Psyllid ID: psy5169


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MPEQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTNFLSSFAFKIFECLVYFWTPCTVKY
cccEEEEEEcccHHHHHHHHHHHHccccEEEEEEEEccEEEEEEEEEEccccHHHHHcccccccccccEEEEccccHHHHHHHHccccccEEEc
ccccEEEEccccHHHHHHHHHHHHcccccEEEEEEcccccEHHHHHEEHcccHHHHHHHHHcccccccEEEEccccHHHHHHHHHHcccccccc
MPEQYSLKWNNFHAnlttgfhglfededlVDVSLAVEGKIIQAHKVILSvcspyfikcppkklgqsentnFLSSFAFKIFECLVYfwtpctvky
MPEQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTNFLSSFAFKIFECLVYFWTPCTVKY
MPEQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTNFLSSFAFKIFECLVYFWTPCTVKY
*****SLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTNFLSSFAFKIFECLVYFWTPCTV**
*PEQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTNFLSSFAFKIFECLVYFWTPCTVKY
MPEQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTNFLSSFAFKIFECLVYFWTPCTVKY
**EQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTNFLSSFAFKIFECLVYFWTPCTVKY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPEQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTNFLSSFAFKIFECLVYFWTPCTVKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query94 2.2.26 [Sep-21-2011]
Q86B87 610 Modifier of mdg4 OS=Droso no N/A 0.893 0.137 0.452 2e-15
Q24206 880 Broad-complex core protei no N/A 0.638 0.068 0.476 1e-12
Q01295 727 Broad-complex core protei no N/A 0.638 0.082 0.476 1e-12
Q9W0K7 977 Protein bric-a-brac 1 OS= no N/A 0.563 0.054 0.528 2e-12
Q9V5M3 878 Longitudinals lacking pro no N/A 0.563 0.060 0.547 2e-12
Q9V5M6 963 Longitudinals lacking pro no N/A 0.563 0.055 0.547 2e-12
Q867Z4 970 Longitudinals lacking pro no N/A 0.563 0.054 0.547 2e-12
Q7KQZ4 787 Longitudinals lacking pro no N/A 0.563 0.067 0.547 2e-12
P42284 549 Longitudinals lacking pro no N/A 0.563 0.096 0.547 2e-12
P42283 891 Longitudinals lacking pro no N/A 0.563 0.059 0.547 2e-12
>sp|Q86B87|MMD4_DROME Modifier of mdg4 OS=Drosophila melanogaster GN=mod(mdg4) PE=1 SV=1 Back     alignment and function desciption
 Score = 80.9 bits (198), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 55/84 (65%)

Query: 3  EQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKK 62
          EQ+SL WNNF+ NL+ GFH      DLVDVSLA EG+I++AH+++LSVCSP+F K   + 
Sbjct: 5  EQFSLCWNNFNTNLSAGFHESLCRGDLVDVSLAAEGQIVKAHRLVLSVCSPFFRKMFTQM 64

Query: 63 LGQSENTNFLSSFAFKIFECLVYF 86
             +    FL++ +    + L+ F
Sbjct: 65 PSNTHAIVFLNNVSHSALKDLIQF 88




Component of the gypsy chromatin insulator complex which is required for the function of the gypsy chromatin insulator and other endogenous chromatin insulators. Chromatin insulators are regulatory elements which establish independent domains of transcriptional activity within eukaryotic genomes. Insulators have two defining properties; they can block the communication between an enhancer and a promoter when placed between them and can also buffer transgenes from position effect variegation (PEV). Insulators are proposed to structure the chromatin fiber into independent domains of differing transcriptional potential by promoting the formation of distinct chromatin loops. This chromatin looping may involve the formation of insulator bodies, where homotypic interactions between individual subunits of the insulator complex could promote the clustering of widely spaced insulators at the nuclear periphery. Within the gypsy insulator complex, this protein may control the nature of the repressive effect of su(Hw): in the absence of mod(mdg4) protein, su(Hw) exerts a bidirectional silencing effect, whereas in the presence of mod(mdg4), the silencing effect is unidirectional. Isoform H is specifically required to maintain the pairing of achiasmate homologs in male meiosis I which is mediated by the rDNA repeats on the achiasmate X-Y bivalents. Isoform H also plays a role in apoptotic regulatory pathways.
Drosophila melanogaster (taxid: 7227)
>sp|Q24206|BRC4_DROME Broad-complex core protein isoform 6 OS=Drosophila melanogaster GN=br PE=1 SV=2 Back     alignment and function description
>sp|Q01295|BRC1_DROME Broad-complex core protein isoforms 1/2/3/4/5 OS=Drosophila melanogaster GN=br PE=1 SV=2 Back     alignment and function description
>sp|Q9W0K7|BAB1_DROME Protein bric-a-brac 1 OS=Drosophila melanogaster GN=bab1 PE=2 SV=2 Back     alignment and function description
>sp|Q9V5M3|LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster GN=lola PE=1 SV=3 Back     alignment and function description
>sp|Q9V5M6|LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster GN=lola PE=1 SV=4 Back     alignment and function description
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|Q7KQZ4|LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|P42284|LOLA2_DROME Longitudinals lacking protein, isoforms H/M/V OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|P42283|LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
389614733 349 modifier of mdg4 [Papilio polytes] 0.563 0.151 0.716 2e-17
389611509 290 modifier of mdg4, partial [Papilio xuthu 0.563 0.182 0.716 2e-17
357618658 615 hypothetical protein KGM_11213 [Danaus p 0.563 0.086 0.698 5e-17
163838692 344 Mod(mdg4)-heS00531 [Bombyx mori] gi|4716 0.563 0.154 0.698 6e-17
270011776 647 hypothetical protein TcasGA2_TC005851 [T 0.563 0.081 0.698 1e-16
91088359 336 PREDICTED: similar to Mod(mdg4)-heS00531 0.563 0.157 0.698 1e-16
242007352 356 modifier of mdg4, putative [Pediculus hu 0.563 0.148 0.698 1e-16
242016203 272 bric-A-brac, putative [Pediculus humanus 0.563 0.194 0.698 4e-16
357609737 377 hypothetical protein KGM_08757 [Danaus p 0.585 0.145 0.654 5e-16
242023188 405 zinc finger protein, putative [Pediculus 0.585 0.135 0.690 8e-16
>gi|389614733|dbj|BAM20390.1| modifier of mdg4 [Papilio polytes] Back     alignment and taxonomy information
 Score = 92.8 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/53 (71%), Positives = 46/53 (86%)

Query: 3  EQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYF 55
          EQ+SL WNNFHAN++ GFHGL    DLVDV+LA EG+I+QAHK++LSVCSPYF
Sbjct: 6  EQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRILQAHKLVLSVCSPYF 58




Source: Papilio polytes

Species: Papilio polytes

Genus: Papilio

Family: Papilionidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|389611509|dbj|BAM19362.1| modifier of mdg4, partial [Papilio xuthus] Back     alignment and taxonomy information
>gi|357618658|gb|EHJ71553.1| hypothetical protein KGM_11213 [Danaus plexippus] Back     alignment and taxonomy information
>gi|163838692|ref|NP_001106229.1| Mod(mdg4)-heS00531 [Bombyx mori] gi|47169616|tpe|CAE54311.1| TPA: Mod(mdg4)-heS00531 [Bombyx mori] Back     alignment and taxonomy information
>gi|270011776|gb|EFA08224.1| hypothetical protein TcasGA2_TC005851 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91088359|ref|XP_971758.1| PREDICTED: similar to Mod(mdg4)-heS00531 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242007352|ref|XP_002424505.1| modifier of mdg4, putative [Pediculus humanus corporis] gi|212507923|gb|EEB11767.1| modifier of mdg4, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|242016203|ref|XP_002428719.1| bric-A-brac, putative [Pediculus humanus corporis] gi|212513396|gb|EEB15981.1| bric-A-brac, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357609737|gb|EHJ66622.1| hypothetical protein KGM_08757 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242023188|ref|XP_002432018.1| zinc finger protein, putative [Pediculus humanus corporis] gi|212517369|gb|EEB19280.1| zinc finger protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
FB|FBgn0038339 967 CG6118 [Drosophila melanogaste 0.563 0.054 0.622 4.3e-14
FB|FBgn0002781 610 mod(mdg4) "modifier of mdg4" [ 0.893 0.137 0.452 5.7e-14
FB|FBgn0022238127 lolal "lola like" [Drosophila 0.563 0.417 0.490 2.8e-11
FB|FBgn0000210 880 br "broad" [Drosophila melanog 0.829 0.088 0.409 3.7e-11
FB|FBgn0004870 977 bab1 "bric a brac 1" [Drosophi 0.563 0.054 0.528 8.9e-11
FB|FBgn0005630 970 lola "longitudinals lacking" [ 0.563 0.054 0.547 1.1e-10
FB|FBgn0025525 1067 bab2 "bric a brac 2" [Drosophi 0.563 0.049 0.528 1.3e-10
FB|FBgn0003870 813 ttk "tramtrack" [Drosophila me 0.563 0.065 0.490 6.6e-10
FB|FBgn0264442 904 ab "abrupt" [Drosophila melano 0.563 0.058 0.490 9.4e-10
FB|FBgn0029822 553 CG12236 [Drosophila melanogast 0.563 0.095 0.528 2.7e-09
FB|FBgn0038339 CG6118 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 194 (73.4 bits), Expect = 4.3e-14, P = 4.3e-14
 Identities = 33/53 (62%), Positives = 42/53 (79%)

Query:     3 EQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYF 55
             +QY L WNNFH N+  GFH L +DE +VDV++A  GKI +AHK++LSVCSPYF
Sbjct:   391 DQYLLSWNNFHGNMCRGFHSLQKDEKMVDVTIAAGGKIFKAHKLVLSVCSPYF 443




GO:0007052 "mitotic spindle organization" evidence=IMP
FB|FBgn0002781 mod(mdg4) "modifier of mdg4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0264442 ab "abrupt" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0029822 CG12236 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
pfam00651101 pfam00651, BTB, BTB/POZ domain 8e-12
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 4e-06
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
 Score = 55.7 bits (135), Expect = 8e-12
 Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 20 FHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKL--GQSENTNFLSSFAF 77
           + L E+ +L DV+L V  K   AHK +L+ CSPYF     K L  G  E    L   + 
Sbjct: 1  LNELRENGELCDVTLVVGDKEFHAHKAVLAACSPYF-----KALFTGNKEVEITLEDVSP 55

Query: 78 KIFECLVYF 86
          + FE L+ F
Sbjct: 56 EDFEALLEF 64


The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101

>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 94
PHA02713 557 hypothetical protein; Provisional 99.88
KOG4441|consensus 571 99.87
PHA02790 480 Kelch-like protein; Provisional 99.81
KOG4350|consensus 620 99.79
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.79
PHA03098 534 kelch-like protein; Provisional 99.74
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.67
KOG4591|consensus 280 99.59
KOG2075|consensus 521 99.49
KOG0783|consensus 1267 99.17
KOG0783|consensus 1267 98.74
KOG2838|consensus 401 98.74
KOG4682|consensus 488 98.57
KOG2838|consensus401 97.78
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 97.69
KOG0511|consensus 516 97.15
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.0
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.95
KOG0511|consensus 516 96.34
KOG2716|consensus 230 96.31
KOG1987|consensus 297 94.89
KOG2714|consensus 465 93.86
KOG3473|consensus112 93.75
KOG4390|consensus 632 83.68
KOG1724|consensus162 80.2
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.88  E-value=4.4e-23  Score=152.49  Aligned_cols=87  Identities=21%  Similarity=0.285  Sum_probs=78.9

Q ss_pred             eeeCCchHHHHHHHHhhhhCCCceeEEEEEC-CeEEEhhHHHHhhcCHHHHhcCCCCCCCCC--CccccCCCCHHHHHHh
Q psy5169           7 LKWNNFHANLTTGFHGLFEDEDLVDVSLAVE-GKIIQAHKVILSVCSPYFIKCPPKKLGQSE--NTNFLSSFAFKIFECL   83 (94)
Q Consensus         7 ~~~~~~~~~~~~~l~~~~~~~~~~Dv~l~~~-~~~~~~Hk~vLa~~S~yF~~~f~~~~~e~~--~~~~l~~v~~~~~~~l   83 (94)
                      +.+..|+..+++.|+++|.++.+|||+|.++ |+.|||||+|||++|+||++||++++.|+.  ..+.|.++++++++.+
T Consensus         3 ~~~~~h~~~~l~~l~~lr~~~~l~DV~L~v~~~~~f~~Hr~vLaa~S~YF~amF~~~~~e~~~~~~v~l~~v~~~~~~~l   82 (557)
T PHA02713          3 IDDIKHNRRVVSNISNLLDDDILCDVIITIGDGEEIKAHKTILAAGSKYFRTLFTTPMIIRDLVTRVNLQMFDKDAVKNI   82 (557)
T ss_pred             cchhhhhHHHHHHHHHHHhCCCCCCEEEEeCCCCEEeehHHHHhhcCHHHHHHhcCCchhhccCceEEeccCCHHHHHHH
Confidence            3456789999999999999999999999997 899999999999999999999999998753  4458999999999999


Q ss_pred             hhhhcCCeec
Q psy5169          84 VYFWTPCTVK   93 (94)
Q Consensus        84 l~fly~~~v~   93 (94)
                      |+|+|||++.
T Consensus        83 l~y~Yt~~i~   92 (557)
T PHA02713         83 VQYLYNRHIS   92 (557)
T ss_pred             HHHhcCCCCC
Confidence            9999999753



>KOG4441|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>KOG1987|consensus Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>KOG1724|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 2e-12
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 5e-12
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 2e-11
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 3e-11
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 6e-11
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 6e-11
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 7e-11
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 1e-10
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 4e-10
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 5e-10
3b84_A119 Zinc finger and BTB domain-containing protein 48; 9e-10
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 1e-09
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 1e-09
2vpk_A116 Myoneurin; transcription regulation, transcription 1e-09
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 2e-09
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 3e-09
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 3e-09
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 3e-09
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 7e-09
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 8e-09
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
 Score = 57.9 bits (141), Expect = 2e-12
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 15 NLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYF 55
           L     GL+E+    D  L V G+  QAHK IL+  SP F
Sbjct: 11 RLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVF 51


>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.95
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.94
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.94
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.94
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.94
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.94
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.94
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.94
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.93
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.93
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.93
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.92
2vpk_A116 Myoneurin; transcription regulation, transcription 99.92
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.92
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 99.91
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.89
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.89
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.88
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.87
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.85
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.26
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.09
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.59
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 98.51
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.43
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.38
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 97.93
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 97.7
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 97.41
3kvt_A115 Potassium channel protein SHAW; tetramerization do 95.63
3drx_A 202 BTB/POZ domain-containing protein KCTD5; golgi, gr 93.54
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 92.12
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 89.99
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 89.93
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 88.47
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
Probab=99.95  E-value=5.5e-28  Score=146.17  Aligned_cols=88  Identities=19%  Similarity=0.317  Sum_probs=78.6

Q ss_pred             eeeeCCchHHHHHHHHhhhhCCCceeEEEEECCeEEEhhHHHHhhcCHHHHhcCCCCCCCCCCcc-ccCCCCHHHHHHhh
Q psy5169           6 SLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTN-FLSSFAFKIFECLV   84 (94)
Q Consensus         6 ~~~~~~~~~~~~~~l~~~~~~~~~~Dv~l~~~~~~~~~Hk~vLa~~S~yF~~~f~~~~~e~~~~~-~l~~v~~~~~~~ll   84 (94)
                      .++|++|++.+++.+++++.++.+|||+|.++|+.|+|||+|||++|+||++||.+++.|+.... .++++++++|+.+|
T Consensus         2 ~~~~~~h~~~l~~~l~~l~~~~~~~Dv~l~v~~~~~~aHk~vLaa~S~~F~~~f~~~~~e~~~~~i~l~~~~~~~f~~ll   81 (120)
T 2if5_A            2 GIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALM   81 (120)
T ss_dssp             CCCCTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHHC-----CCSEEECCSSCHHHHHHHH
T ss_pred             CcCccchHHHHHHHHHHHHhcCCCCCeEEEECCEEEeHHHHHHHHhCHHHHHHhcCCccccCCceEEeCCCCHHHHHHHH
Confidence            57899999999999999999999999999999999999999999999999999999888876655 99999999999999


Q ss_pred             hhhcCCeec
Q psy5169          85 YFWTPCTVK   93 (94)
Q Consensus        85 ~fly~~~v~   93 (94)
                      +|+|||++.
T Consensus        82 ~~~Yt~~~~   90 (120)
T 2if5_A           82 DFAYTATLT   90 (120)
T ss_dssp             HHHHHSCCC
T ss_pred             HHHcCCCCc
Confidence            999999874



>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 94
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 2e-09
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 8e-09
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 48.6 bits (115), Expect = 2e-09
 Identities = 17/81 (20%), Positives = 32/81 (39%), Gaps = 1/81 (1%)

Query: 7  LKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLG-Q 65
          +++    +++    + L   + L DV + V  +  +AHK +L  CS  F      +L   
Sbjct: 3  IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRN 62

Query: 66 SENTNFLSSFAFKIFECLVYF 86
              N       + F  L+ F
Sbjct: 63 LSVINLDPEINPEGFNILLDF 83


>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.95
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.94
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 98.11
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 97.22
d3kvta_103 akv3.1 voltage-gated potassium channel {California 97.18
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 97.15
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 96.42
d1t1da_100 Shaker potassium channel {California sea hare (Apl 95.62
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=3.5e-28  Score=146.68  Aligned_cols=88  Identities=18%  Similarity=0.280  Sum_probs=82.4

Q ss_pred             eeeeCCchHHHHHHHHhhhhCCCceeEEEEECCeEEEhhHHHHhhcCHHHHhcCCCCCCCCCCcc-ccCCCCHHHHHHhh
Q psy5169           6 SLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTN-FLSSFAFKIFECLV   84 (94)
Q Consensus         6 ~~~~~~~~~~~~~~l~~~~~~~~~~Dv~l~~~~~~~~~Hk~vLa~~S~yF~~~f~~~~~e~~~~~-~l~~v~~~~~~~ll   84 (94)
                      .++|++|+.++++.|+++|.++.+||++|.++|++|+|||+|||++|+||++||.+++.++...+ .++++++++|+.+|
T Consensus         2 ~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~~Hk~vLa~~S~~F~~~f~~~~~e~~~~~~~~~~v~~~~f~~ll   81 (122)
T d1r29a_           2 QIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILL   81 (122)
T ss_dssp             CCCCTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHTSTTTTTCSEEECCTTSCHHHHHHHH
T ss_pred             CcccchHHHHHHHHHHHHHhcCCCeEEEEEECCEEEEEehHHhhhCCHHHHHHhccchhhhcceeeeecccCHHHHHHHH
Confidence            46899999999999999999999999999999999999999999999999999999988887766 66899999999999


Q ss_pred             hhhcCCeec
Q psy5169          85 YFWTPCTVK   93 (94)
Q Consensus        85 ~fly~~~v~   93 (94)
                      +|+|||++.
T Consensus        82 ~~~Ytg~~~   90 (122)
T d1r29a_          82 DFMYTSRLN   90 (122)
T ss_dssp             HHHHHSCCC
T ss_pred             hhhcCCeec
Confidence            999999864



>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure