Psyllid ID: psy5169
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 94 | ||||||
| 389614733 | 349 | modifier of mdg4 [Papilio polytes] | 0.563 | 0.151 | 0.716 | 2e-17 | |
| 389611509 | 290 | modifier of mdg4, partial [Papilio xuthu | 0.563 | 0.182 | 0.716 | 2e-17 | |
| 357618658 | 615 | hypothetical protein KGM_11213 [Danaus p | 0.563 | 0.086 | 0.698 | 5e-17 | |
| 163838692 | 344 | Mod(mdg4)-heS00531 [Bombyx mori] gi|4716 | 0.563 | 0.154 | 0.698 | 6e-17 | |
| 270011776 | 647 | hypothetical protein TcasGA2_TC005851 [T | 0.563 | 0.081 | 0.698 | 1e-16 | |
| 91088359 | 336 | PREDICTED: similar to Mod(mdg4)-heS00531 | 0.563 | 0.157 | 0.698 | 1e-16 | |
| 242007352 | 356 | modifier of mdg4, putative [Pediculus hu | 0.563 | 0.148 | 0.698 | 1e-16 | |
| 242016203 | 272 | bric-A-brac, putative [Pediculus humanus | 0.563 | 0.194 | 0.698 | 4e-16 | |
| 357609737 | 377 | hypothetical protein KGM_08757 [Danaus p | 0.585 | 0.145 | 0.654 | 5e-16 | |
| 242023188 | 405 | zinc finger protein, putative [Pediculus | 0.585 | 0.135 | 0.690 | 8e-16 |
| >gi|389614733|dbj|BAM20390.1| modifier of mdg4 [Papilio polytes] | Back alignment and taxonomy information |
|---|
Score = 92.8 bits (229), Expect = 2e-17, Method: Composition-based stats.
Identities = 38/53 (71%), Positives = 46/53 (86%)
Query: 3 EQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYF 55
EQ+SL WNNFHAN++ GFHGL DLVDV+LA EG+I+QAHK++LSVCSPYF
Sbjct: 6 EQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRILQAHKLVLSVCSPYF 58
|
Source: Papilio polytes Species: Papilio polytes Genus: Papilio Family: Papilionidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|389611509|dbj|BAM19362.1| modifier of mdg4, partial [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|357618658|gb|EHJ71553.1| hypothetical protein KGM_11213 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|163838692|ref|NP_001106229.1| Mod(mdg4)-heS00531 [Bombyx mori] gi|47169616|tpe|CAE54311.1| TPA: Mod(mdg4)-heS00531 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|270011776|gb|EFA08224.1| hypothetical protein TcasGA2_TC005851 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91088359|ref|XP_971758.1| PREDICTED: similar to Mod(mdg4)-heS00531 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242007352|ref|XP_002424505.1| modifier of mdg4, putative [Pediculus humanus corporis] gi|212507923|gb|EEB11767.1| modifier of mdg4, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|242016203|ref|XP_002428719.1| bric-A-brac, putative [Pediculus humanus corporis] gi|212513396|gb|EEB15981.1| bric-A-brac, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|357609737|gb|EHJ66622.1| hypothetical protein KGM_08757 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|242023188|ref|XP_002432018.1| zinc finger protein, putative [Pediculus humanus corporis] gi|212517369|gb|EEB19280.1| zinc finger protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 94 | ||||||
| FB|FBgn0038339 | 967 | CG6118 [Drosophila melanogaste | 0.563 | 0.054 | 0.622 | 4.3e-14 | |
| FB|FBgn0002781 | 610 | mod(mdg4) "modifier of mdg4" [ | 0.893 | 0.137 | 0.452 | 5.7e-14 | |
| FB|FBgn0022238 | 127 | lolal "lola like" [Drosophila | 0.563 | 0.417 | 0.490 | 2.8e-11 | |
| FB|FBgn0000210 | 880 | br "broad" [Drosophila melanog | 0.829 | 0.088 | 0.409 | 3.7e-11 | |
| FB|FBgn0004870 | 977 | bab1 "bric a brac 1" [Drosophi | 0.563 | 0.054 | 0.528 | 8.9e-11 | |
| FB|FBgn0005630 | 970 | lola "longitudinals lacking" [ | 0.563 | 0.054 | 0.547 | 1.1e-10 | |
| FB|FBgn0025525 | 1067 | bab2 "bric a brac 2" [Drosophi | 0.563 | 0.049 | 0.528 | 1.3e-10 | |
| FB|FBgn0003870 | 813 | ttk "tramtrack" [Drosophila me | 0.563 | 0.065 | 0.490 | 6.6e-10 | |
| FB|FBgn0264442 | 904 | ab "abrupt" [Drosophila melano | 0.563 | 0.058 | 0.490 | 9.4e-10 | |
| FB|FBgn0029822 | 553 | CG12236 [Drosophila melanogast | 0.563 | 0.095 | 0.528 | 2.7e-09 |
| FB|FBgn0038339 CG6118 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 194 (73.4 bits), Expect = 4.3e-14, P = 4.3e-14
Identities = 33/53 (62%), Positives = 42/53 (79%)
Query: 3 EQYSLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYF 55
+QY L WNNFH N+ GFH L +DE +VDV++A GKI +AHK++LSVCSPYF
Sbjct: 391 DQYLLSWNNFHGNMCRGFHSLQKDEKMVDVTIAAGGKIFKAHKLVLSVCSPYF 443
|
|
| FB|FBgn0002781 mod(mdg4) "modifier of mdg4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0264442 ab "abrupt" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0029822 CG12236 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 94 | |||
| pfam00651 | 101 | pfam00651, BTB, BTB/POZ domain | 8e-12 | |
| smart00225 | 97 | smart00225, BTB, Broad-Complex, Tramtrack and Bric | 4e-06 |
| >gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain | Back alignment and domain information |
|---|
Score = 55.7 bits (135), Expect = 8e-12
Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 7/69 (10%)
Query: 20 FHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKL--GQSENTNFLSSFAF 77
+ L E+ +L DV+L V K AHK +L+ CSPYF K L G E L +
Sbjct: 1 LNELRENGELCDVTLVVGDKEFHAHKAVLAACSPYF-----KALFTGNKEVEITLEDVSP 55
Query: 78 KIFECLVYF 86
+ FE L+ F
Sbjct: 56 EDFEALLEF 64
|
The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101 |
| >gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 94 | |||
| PHA02713 | 557 | hypothetical protein; Provisional | 99.88 | |
| KOG4441|consensus | 571 | 99.87 | ||
| PHA02790 | 480 | Kelch-like protein; Provisional | 99.81 | |
| KOG4350|consensus | 620 | 99.79 | ||
| PF00651 | 111 | BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( | 99.79 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 99.74 | |
| smart00225 | 90 | BTB Broad-Complex, Tramtrack and Bric a brac. Doma | 99.67 | |
| KOG4591|consensus | 280 | 99.59 | ||
| KOG2075|consensus | 521 | 99.49 | ||
| KOG0783|consensus | 1267 | 99.17 | ||
| KOG0783|consensus | 1267 | 98.74 | ||
| KOG2838|consensus | 401 | 98.74 | ||
| KOG4682|consensus | 488 | 98.57 | ||
| KOG2838|consensus | 401 | 97.78 | ||
| PF03931 | 62 | Skp1_POZ: Skp1 family, tetramerisation domain; Int | 97.69 | |
| KOG0511|consensus | 516 | 97.15 | ||
| PF02214 | 94 | BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi | 97.0 | |
| smart00512 | 104 | Skp1 Found in Skp1 protein family. Family of Skp1 | 96.95 | |
| KOG0511|consensus | 516 | 96.34 | ||
| KOG2716|consensus | 230 | 96.31 | ||
| KOG1987|consensus | 297 | 94.89 | ||
| KOG2714|consensus | 465 | 93.86 | ||
| KOG3473|consensus | 112 | 93.75 | ||
| KOG4390|consensus | 632 | 83.68 | ||
| KOG1724|consensus | 162 | 80.2 |
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=99.88 E-value=4.4e-23 Score=152.49 Aligned_cols=87 Identities=21% Similarity=0.285 Sum_probs=78.9
Q ss_pred eeeCCchHHHHHHHHhhhhCCCceeEEEEEC-CeEEEhhHHHHhhcCHHHHhcCCCCCCCCC--CccccCCCCHHHHHHh
Q psy5169 7 LKWNNFHANLTTGFHGLFEDEDLVDVSLAVE-GKIIQAHKVILSVCSPYFIKCPPKKLGQSE--NTNFLSSFAFKIFECL 83 (94)
Q Consensus 7 ~~~~~~~~~~~~~l~~~~~~~~~~Dv~l~~~-~~~~~~Hk~vLa~~S~yF~~~f~~~~~e~~--~~~~l~~v~~~~~~~l 83 (94)
+.+..|+..+++.|+++|.++.+|||+|.++ |+.|||||+|||++|+||++||++++.|+. ..+.|.++++++++.+
T Consensus 3 ~~~~~h~~~~l~~l~~lr~~~~l~DV~L~v~~~~~f~~Hr~vLaa~S~YF~amF~~~~~e~~~~~~v~l~~v~~~~~~~l 82 (557)
T PHA02713 3 IDDIKHNRRVVSNISNLLDDDILCDVIITIGDGEEIKAHKTILAAGSKYFRTLFTTPMIIRDLVTRVNLQMFDKDAVKNI 82 (557)
T ss_pred cchhhhhHHHHHHHHHHHhCCCCCCEEEEeCCCCEEeehHHHHhhcCHHHHHHhcCCchhhccCceEEeccCCHHHHHHH
Confidence 3456789999999999999999999999997 899999999999999999999999998753 4458999999999999
Q ss_pred hhhhcCCeec
Q psy5169 84 VYFWTPCTVK 93 (94)
Q Consensus 84 l~fly~~~v~ 93 (94)
|+|+|||++.
T Consensus 83 l~y~Yt~~i~ 92 (557)
T PHA02713 83 VQYLYNRHIS 92 (557)
T ss_pred HHHhcCCCCC
Confidence 9999999753
|
|
| >KOG4441|consensus | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4350|consensus | Back alignment and domain information |
|---|
| >PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00225 BTB Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >KOG4591|consensus | Back alignment and domain information |
|---|
| >KOG2075|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG2838|consensus | Back alignment and domain information |
|---|
| >KOG4682|consensus | Back alignment and domain information |
|---|
| >KOG2838|consensus | Back alignment and domain information |
|---|
| >PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >smart00512 Skp1 Found in Skp1 protein family | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >KOG2716|consensus | Back alignment and domain information |
|---|
| >KOG1987|consensus | Back alignment and domain information |
|---|
| >KOG2714|consensus | Back alignment and domain information |
|---|
| >KOG3473|consensus | Back alignment and domain information |
|---|
| >KOG4390|consensus | Back alignment and domain information |
|---|
| >KOG1724|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 94 | |||
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 2e-12 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 5e-12 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 2e-11 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 3e-11 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 6e-11 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 6e-11 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 7e-11 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 1e-10 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 4e-10 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 5e-10 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 9e-10 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 1e-09 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 1e-09 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 1e-09 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 2e-09 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 3e-09 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 3e-09 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 3e-09 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 7e-09 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 8e-09 |
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
Score = 57.9 bits (141), Expect = 2e-12
Identities = 17/41 (41%), Positives = 21/41 (51%)
Query: 15 NLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYF 55
L GL+E+ D L V G+ QAHK IL+ SP F
Sbjct: 11 RLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVF 51
|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 94 | |||
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 99.95 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 99.94 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 99.94 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 99.94 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 99.94 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 99.94 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 99.94 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 99.94 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 99.93 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 99.93 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 99.93 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 99.92 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 99.92 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 99.92 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 99.91 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 99.89 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 99.89 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 99.88 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 99.87 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 99.85 | |
| 4ajy_C | 97 | Transcription elongation factor B polypeptide 1; E | 99.26 | |
| 2ast_A | 159 | S-phase kinase-associated protein 1A; SCF-substrat | 99.09 | |
| 1hv2_A | 99 | Elongin C, ELC1; protein-peptide complex, signalin | 98.59 | |
| 1fs1_B | 141 | SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le | 98.51 | |
| 2fnj_C | 96 | Transcription elongation factor B polypeptide 1; b | 98.43 | |
| 2p1m_A | 160 | SKP1-like protein 1A; F-BOX, leucine rich repeat, | 98.38 | |
| 1vcb_B | 112 | Protein (elongin C); tumor suppressor, cancer, ubi | 97.93 | |
| 3v7d_A | 169 | Suppressor of kinetochore protein 1; WD 40 domain, | 97.7 | |
| 3drz_A | 107 | BTB/POZ domain-containing protein KCTD5; potassium | 97.41 | |
| 3kvt_A | 115 | Potassium channel protein SHAW; tetramerization do | 95.63 | |
| 3drx_A | 202 | BTB/POZ domain-containing protein KCTD5; golgi, gr | 93.54 | |
| 1s1g_A | 124 | Potassium voltage-gated channel subfamily D membe; | 92.12 | |
| 1t1d_A | 100 | Protein (potassium channel KV1.1); potassium chann | 89.99 | |
| 2nz0_B | 140 | Potassium voltage-gated channel subfamily D membe; | 89.93 | |
| 1nn7_A | 105 | Potassium channel KV4.2; teteramerization domain, | 88.47 |
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A | Back alignment and structure |
|---|
Probab=99.95 E-value=5.5e-28 Score=146.17 Aligned_cols=88 Identities=19% Similarity=0.317 Sum_probs=78.6
Q ss_pred eeeeCCchHHHHHHHHhhhhCCCceeEEEEECCeEEEhhHHHHhhcCHHHHhcCCCCCCCCCCcc-ccCCCCHHHHHHhh
Q psy5169 6 SLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTN-FLSSFAFKIFECLV 84 (94)
Q Consensus 6 ~~~~~~~~~~~~~~l~~~~~~~~~~Dv~l~~~~~~~~~Hk~vLa~~S~yF~~~f~~~~~e~~~~~-~l~~v~~~~~~~ll 84 (94)
.++|++|++.+++.+++++.++.+|||+|.++|+.|+|||+|||++|+||++||.+++.|+.... .++++++++|+.+|
T Consensus 2 ~~~~~~h~~~l~~~l~~l~~~~~~~Dv~l~v~~~~~~aHk~vLaa~S~~F~~~f~~~~~e~~~~~i~l~~~~~~~f~~ll 81 (120)
T 2if5_A 2 GIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALM 81 (120)
T ss_dssp CCCCTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHHC-----CCSEEECCSSCHHHHHHHH
T ss_pred CcCccchHHHHHHHHHHHHhcCCCCCeEEEECCEEEeHHHHHHHHhCHHHHHHhcCCccccCCceEEeCCCCHHHHHHHH
Confidence 57899999999999999999999999999999999999999999999999999999888876655 99999999999999
Q ss_pred hhhcCCeec
Q psy5169 85 YFWTPCTVK 93 (94)
Q Consensus 85 ~fly~~~v~ 93 (94)
+|+|||++.
T Consensus 82 ~~~Yt~~~~ 90 (120)
T 2if5_A 82 DFAYTATLT 90 (120)
T ss_dssp HHHHHSCCC
T ss_pred HHHcCCCCc
Confidence 999999874
|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* | Back alignment and structure |
|---|
| >1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 | Back alignment and structure |
|---|
| >1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D | Back alignment and structure |
|---|
| >2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B | Back alignment and structure |
|---|
| >2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* | Back alignment and structure |
|---|
| >1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 | Back alignment and structure |
|---|
| >3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* | Back alignment and structure |
|---|
| >3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A | Back alignment and structure |
|---|
| >1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A | Back alignment and structure |
|---|
| >2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A | Back alignment and structure |
|---|
| >1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 94 | ||||
| d1r29a_ | 122 | d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB | 2e-09 | |
| d1buoa_ | 121 | d.42.1.1 (A:) Promyelocytic leukaemia zinc finger | 8e-09 |
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: B-cell lymphoma 6 (Bcl6) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 48.6 bits (115), Expect = 2e-09
Identities = 17/81 (20%), Positives = 32/81 (39%), Gaps = 1/81 (1%)
Query: 7 LKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLG-Q 65
+++ +++ + L + L DV + V + +AHK +L CS F +L
Sbjct: 3 IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRN 62
Query: 66 SENTNFLSSFAFKIFECLVYF 86
N + F L+ F
Sbjct: 63 LSVINLDPEINPEGFNILLDF 83
|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 94 | |||
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 99.95 | |
| d1buoa_ | 121 | Promyelocytic leukaemia zinc finger (PLZF) protein | 99.94 | |
| d1hv2a_ | 99 | Elongin C {Baker's yeast (Saccharomyces cerevisiae | 98.11 | |
| d2c9wc1 | 96 | Elongin C {Human (Homo sapiens) [TaxId: 9606]} | 97.79 | |
| d1fs1b2 | 61 | Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa | 97.22 | |
| d3kvta_ | 103 | akv3.1 voltage-gated potassium channel {California | 97.18 | |
| d1nexa2 | 72 | Centromere DNA-binding protein complex Cbf3 subuni | 97.15 | |
| d1nn7a_ | 105 | Potassium channel kv4.2 {Rat (Rattus norvegicus) [ | 96.42 | |
| d1t1da_ | 100 | Shaker potassium channel {California sea hare (Apl | 95.62 |
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: B-cell lymphoma 6 (Bcl6) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95 E-value=3.5e-28 Score=146.68 Aligned_cols=88 Identities=18% Similarity=0.280 Sum_probs=82.4
Q ss_pred eeeeCCchHHHHHHHHhhhhCCCceeEEEEECCeEEEhhHHHHhhcCHHHHhcCCCCCCCCCCcc-ccCCCCHHHHHHhh
Q psy5169 6 SLKWNNFHANLTTGFHGLFEDEDLVDVSLAVEGKIIQAHKVILSVCSPYFIKCPPKKLGQSENTN-FLSSFAFKIFECLV 84 (94)
Q Consensus 6 ~~~~~~~~~~~~~~l~~~~~~~~~~Dv~l~~~~~~~~~Hk~vLa~~S~yF~~~f~~~~~e~~~~~-~l~~v~~~~~~~ll 84 (94)
.++|++|+.++++.|+++|.++.+||++|.++|++|+|||+|||++|+||++||.+++.++...+ .++++++++|+.+|
T Consensus 2 ~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~~Hk~vLa~~S~~F~~~f~~~~~e~~~~~~~~~~v~~~~f~~ll 81 (122)
T d1r29a_ 2 QIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILL 81 (122)
T ss_dssp CCCCTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHTSTTTTTCSEEECCTTSCHHHHHHHH
T ss_pred CcccchHHHHHHHHHHHHHhcCCCeEEEEEECCEEEEEehHHhhhCCHHHHHHhccchhhhcceeeeecccCHHHHHHHH
Confidence 46899999999999999999999999999999999999999999999999999999988887766 66899999999999
Q ss_pred hhhcCCeec
Q psy5169 85 YFWTPCTVK 93 (94)
Q Consensus 85 ~fly~~~v~ 93 (94)
+|+|||++.
T Consensus 82 ~~~Ytg~~~ 90 (122)
T d1r29a_ 82 DFMYTSRLN 90 (122)
T ss_dssp HHHHHSCCC
T ss_pred hhhcCCeec
Confidence 999999864
|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|