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 88.86
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 87.72
2klz_A52 Ataxin-3; UIM, ubiquitin-binding, hydrolase, neuro 85.5
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 85.23
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 84.81
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 84.37
2lva_A129 Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubi 84.42
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 83.79
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 83.74
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 83.52
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 83.44
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 82.58
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 81.99
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 81.42
3a1q_C45 Ubiquitin interaction motif-containing protein 1; 80.56
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 80.29
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 80.12
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
Probab=99.95  E-value=5.7e-30  Score=204.87  Aligned_cols=88  Identities=63%  Similarity=1.250  Sum_probs=84.0

Q ss_pred             CccCCCcCCCCCcccccccCCCCCCcccCCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChh
Q psy509            1 MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCED   80 (158)
Q Consensus         1 l~~~g~~fp~~~~s~~~~~~~~~p~W~~~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~   80 (158)
                      ||.+||.||+.+++|+||.++.+|.|++++.|+.|+++|++++||||||+||++||+.|+.+++++|.+|..+++|||+.
T Consensus       136 Lk~~G~~FP~~~~~damf~~~~~p~W~~~~~C~~C~~~F~~~~RrhHCR~CG~v~C~~Cs~~~~~~p~~~~~~~~RVC~~  215 (226)
T 3zyq_A          136 MKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEP  215 (226)
T ss_dssp             HHHHTCCCCCCCGGGGCCCCCCCCCCCCCSBCTTTCCBCBTTBCCEECTTTCCEECTTTCCEEEEEGGGTEEEEEEECHH
T ss_pred             HHhcCCCcccchhHHHhhhcccccccccCCCCcCcCCCCCccccccccCCCcCEeChhhcCCcccCCCCCCCCCCEeCHH
Confidence            67899999999999999999999999999999999999999999999999999999999999999999888899999999


Q ss_pred             hHHHHhcc
Q psy509           81 CHEKFTNY   88 (158)
Q Consensus        81 C~~~l~~~   88 (158)
                      ||..|++.
T Consensus       216 C~~~l~~~  223 (226)
T 3zyq_A          216 CYEQLNRK  223 (226)
T ss_dssp             HHHHHCC-
T ss_pred             HHHHhhhh
Confidence            99998863
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>1q0v_A Hydrophilic protein; has cysteine rich putative zinc finger esential for function;...; stable, non-interacting alpha-helices; NMR {Saccharomyces cerevisiae} SCOP: j.105.1.1 PDB: 1q0w_A Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Back     alignment and structure
>1q0v_A Hydrophilic protein; has cysteine rich putative zinc finger esential for function;...; stable, non-interacting alpha-helices; NMR {Saccharomyces cerevisiae} SCOP: j.105.1.1 PDB: 1q0w_A Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2csz_A Synaptotagmin-like protein 4; exophilin 2, granuphilin, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2klz_A Ataxin-3; UIM, ubiquitin-binding, hydrolase, neurodegenerati nucleus, phosphoprotein, spinocerebellar ataxia, transcript transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2a20_A Regulating synaptic membrane exocytosis protein 2; zinc-finger domain, metal binding protein; NMR {Rattus norvegicus} PDB: 2cjs_C Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2klz_A Ataxin-3; UIM, ubiquitin-binding, hydrolase, neurodegenerati nucleus, phosphoprotein, spinocerebellar ataxia, transcript transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2lva_A Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubiquitin interacting motif, UBA domain, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3a1q_C Ubiquitin interaction motif-containing protein 1; protein complex, cytoplasm, nucleus, phosphoprotein, UBL conjugation, transcription regulation; 2.20A {Mus musculus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 158
d1dvpa272 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila me 6e-27
d1vfya_67 g.50.1.1 (A:) vps27p protein {Baker's yeast (Sacch 3e-22
d1wfka_88 g.50.1.1 (A:) Zinc finger FYVE domain containing p 3e-18
d1joca164 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) 2e-15
d1y02a251 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger pro 2e-13
d1zbdb_124 g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat 2e-11
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: FYVE, a phosphatidylinositol-3-phosphate binding domain
domain: Hrs
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 94.3 bits (234), Expect = 6e-27
 Identities = 43/70 (61%), Positives = 49/70 (70%)

Query: 17 MFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVR 76
          MF+ADTAP W DG  CHRCR  F+   RKHHCR CGQVFC  C++K   LPK+GIEKEVR
Sbjct: 1  MFTADTAPNWADGRVCHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVR 60

Query: 77 VCEDCHEKFT 86
          VC+ C     
Sbjct: 61 VCDGCFAALQ 70
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 99.93
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 99.88
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 99.82
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 99.64
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 99.05
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 95.39
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 94.62
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 94.18
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 93.41
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 92.64
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 89.85
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 89.62
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 88.79
d2fiya1290 FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId 84.01
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 83.12
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 82.91
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: FYVE, a phosphatidylinositol-3-phosphate binding domain
domain: Hrs
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.93  E-value=4.5e-27  Score=156.07  Aligned_cols=71  Identities=61%  Similarity=1.315  Sum_probs=68.3

Q ss_pred             cccCCCCCCcccCCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           17 MFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        17 ~~~~~~~p~W~~~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      ||.++.+|.|++++.|..|+++|++|+||||||+||.+||..|+.++++||.++...|+|||+.||.+|++
T Consensus         1 m~~~~~~p~W~~~~~C~~C~~~F~~~~rrhhCr~CG~~~C~~C~~~~~~lp~~~~~~p~RVC~~C~~~l~~   71 (72)
T d1dvpa2           1 MFTADTAPNWADGRVCHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAALQR   71 (72)
T ss_dssp             CCCCSCCCCCCCCSBCTTTCCBCCSSSCCEECTTTCCEECSTTSCEEEEEGGGTEEEEEEECHHHHHHHHH
T ss_pred             CCcCCCCCCCCcCCccccCCCcccCccccccccccCCeeChhhhCCceECcccCCCCCCEeCHHHHHHHHC
Confidence            78899999999999999999999999999999999999999999999999999988999999999999875
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure