Psyllid ID: psy5204

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MTQLLTKINRVEHYLLRLTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRARLTYWSKFGHKVV
cHHHHHHHHcccHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccHHcccccccccEEEEEEcccccEEEEEEEEcccccccccccccccEEEEEEEEEEEEEEEEccccccccccccccccccEEEEEEcccEEEEcccccEEEEEcccccccEEEEEEcccccccccEEEcccccEEEEEEEEEccccEEcc
cccEcccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHcccccccHHHEEcccccEEEEEEEEccccccccccccccccEHEEEcccEEEEEEcccccccccccccccEEEEEEEEcccccEEEEEccccEEEEEcccccccEEEEEEEcccccccEEEccccccEEEEEEEEEEccccEEc
MTQLLTKINRVEHYLLRLTRIDTLSELIHRVYAAfegrssvdVAHVKFLMESYVSnaddwkryaqfdenrytrnlvdegdgKFNLILLCWsqgqassihDHAQAHCFMKMLQGCLtevryqepnhtsdeigqdrplseisrtelaendvcyindsmglhkvgnsgphpaavslhlysppfnicssfdaqtgvksrARLTYWSKFGHKVV
MTQLLTKINRVEHYLLRLTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPnhtsdeigqdrplsEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRARltywskfghkvv
MTQLLTKINRVEHYLLRLTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRARLTYWSKFGHKVV
***LLTKINRVEHYLLRLTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRY************************AENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRARLTYWSKFG****
******K***********TRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRARLTYWSKFGHKV*
MTQLLTKINRVEHYLLRLTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRARLTYWSKFGHKVV
*TQLLTKINRVEHYLLRLTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRARLTYWSKFGHKVV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTQLLTKINRVEHYLLRLTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRARLTYWSKFGHKVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
Q6NWZ9201 Cysteine dioxygenase type yes N/A 0.885 0.920 0.471 7e-48
Q3SZU4200 Cysteine dioxygenase type yes N/A 0.846 0.885 0.494 4e-47
Q5RBQ7200 Cysteine dioxygenase type yes N/A 0.842 0.88 0.497 6e-47
Q16878200 Cysteine dioxygenase type yes N/A 0.842 0.88 0.497 6e-47
P21816200 Cysteine dioxygenase type yes N/A 0.866 0.905 0.489 8e-47
P60334200 Cysteine dioxygenase type yes N/A 0.866 0.905 0.489 8e-47
Q60TI7190 Cysteine dioxygenase OS=C N/A N/A 0.856 0.942 0.451 4e-44
Q20893190 Cysteine dioxygenase 1 OS yes N/A 0.856 0.942 0.451 3e-43
Q9U8F1212 Cysteine dioxygenase OS=S N/A N/A 0.923 0.910 0.35 1e-36
Q5RLY7213 Cysteine dioxygenase OS=A N/A N/A 0.880 0.863 0.445 3e-35
>sp|Q6NWZ9|CDO1_DANRE Cysteine dioxygenase type 1 OS=Danio rerio GN=cdo1 PE=2 SV=1 Back     alignment and function desciption
 Score =  190 bits (482), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 126/191 (65%), Gaps = 6/191 (3%)

Query: 18  LTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVD 77
           + + +TL +LI  ++  F+   S++V  V+ LMESY SN  DW ++A+FD+ RYTRNLVD
Sbjct: 6   VMKPETLEDLIKTLHQIFQS-DSINVEEVQNLMESYQSNPQDWMKFAKFDQYRYTRNLVD 64

Query: 78  EGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLS 137
           EG+GKFNL++LCW +G  SSIHDH  +HCF+K+LQG L E  +  P+       + R   
Sbjct: 65  EGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGQLKETLFDWPDRKLQSGMKPR--- 121

Query: 138 EISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRAR 197
              ++ L EN   YINDS+GLH+V N      AVSLHLYSPPF  C +FD +TG  +  +
Sbjct: 122 --GQSVLQENQCAYINDSLGLHRVENVSHTEPAVSLHLYSPPFQSCRTFDQRTGHHNTVK 179

Query: 198 LTYWSKFGHKV 208
           +T+WSK+G + 
Sbjct: 180 MTFWSKYGERT 190

Danio rerio (taxid: 7955)
EC: 1EC: .EC: 1EC: 3EC: .EC: 1EC: 1EC: .EC: 2EC: 0
>sp|Q3SZU4|CDO1_BOVIN Cysteine dioxygenase type 1 OS=Bos taurus GN=CDO1 PE=2 SV=1 Back     alignment and function description
>sp|Q5RBQ7|CDO1_PONAB Cysteine dioxygenase type 1 OS=Pongo abelii GN=CDO1 PE=2 SV=1 Back     alignment and function description
>sp|Q16878|CDO1_HUMAN Cysteine dioxygenase type 1 OS=Homo sapiens GN=CDO1 PE=1 SV=2 Back     alignment and function description
>sp|P21816|CDO1_RAT Cysteine dioxygenase type 1 OS=Rattus norvegicus GN=Cdo1 PE=1 SV=1 Back     alignment and function description
>sp|P60334|CDO1_MOUSE Cysteine dioxygenase type 1 OS=Mus musculus GN=Cdo1 PE=1 SV=1 Back     alignment and function description
>sp|Q60TI7|CDO_CAEBR Cysteine dioxygenase OS=Caenorhabditis briggsae GN=cdo-1 PE=3 SV=1 Back     alignment and function description
>sp|Q20893|CDO1_CAEEL Cysteine dioxygenase 1 OS=Caenorhabditis elegans GN=cdo-1 PE=3 SV=2 Back     alignment and function description
>sp|Q9U8F1|CDO_SCHJA Cysteine dioxygenase OS=Schistosoma japonicum GN=CDO PE=2 SV=1 Back     alignment and function description
>sp|Q5RLY7|CDO_AJECG Cysteine dioxygenase OS=Ajellomyces capsulata (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CDO1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
170073205245 cysteine dioxygenase [Culex quinquefasci 0.923 0.787 0.518 5e-54
321459245206 hypothetical protein DAPPUDRAFT_202397 [ 0.894 0.907 0.538 2e-53
345483092233 PREDICTED: cysteine dioxygenase type 1-l 0.875 0.785 0.548 6e-53
322800799233 hypothetical protein SINV_07900 [Solenop 0.913 0.819 0.528 6e-53
332017575277 Cysteine dioxygenase type 1 [Acromyrmex 0.899 0.678 0.518 2e-52
213514732203 cysteine dioxygenase type 1 [Salmo salar 0.894 0.921 0.489 2e-52
110762117227 PREDICTED: cysteine dioxygenase type 1-l 0.875 0.806 0.535 5e-52
91087037243 PREDICTED: similar to cysteine dioxygena 0.875 0.753 0.526 5e-51
346471861213 hypothetical protein [Amblyomma maculatu 0.870 0.854 0.532 7e-51
427787331213 Putative cysteine dioxygenase cdo1 [Rhip 0.870 0.854 0.532 8e-51
>gi|170073205|ref|XP_001870330.1| cysteine dioxygenase [Culex quinquefasciatus] gi|167869715|gb|EDS33098.1| cysteine dioxygenase [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 111/214 (51%), Positives = 146/214 (68%), Gaps = 21/214 (9%)

Query: 11  VEHYLLRLTRIDTLSELI---HRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFD 67
           +E  L    +  TL+ELI   HRV+A       V++ +V  LM SY SNA +W+++A+FD
Sbjct: 31  IEKPLKDAPQCGTLTELIAELHRVFA----EDRVNIEYVNHLMMSYKSNAAEWRKFAKFD 86

Query: 68  ENRYTRNLVDEGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEP-NHT 126
             RYTRNLVD G+GKFNL+LLCW++G AS+IHDHA +HCFMKML+G LTEVRY  P + T
Sbjct: 87  RYRYTRNLVDAGNGKFNLMLLCWNEGHASAIHDHADSHCFMKMLKGELTEVRYAWPKDAT 146

Query: 127 SDE-----IGQD--------RPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSL 173
            +E     IGQD          L E+SRT LA N VCYIND++GLH+V N      AVSL
Sbjct: 147 VNEDAAANIGQDPEDQEYSGDELEELSRTTLATNGVCYINDTLGLHRVENPSHSDVAVSL 206

Query: 174 HLYSPPFNICSSFDAQTGVKSRARLTYWSKFGHK 207
           HLY PPF+ CS F+ QTG +++ ++T+WSK+G +
Sbjct: 207 HLYCPPFDTCSVFNKQTGKRTKCKVTFWSKYGKR 240

Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|321459245|gb|EFX70300.1| hypothetical protein DAPPUDRAFT_202397 [Daphnia pulex] Back     alignment and taxonomy information
>gi|345483092|ref|XP_001604510.2| PREDICTED: cysteine dioxygenase type 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322800799|gb|EFZ21675.1| hypothetical protein SINV_07900 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332017575|gb|EGI58275.1| Cysteine dioxygenase type 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|213514732|ref|NP_001134993.1| cysteine dioxygenase type 1 [Salmo salar] gi|209737796|gb|ACI69767.1| Cysteine dioxygenase type 1 [Salmo salar] Back     alignment and taxonomy information
>gi|110762117|ref|XP_001122114.1| PREDICTED: cysteine dioxygenase type 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|91087037|ref|XP_974462.1| PREDICTED: similar to cysteine dioxygenase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|346471861|gb|AEO35775.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|427787331|gb|JAA59117.1| Putative cysteine dioxygenase cdo1 [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
FB|FBgn0034364238 CG5493 [Drosophila melanogaste 0.875 0.768 0.479 6.2e-46
ZFIN|ZDB-GENE-040426-1704201 cdo1 "cysteine dioxygenase, ty 0.861 0.895 0.489 7.9e-46
UNIPROTKB|E1C9J4206 CDO1 "Uncharacterized protein" 0.899 0.912 0.467 3.4e-45
UNIPROTKB|E2R3U0200 CDO1 "Uncharacterized protein" 0.842 0.88 0.508 3.4e-45
MGI|MGI:105925200 Cdo1 "cysteine dioxygenase 1, 0.842 0.88 0.497 9.1e-45
RGD|69262200 Cdo1 "cysteine dioxygenase, ty 0.842 0.88 0.497 9.1e-45
UNIPROTKB|Q3SZU4200 CDO1 "Cysteine dioxygenase typ 0.851 0.89 0.497 1.9e-44
UNIPROTKB|Q16878200 CDO1 "Cysteine dioxygenase typ 0.842 0.88 0.497 1.9e-44
UNIPROTKB|D0G6R7200 CDO1 "Cysteine dioxygenase, ty 0.842 0.88 0.491 1e-43
WB|WBGene00018986190 cdo-1 [Caenorhabditis elegans 0.842 0.926 0.469 1.1e-41
FB|FBgn0034364 CG5493 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 482 (174.7 bits), Expect = 6.2e-46, P = 6.2e-46
 Identities = 93/194 (47%), Positives = 130/194 (67%)

Query:    21 IDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGD 80
             +++LS+L+  ++  FE  + V++  V  LM SY SN  +W++YA+FD   YTRNLVD G+
Sbjct:    39 VNSLSDLVAALHREFES-NYVNIEMVNHLMLSYKSNPREWRKYAKFDRYTYTRNLVDAGN 97

Query:    81 GKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQD------- 133
             GKFNL++LCW +G  SS+HDHA +HCFMKML+G L E RY+ PN ++ + G+        
Sbjct:    98 GKFNLLILCWGEGHGSSVHDHADSHCFMKMLKGDLREKRYEYPNRSARDNGRSHHPDGEI 157

Query:   134 --RPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTG 191
               R L EI  T +A NDV YIND++GLH+V N      +VSLHLY PPF+ CS F     
Sbjct:   158 DSRELVEIGETPIAVNDVAYINDNLGLHRVENPSHSDTSVSLHLYCPPFDTCSVFQDNLK 217

Query:   192 VKSRARLTYWSKFG 205
              K+ A++T+WSK+G
Sbjct:   218 -KTTAKVTFWSKYG 230
GO:0017172 "cysteine dioxygenase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0046439 "L-cysteine metabolic process" evidence=IEA
ZFIN|ZDB-GENE-040426-1704 cdo1 "cysteine dioxygenase, type I" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C9J4 CDO1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3U0 CDO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:105925 Cdo1 "cysteine dioxygenase 1, cytosolic" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|69262 Cdo1 "cysteine dioxygenase, type I" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZU4 CDO1 "Cysteine dioxygenase type 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q16878 CDO1 "Cysteine dioxygenase type 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D0G6R7 CDO1 "Cysteine dioxygenase, type I" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00018986 cdo-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P21816CDO1_RAT1, ., 1, 3, ., 1, 1, ., 2, 00.48930.86600.905yesN/A
Q3SZU4CDO1_BOVIN1, ., 1, 3, ., 1, 1, ., 2, 00.49460.84680.885yesN/A
Q6NWZ9CDO1_DANRE1, ., 1, 3, ., 1, 1, ., 2, 00.47120.88510.9203yesN/A
Q16878CDO1_HUMAN1, ., 1, 3, ., 1, 1, ., 2, 00.49720.84210.88yesN/A
Q5RBQ7CDO1_PONAB1, ., 1, 3, ., 1, 1, ., 2, 00.49720.84210.88yesN/A
P60334CDO1_MOUSE1, ., 1, 3, ., 1, 1, ., 2, 00.48930.86600.905yesN/A
Q20893CDO1_CAEEL1, ., 1, 3, ., 1, 1, ., 2, 00.45160.85640.9421yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.13.11LOW CONFIDENCE prediction!
3rd Layer1.13.11.200.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
pfam05995170 pfam05995, CDO_I, Cysteine dioxygenase type I 3e-47
COG5553191 COG5553, COG5553, Predicted metal-dependent enzyme 0.002
>gnl|CDD|218847 pfam05995, CDO_I, Cysteine dioxygenase type I Back     alignment and domain information 
 Score =  152 bits (386), Expect = 3e-47
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 7/152 (4%)

Query: 38  RSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASS 97
           ++  DV  V  L+E Y+S+  +W +Y +FD+  YTRN +  G+G++ L LL W  GQ + 
Sbjct: 26  QAEADVPEVAKLLERYISDPTEWGKYVRFDQTGYTRNRI-AGNGEYELWLLSWPPGQGTG 84

Query: 98  IHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEISRTELAENDVCYINDSMG 157
           +HDH  +H  +K+L+G L E  +  P            +   S +   +    YI D  G
Sbjct: 85  VHDHGGSHGALKVLEGELKETIFAWPRKR------SVEMVIKSNSRRLDEGTQYIFDKGG 138

Query: 158 LHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQ 189
           +H+V N+     AVSLHLYSPP    ++F+  
Sbjct: 139 IHRVENNSTSEPAVSLHLYSPPLTTMTAFEES 170

Cysteine dioxygenase type I (EC:1.13.11.20) converts cysteine to cysteinesulphinic acid and is the rate-limiting step in sulphate production. Length = 170
>gnl|CDD|227840 COG5553, COG5553, Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
KOG4064|consensus196 100.0
PF05995175 CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 100.0
COG5553191 Predicted metal-dependent enzyme of the double-str 99.92
PF07847200 DUF1637: Protein of unknown function (DUF1637); In 99.48
KOG4281|consensus236 99.27
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 98.35
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 98.34
PRK13290125 ectC L-ectoine synthase; Reviewed 98.27
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 98.19
COG1917131 Uncharacterized conserved protein, contains double 98.09
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 98.06
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 98.05
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 97.94
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 97.83
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 97.76
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 97.75
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 97.69
smart00835146 Cupin_1 Cupin. This family represents the conserve 97.66
PRK11171266 hypothetical protein; Provisional 97.54
PRK11171266 hypothetical protein; Provisional 97.42
PRK04190191 glucose-6-phosphate isomerase; Provisional 97.38
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 97.35
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 97.19
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 97.03
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 96.84
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 96.72
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 96.63
COG3837161 Uncharacterized conserved protein, contains double 96.08
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 95.9
PRK12335 287 tellurite resistance protein TehB; Provisional 95.2
COG361599 TehB Uncharacterized protein/domain, possibly invo 94.6
PF0931382 DUF1971: Domain of unknown function (DUF1971); Int 94.44
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 93.87
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 93.4
PF02678107 Pirin: Pirin; InterPro: IPR003829 This entry repre 92.97
COG1741 276 Pirin-related protein [General function prediction 92.81
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 92.42
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 89.57
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 89.53
PRK10296 278 DNA-binding transcriptional regulator ChbR; Provis 89.4
PF14499251 DUF4437: Domain of unknown function (DUF4437); PDB 87.91
PLN00212 493 glutelin; Provisional 87.73
PRK13500 312 transcriptional activator RhaR; Provisional 85.46
PF06339126 Ectoine_synth: Ectoine synthase; InterPro: IPR0104 84.68
PRK13501 290 transcriptional activator RhaR; Provisional 83.71
COG4766176 EutQ Ethanolamine utilization protein [Amino acid 81.91
PF13759101 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB 80.93
PRK10371 302 DNA-binding transcriptional regulator MelR; Provis 80.89
PLN00212493 glutelin; Provisional 80.64
>KOG4064|consensus Back     alignment and domain information 
Probab=100.00  E-value=1e-47  Score=299.48  Aligned_cols=183  Identities=48%  Similarity=0.907  Sum_probs=172.5

Q ss_pred             CchhHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHhhcCccchhhhhccCCccceEEeeecCCCceEEEEEEccCCCccCC
Q psy5204          19 TRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASSI   98 (209)
Q Consensus        19 ~~~~~l~~li~~l~~~~~~~~~~~~~~v~~ll~~l~~~~~~w~~~~~~~~~~Y~R~ll~~~~~~~~l~~~~W~pG~~spi   98 (209)
                      |.--+|-+||.+|+++|.+. -++++++..+|+.+.++|.+|..|+.||..+|+|||+..+|++|+++++||.+|..|.+
T Consensus         9 p~~~sl~dLv~~lh~~F~~~-~vnveeV~~lM~sYkSnp~EWr~yAkFD~y~YTRNLVD~GNGKfNLmILCWGeGhgSSv   87 (196)
T KOG4064|consen    9 PRMISLVDLVVQLHEIFQQK-LVNVEEVMKLMASYKSNPNEWRRYAKFDMYKYTRNLVDVGNGKFNLMILCWGEGHGSSV   87 (196)
T ss_pred             chhhhHHHHHHHHHHHHHhc-ccCHHHHHHHHHHhhcCHHHHHHHHhhhHHHHhhhhhhcCCCeEeEEEEEecCCCCccc
Confidence            55567999999999999997 79999999999999999999999999999999999999889999999999999999999


Q ss_pred             CCCCCceEEEEEEEeEEEEEEeeCCCCCCCCCCCCccccccceEEeeCCcEEEEcCCCCeEEEecCCCCCceEEEEEeCC
Q psy5204          99 HDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSP  178 (209)
Q Consensus        99 HDH~~s~~~~~vl~G~l~e~~y~~~~~~~~~~~~~~~l~~~~~~~~~~G~v~~~~~~~~iH~v~n~~~~~~avSLHvY~p  178 (209)
                      |||.+++||+++|+|.|+|+.|.|++..+.+      +....+.+++.++|.|++|..|+|||+|+|..++|||||+|.|
T Consensus        88 HDHtdsHCF~KmL~G~L~Et~yawPd~ks~e------~v~isE~~~~~N~vaYiND~lGLHRvEN~SHs~~aVSLHLY~P  161 (196)
T KOG4064|consen   88 HDHTDSHCFVKMLDGELTETKYAWPDRKSHE------PVDISEKTYGMNGVAYINDELGLHRVENLSHSNGAVSLHLYIP  161 (196)
T ss_pred             cccccchhHHHHhcCcchhhcccCCCcccCc------cccccceeeeccceEEecccccceeccccccCCCceEEEEecC
Confidence            9999999999999999999999999766543      5556789999999999999999999999999999999999999


Q ss_pred             CCCcceEEECCCCceEEeeeeEEeccCeec
Q psy5204         179 PFNICSSFDAQTGVKSRARLTYWSKFGHKV  208 (209)
Q Consensus       179 p~~~~~~yd~~~g~~~~~~~~~~s~~g~~~  208 (209)
                      |+..|+.||..||+...+.++|+|+||.+.
T Consensus       162 PfdTC~aFd~rtgkKt~~tvTF~SKyG~rt  191 (196)
T KOG4064|consen  162 PFDTCNAFDERTGKKTQCTVTFYSKYGKRT  191 (196)
T ss_pred             CcchhhhhhhccCCcceEEEEEehhcCccc
Confidence            999999999999999999999999999874

>PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 Back     alignment and domain information
>COG5553 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only] Back     alignment and domain information
>PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine Back     alignment and domain information
>KOG4281|consensus Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG3615 TehB Uncharacterized protein/domain, possibly involved in tellurite resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG1741 Pirin-related protein [General function prediction only] Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
2b5h_A200 1.5 A Resolution Crystal Structure Of Recombinant R 7e-48
2ic1_A205 Crystal Structure Of Human Cysteine Dioxygenase In 7e-48
2atf_A200 X-Ray Structure Of Cysteine Dioxygenase Type I From 1e-46
3eqe_A171 Crystal Structure Of The Yubc Protein From Bacillus 3e-04
2gm6_A208 Crystal Structure Of A Putative Cysteine Dioxygenas 6e-04
>pdb|2B5H|A Chain A, 1.5 A Resolution Crystal Structure Of Recombinant R. Norvegicus Cysteine Dioxygenase Length = 200 Back     alignment and structure 
Iteration: 1

 Score =  186 bits (473), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 92/188 (48%), Positives = 128/188 (68%), Gaps = 7/188 (3%)
Query: 18  LTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVD 77
           L +  TL++LI  ++  F G   V+V  V+ ++E+Y SN  +W  YA+FD+ RYTRNLVD
Sbjct: 6   LLKPRTLADLIRILHELFAG-DEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVD 64
Query: 78  EGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLS 137
           +G+GKFNL++LCW +G  SSIHDH  +HCF+K+LQG L E  +  P+  S+E+     + 
Sbjct: 65  QGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEM-----IK 119
Query: 138 EISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRAR 197
           +  RT L EN   YINDS+GLH+V N      AVSLHLYSPPF+ C +FD +TG K++  
Sbjct: 120 KSERT-LRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVT 178
Query: 198 LTYWSKFG 205
           +T+ SKFG
Sbjct: 179 MTFHSKFG 186
>pdb|2IC1|A Chain A, Crystal Structure Of Human Cysteine Dioxygenase In Complex With Substrate Cysteine Length = 205 Back     alignment and structure
>pdb|2ATF|A Chain A, X-Ray Structure Of Cysteine Dioxygenase Type I From Mus Musculus Mm.241056 Length = 200 Back     alignment and structure
>pdb|3EQE|A Chain A, Crystal Structure Of The Yubc Protein From Bacillus Subtilis. Northeast Structural Genomics Consortium Target Sr112. Length = 171 Back     alignment and structure
>pdb|2GM6|A Chain A, Crystal Structure Of A Putative Cysteine Dioxygenase Type I (reut_b5045) From Ralstonia Eutropha Jmp134 At 1.84 A Resolution Length = 208 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 2e-61
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 2e-44
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 2e-38
3uss_A211 Putative uncharacterized protein; cupin, three his 9e-37
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Length = 200 Back     alignment and structure
 Score =  189 bits (480), Expect = 2e-61
 Identities = 90/191 (47%), Positives = 125/191 (65%), Gaps = 7/191 (3%)

Query: 18  LTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVD 77
           L +  TL++LI  ++  F G   V+V  V+ ++E+Y SN  +W  YA+FD+ RYTRNLVD
Sbjct: 6   LLKPRTLADLIRILHELFAGDE-VNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVD 64

Query: 78  EGDGKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLS 137
           +G+GKFNL++LCW +G  SSIHDH  +HCF+K+LQG L E  +  P+  S        + 
Sbjct: 65  QGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKS------NEMI 118

Query: 138 EISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRAR 197
           + S   L EN   YINDS+GLH+V N      AVSLHLYSPPF+ C +FD +TG K++  
Sbjct: 119 KKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVT 178

Query: 198 LTYWSKFGHKV 208
           +T+ SKFG + 
Sbjct: 179 MTFHSKFGIRT 189
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Length = 171 Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Length = 208 Back     alignment and structure
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} Length = 211 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 100.0
3uss_A211 Putative uncharacterized protein; cupin, three his 100.0
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 100.0
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 100.0
3h8u_A125 Uncharacterized conserved protein with double-STR 98.92
1v70_A105 Probable antibiotics synthesis protein; structural 98.76
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 98.61
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 98.58
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 98.55
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 98.44
2q30_A110 Uncharacterized protein; double-stranded beta-heli 98.41
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 98.4
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 98.4
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 98.38
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 98.35
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 98.29
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 98.29
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 98.28
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 98.22
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 98.21
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 98.2
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 98.19
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 98.15
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 98.13
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 98.13
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 98.1
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 98.09
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 98.03
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 98.02
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 97.98
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 97.97
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 97.96
1vj2_A126 Novel manganese-containing cupin TM1459; structura 97.95
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 97.93
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 97.89
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 97.89
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 97.89
3rns_A227 Cupin 2 conserved barrel domain protein; structura 97.8
4i4a_A128 Similar to unknown protein; structural genomics, P 97.73
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 97.73
3rns_A227 Cupin 2 conserved barrel domain protein; structura 97.72
3h7j_A 243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 97.72
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 97.71
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 97.64
1sfn_A246 Conserved hypothetical protein; structural genomic 97.59
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 97.59
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 97.58
3cjx_A165 Protein of unknown function with A cupin-like FOL; 97.57
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 97.56
1sq4_A 278 GLXB, glyoxylate-induced protein; structural genom 97.52
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 97.51
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 97.5
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 97.49
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 97.47
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 97.45
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 97.44
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 97.43
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 97.42
3lwc_A119 Uncharacterized protein; structural genomics, unkn 97.4
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 97.39
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 97.37
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 97.35
1sef_A 274 Conserved hypothetical protein; structural genomic 97.27
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 97.27
1sef_A274 Conserved hypothetical protein; structural genomic 97.25
3bb6_A127 Uncharacterized protein YEAR; structural genomics, 97.2
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 97.09
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 97.07
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 97.05
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 97.01
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 97.01
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 97.0
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 96.97
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 96.83
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 96.82
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 96.72
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 96.6
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 96.59
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 96.49
3dl3_A119 Tellurite resistance protein B; X-RAY NESG VFR98 Q 96.47
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 96.43
3d82_A102 Cupin 2, conserved barrel domain protein; structur 96.29
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 96.24
1sfn_A246 Conserved hypothetical protein; structural genomic 96.22
3bcw_A123 Uncharacterized protein; structural genomics, join 96.15
4axo_A151 EUTQ, ethanolamine utilization protein; structural 96.14
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 96.05
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 96.02
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 95.85
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 95.75
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 95.62
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 95.61
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 95.59
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 95.41
2vec_A256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 95.37
3bal_A153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 95.35
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 95.2
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 94.91
1tq5_A242 Protein YHHW; bicupin, pirin, montreal-kingston ba 94.91
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 94.81
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 94.67
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 94.65
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 94.56
2yu1_A 451 JMJC domain-containing histone demethylation PROT; 94.19
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 94.1
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 93.54
1uij_A416 Beta subunit of beta conglycinin; double-stranded 93.47
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 93.14
3c3v_A 510 Arachin ARAH3 isoform; peanut allergen, allergy, g 93.04
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 92.89
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 92.76
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 92.67
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 92.25
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 92.14
2p17_A 277 Pirin-like protein; GK1651, structural genomics, s 91.29
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 90.51
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 90.34
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 90.14
3k3o_A371 PHF8, PHD finger protein 8; histone demethylase, c 89.88
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 89.8
3pua_A392 GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe 89.35
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 88.89
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 88.71
3kmh_A246 D-lyxose isomerase; cupin beta-barrel, structural 88.37
3d8c_A349 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 88.28
3kv5_D488 JMJC domain-containing histone demethylation prote 87.71
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 87.54
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 87.45
1j1l_A 290 Pirin; beta sandwich, cupin, iron, metatl binding 87.05
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 86.54
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 86.25
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 84.39
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 83.84
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 83.02
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 82.37
3kv9_A397 JMJC domain-containing histone demethylation prote 81.54
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 80.18
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
Probab=100.00  E-value=2.9e-54  Score=356.53  Aligned_cols=186  Identities=48%  Similarity=0.893  Sum_probs=173.8

Q ss_pred             ccCCchhHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHhhcCccchhhhhccCCccceEEeeecCCCceEEEEEEccCCCc
Q psy5204          16 LRLTRIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQA   95 (209)
Q Consensus        16 ~~~~~~~~l~~li~~l~~~~~~~~~~~~~~v~~ll~~l~~~~~~w~~~~~~~~~~Y~R~ll~~~~~~~~l~~~~W~pG~~   95 (209)
                      +..+.+++|++||++|+++|+++ ..++++|+.+|++|++++++|.+|+.|||.+|+|++|++++++|+|++++|+|||.
T Consensus         4 ~~~~~~~~l~~li~~l~~~~~~~-~~~~~~l~~ll~~l~~~~~~W~~~~~~d~~~y~R~ll~~~~~~~~l~ll~W~PGq~   82 (200)
T 3eln_A            4 TELLKPRTLADLIRILHELFAGD-EVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHG   82 (200)
T ss_dssp             CCCCCCSSHHHHHHHHHHHTSSS-SCCHHHHHHHHHHSCCCHHHHGGGCCCCSSSCEEEEEECGGGTCEEEEEEECTTCB
T ss_pred             cccCChHHHHHHHHHHHHHHcCC-CCCHHHHHHHHHHHHcCHHHHHhhhccCccceEEEeeecCCCceEEEEEEECCCCc
Confidence            35788999999999999999986 69999999999999999999999999999999999999767899999999999999


Q ss_pred             cCCCCCCCceEEEEEEEeEEEEEEeeCCCCCCCCCCCCccccccceEEeeCCcEEEEcCCCCeEEEecCCCCCceEEEEE
Q psy5204          96 SSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHL  175 (209)
Q Consensus        96 spiHDH~~s~~~~~vl~G~l~e~~y~~~~~~~~~~~~~~~l~~~~~~~~~~G~v~~~~~~~~iH~v~n~~~~~~avSLHv  175 (209)
                      ||||||+++||+++||+|+++|++|++++++..      ++...++.++.+|++.+++++.+||+|+|++.+++||||||
T Consensus        83 SpiHDH~~s~g~i~VL~G~l~e~~y~~~~~~~~------~l~~~~~~~l~~G~v~~~~~~~giH~V~N~s~~~~avSlHv  156 (200)
T 3eln_A           83 SSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSN------EMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHL  156 (200)
T ss_dssp             CCEECCTTCEEEEEEEESCEEEEEECCCCSSCC------CCCEEEEEEECTTCEEEECTTTCEEEEECCCSSCCEEEEEE
T ss_pred             CCCccCCCceEEEEEEeeeEEEEEeecCCCCcc------cccccceEEeCCCCEEEecCCCcEEEEECCCCCCCEEEEEe
Confidence            999999999999999999999999999766532      37888899999999999977788999999986689999999


Q ss_pred             eCCCCCcceEEECCCCceEEeeeeEEeccCeec
Q psy5204         176 YSPPFNICSSFDAQTGVKSRARLTYWSKFGHKV  208 (209)
Q Consensus       176 Y~pp~~~~~~yd~~~g~~~~~~~~~~s~~g~~~  208 (209)
                      ||||+.+|++||+.||++++++++|+|+||+|+
T Consensus       157 Y~pp~~~~~~yd~~tG~~~~~~~~~~s~~g~~~  189 (200)
T 3eln_A          157 YSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRT  189 (200)
T ss_dssp             EESCCSEEEEECTTTCCEEEEECCCSEETTEEC
T ss_pred             CCCCccceEEEECCCCCEEEEeeEEEcCCCEEC
Confidence            999999999999999999999999999999985
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* Back     alignment and structure
>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d3elna1186 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {R 4e-59
d2gm6a1192 b.82.1.19 (A:11-202) Cysteine dioxygenase type I { 7e-37
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Length = 186 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Cysteine dioxygenase type I
domain: Cysteine dioxygenase type I
species: Rattus norvegicus [TaxId: 10116]

 Score =  182 bits (462), Expect = 4e-59
 Identities = 86/187 (45%), Positives = 121/187 (64%), Gaps = 10/187 (5%)

Query: 21  IDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGD 80
           +  L  ++H ++A       V+V  V+ ++E+Y SN  +W  YA+FD+ RYTRNLVD+G+
Sbjct: 8   LADLIRILHELFAG----DEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGN 63

Query: 81  GKFNLILLCWSQGQASSIHDHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEIS 140
           GKFNL++LCW +G  SSIHDH  +HCF+K+LQG L E  +  P+  S        + + S
Sbjct: 64  GKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKS------NEMIKKS 117

Query: 141 RTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPPFNICSSFDAQTGVKSRARLTY 200
              L EN   YINDS+GLH+V N      AVSLHLYSPPF+ C +FD +TG K++  +T+
Sbjct: 118 ERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTF 177

Query: 201 WSKFGHK 207
            SKFG +
Sbjct: 178 HSKFGIR 184
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d3elna1186 Cysteine dioxygenase type I {Rattus norvegicus [Ta 100.0
d2gm6a1192 Cysteine dioxygenase type I {Ralstonia eutropha [T 100.0
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 99.47
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 98.76
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 98.63
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 98.5
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 98.35
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 98.32
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 98.22
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 98.04
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 97.75
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 97.71
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 97.63
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 97.62
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 97.61
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 97.55
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 97.5
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 97.37
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 97.36
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 97.25
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 97.2
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 97.17
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 97.15
d1sq4a_ 273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 97.14
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 97.07
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 97.06
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 97.04
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 96.94
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 96.91
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 96.86
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 96.85
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 96.68
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 96.62
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 96.62
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 96.61
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 96.48
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 96.37
d3dl3a196 Tellurite resistance protein B, TehB {Vibrio fisch 96.2
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 96.0
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 95.74
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 95.72
d3bb6a1109 Uncharacterized protein YeaR {Escherichia coli [Ta 95.6
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 95.39
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 95.12
d1tq5a1231 Hypothetical protein YhhW {Escherichia coli [TaxId 94.64
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 94.58
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 94.37
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 93.63
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Cysteine dioxygenase type I
domain: Cysteine dioxygenase type I
species: Rattus norvegicus [TaxId: 10116]

Probab=100.00  E-value=1.8e-52  Score=340.35  Aligned_cols=182  Identities=49%  Similarity=0.909  Sum_probs=169.6

Q ss_pred             chhHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHhhcCccchhhhhccCCccceEEeeecCCCceEEEEEEccCCCccCCC
Q psy5204          20 RIDTLSELIHRVYAAFEGRSSVDVAHVKFLMESYVSNADDWKRYAQFDENRYTRNLVDEGDGKFNLILLCWSQGQASSIH   99 (209)
Q Consensus        20 ~~~~l~~li~~l~~~~~~~~~~~~~~v~~ll~~l~~~~~~w~~~~~~~~~~Y~R~ll~~~~~~~~l~~~~W~pG~~spiH   99 (209)
                      +|.+|++||+.|++++.++ ..++++|+.+|+++..+|++|.+|+.|++..|+||+|++++++|+|+++||+|||.||||
T Consensus         4 ~p~~l~~Li~~l~~~~~~~-~~~i~~v~~ll~~~~~~~~~w~~~~~~~~~~Y~R~li~~~~~~fel~li~W~pGq~tpiH   82 (186)
T d3elna1           4 KPRTLADLIRILHELFAGD-EVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIH   82 (186)
T ss_dssp             CCSSHHHHHHHHHHHTSSS-SCCHHHHHHHHHHSCCCHHHHGGGCCCCSSSCEEEEEECGGGTCEEEEEEECTTCBCCEE
T ss_pred             CHHHHHHHHHHHHHHhhcc-CCCHHHHHHHHHHccCCHHHHHHhcccCccccEEEEEEcCCCCeEEEEEEccCCCcCCCc
Confidence            3679999999999999886 678999999999999999999999999999999999997568999999999999999999


Q ss_pred             CCCCceEEEEEEEeEEEEEEeeCCCCCCCCCCCCccccccceEEeeCCcEEEEcCCCCeEEEecCCCCCceEEEEEeCCC
Q psy5204         100 DHAQAHCFMKMLQGCLTEVRYQEPNHTSDEIGQDRPLSEISRTELAENDVCYINDSMGLHKVGNSGPHPAAVSLHLYSPP  179 (209)
Q Consensus       100 DH~~s~~~~~vl~G~l~e~~y~~~~~~~~~~~~~~~l~~~~~~~~~~G~v~~~~~~~~iH~v~n~~~~~~avSLHvY~pp  179 (209)
                      ||+++|||++||+|+++|++|++.+++..      ++....+..+.+|+++++.|..+||+|.|++++++|||||||+||
T Consensus        83 DH~~~~~~~~vl~G~l~e~~Y~~~~~~~~------~l~~~~~~~~~~g~v~~~~~~~~iH~v~N~~~~~~avsLHvYspP  156 (186)
T d3elna1          83 DHTDSHCFLKLLQGNLKETLFDWPDKKSN------EMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP  156 (186)
T ss_dssp             CCTTCEEEEEEEESCEEEEEECCCCSSCC------CCCEEEEEEECTTCEEEECTTTCEEEEECCCSSCCEEEEEEEESC
T ss_pred             cCCCCcEEEEEcccceEEEEeecCCCCcc------cccccceEEecCCCEEEeCCCCCcceeecCCCCCCeEEEEEeCCC
Confidence            99999999999999999999999866543      377888999999999999987889999999866899999999999


Q ss_pred             CCcceEEECCCCceEEeeeeEEeccCeec
Q psy5204         180 FNICSSFDAQTGVKSRARLTYWSKFGHKV  208 (209)
Q Consensus       180 ~~~~~~yd~~~g~~~~~~~~~~s~~g~~~  208 (209)
                      +.+|++||+++|++++++++|||+||+|.
T Consensus       157 ~~~c~~yd~~tg~~~~~~~~~~s~~g~~~  185 (186)
T d3elna1         157 FDTCHAFDQRTGHKNKVTMTFHSKFGIRT  185 (186)
T ss_dssp             CSEEEEECTTTCCEEEEECCCSEETTEEC
T ss_pred             hhhceeeecccCcEEEEEeeEECCCCEEC
Confidence            99999999999999999999999999984
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure