Psyllid ID: psy5254
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 147 | ||||||
| 270002356 | 2021 | hypothetical protein TcasGA2_TC001372 [T | 0.578 | 0.042 | 0.705 | 1e-29 | |
| 189234985 | 1843 | PREDICTED: similar to myosin-rhogap prot | 0.578 | 0.046 | 0.705 | 1e-29 | |
| 328701265 | 1863 | PREDICTED: myosin-IXb isoform 3 [Acyrtho | 0.578 | 0.045 | 0.682 | 9e-29 | |
| 328701267 | 1776 | PREDICTED: myosin-IXb isoform 4 [Acyrtho | 0.578 | 0.047 | 0.682 | 9e-29 | |
| 328701269 | 1847 | PREDICTED: myosin-IXb isoform 1 [Acyrtho | 0.578 | 0.046 | 0.682 | 1e-28 | |
| 328701263 | 1931 | PREDICTED: myosin-IXb isoform 2 [Acyrtho | 0.578 | 0.044 | 0.682 | 1e-28 | |
| 357623270 | 1062 | hypothetical protein KGM_18974 [Danaus p | 0.578 | 0.080 | 0.682 | 2e-28 | |
| 427791915 | 1463 | Putative myosin class i heavy chain, par | 0.503 | 0.050 | 0.729 | 3e-27 | |
| 242011074 | 783 | myosin IIIB, putative [Pediculus humanus | 0.496 | 0.093 | 0.780 | 4e-27 | |
| 321455065 | 1839 | hypothetical protein DAPPUDRAFT_64918 [D | 0.578 | 0.046 | 0.647 | 3e-26 |
| >gi|270002356|gb|EEZ98803.1| hypothetical protein TcasGA2_TC001372 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 134 bits (338), Expect = 1e-29, Method: Compositional matrix adjust.
Identities = 60/85 (70%), Positives = 69/85 (81%)
Query: 61 GLAEHFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKP 120
GL FEQLCINYANEHLQYYFNQHVF+YEQEEY KEGIRW +I+F DNT CLQL+EGKP
Sbjct: 519 GLNNSFEQLCINYANEHLQYYFNQHVFKYEQEEYRKEGIRWNNIDFMDNTGCLQLIEGKP 578
Query: 121 NGLLCVLDDQAKFSLIPPDDILCRY 145
NGLLC+LDDQ F + +L ++
Sbjct: 579 NGLLCLLDDQCNFPGATNETLLQKF 603
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189234985|ref|XP_968193.2| PREDICTED: similar to myosin-rhogap protein, myr [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328701265|ref|XP_003241547.1| PREDICTED: myosin-IXb isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328701267|ref|XP_003241548.1| PREDICTED: myosin-IXb isoform 4 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328701269|ref|XP_001944223.2| PREDICTED: myosin-IXb isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328701263|ref|XP_003241546.1| PREDICTED: myosin-IXb isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|357623270|gb|EHJ74495.1| hypothetical protein KGM_18974 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|427791915|gb|JAA61409.1| Putative myosin class i heavy chain, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|242011074|ref|XP_002426282.1| myosin IIIB, putative [Pediculus humanus corporis] gi|212510345|gb|EEB13544.1| myosin IIIB, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|321455065|gb|EFX66210.1| hypothetical protein DAPPUDRAFT_64918 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 147 | ||||||
| UNIPROTKB|F1S9U2 | 548 | F1S9U2 "Uncharacterized protei | 0.544 | 0.145 | 0.512 | 4e-20 | |
| WB|WBGene00002040 | 1880 | hum-7 [Caenorhabditis elegans | 0.537 | 0.042 | 0.569 | 4.1e-20 | |
| UNIPROTKB|E1BS57 | 2001 | Gga.50857 "Uncharacterized pro | 0.544 | 0.039 | 0.512 | 9.5e-20 | |
| UNIPROTKB|E1C471 | 2031 | Gga.50857 "Uncharacterized pro | 0.544 | 0.039 | 0.512 | 9.8e-20 | |
| UNIPROTKB|E1C470 | 2140 | Gga.50857 "Uncharacterized pro | 0.544 | 0.037 | 0.512 | 1.1e-19 | |
| UNIPROTKB|E1BNV7 | 2159 | MYO9B "Uncharacterized protein | 0.544 | 0.037 | 0.512 | 3.5e-19 | |
| UNIPROTKB|E2R266 | 2161 | MYO9B "Uncharacterized protein | 0.544 | 0.037 | 0.512 | 3.5e-19 | |
| UNIPROTKB|G3MXH1 | 1104 | Bt.27781 "Uncharacterized prot | 0.462 | 0.061 | 0.588 | 5e-19 | |
| UNIPROTKB|H3BMM1 | 1301 | MYO9A "Unconventional myosin-I | 0.462 | 0.052 | 0.588 | 6.2e-19 | |
| UNIPROTKB|G3MXE8 | 1951 | Bt.27781 "Uncharacterized prot | 0.462 | 0.034 | 0.588 | 1e-18 |
| UNIPROTKB|F1S9U2 F1S9U2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 246 (91.7 bits), Expect = 4.0e-20, P = 4.0e-20
Identities = 41/80 (51%), Positives = 56/80 (70%)
Query: 66 FEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLC 125
FEQ CINYANE LQYYFNQH+F+ EQEEY EGI W +I+++DN C+ L+ KP GL
Sbjct: 405 FEQFCINYANEQLQYYFNQHIFKLEQEEYQSEGISWHNIDYTDNVGCIHLISKKPTGLFY 464
Query: 126 VLDDQAKFSLIPPDDILCRY 145
+LD+++ F +L ++
Sbjct: 465 LLDEESNFPHATSQTLLAKF 484
|
|
| WB|WBGene00002040 hum-7 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BS57 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C471 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C470 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BNV7 MYO9B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R266 MYO9B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MXH1 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BMM1 MYO9A "Unconventional myosin-IXa" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MXE8 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 147 | |||
| cd01385 | 692 | cd01385, MYSc_type_IX, Myosin motor domain, type I | 3e-34 | |
| smart00242 | 677 | smart00242, MYSc, Myosin | 8e-34 | |
| cd00124 | 679 | cd00124, MYSc, Myosin motor domain | 6e-31 | |
| cd01381 | 671 | cd01381, MYSc_type_VII, Myosin motor domain, type | 9e-29 | |
| cd01384 | 674 | cd01384, MYSc_type_XI, Myosin motor domain, plant- | 1e-28 | |
| pfam00063 | 679 | pfam00063, Myosin_head, Myosin head (motor domain) | 2e-28 | |
| cd01380 | 691 | cd01380, MYSc_type_V, Myosin motor domain, type V | 3e-27 | |
| cd01387 | 677 | cd01387, MYSc_type_XV, Myosin motor domain, type X | 1e-25 | |
| cd01383 | 677 | cd01383, MYSc_type_VIII, Myosin motor domain, plan | 2e-25 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 3e-25 | |
| cd01379 | 653 | cd01379, MYSc_type_III, Myosin motor domain, type | 8e-23 | |
| cd01377 | 693 | cd01377, MYSc_type_II, Myosin motor domain, type I | 5e-22 | |
| pfam04675 | 177 | pfam04675, DNA_ligase_A_N, DNA ligase N terminus | 2e-21 | |
| cd01378 | 674 | cd01378, MYSc_type_I, Myosin motor domain, type I | 2e-21 | |
| cd01382 | 717 | cd01382, MYSc_type_VI, Myosin motor domain, type V | 1e-20 | |
| TIGR00574 | 514 | TIGR00574, dnl1, DNA ligase I, ATP-dependent (dnl1 | 7e-18 | |
| PLN03113 | 744 | PLN03113, PLN03113, DNA ligase 1; Provisional | 2e-15 | |
| PTZ00014 | 821 | PTZ00014, PTZ00014, myosin-A; Provisional | 8e-11 | |
| PRK01109 | 590 | PRK01109, PRK01109, ATP-dependent DNA ligase; Prov | 6e-10 | |
| PRK03180 | 508 | PRK03180, ligB, ATP-dependent DNA ligase; Reviewed | 7e-05 | |
| cd01386 | 767 | cd01386, MYSc_type_XVIII, Myosin motor domain, typ | 8e-05 |
| >gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
Score = 125 bits (315), Expect = 3e-34
Identities = 46/86 (53%), Positives = 59/86 (68%)
Query: 60 IGLAEHFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGK 119
G FEQLCINYANE LQYYFNQH+F+ EQEEY EGI W +IE++DN C+QL K
Sbjct: 389 FGRCNSFEQLCINYANEQLQYYFNQHIFKLEQEEYQGEGITWTNIEYTDNVGCIQLFSKK 448
Query: 120 PNGLLCVLDDQAKFSLIPPDDILCRY 145
P GLL +LD+++ F +L ++
Sbjct: 449 PTGLLYLLDEESNFPHATSQTLLAKF 474
|
Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 692 |
| >gnl|CDD|214580 smart00242, MYSc, Myosin | Back alignment and domain information |
|---|
| >gnl|CDD|238071 cd00124, MYSc, Myosin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) | Back alignment and domain information |
|---|
| >gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >gnl|CDD|218206 pfam04675, DNA_ligase_A_N, DNA ligase N terminus | Back alignment and domain information |
|---|
| >gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >gnl|CDD|233029 TIGR00574, dnl1, DNA ligase I, ATP-dependent (dnl1) | Back alignment and domain information |
|---|
| >gnl|CDD|215584 PLN03113, PLN03113, DNA ligase 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234900 PRK01109, PRK01109, ATP-dependent DNA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235108 PRK03180, ligB, ATP-dependent DNA ligase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 147 | |||
| PTZ00014 | 821 | myosin-A; Provisional | 100.0 | |
| cd01381 | 671 | MYSc_type_VII Myosin motor domain, type VII myosin | 100.0 | |
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 100.0 | |
| cd01383 | 677 | MYSc_type_VIII Myosin motor domain, plant-specific | 100.0 | |
| cd01387 | 677 | MYSc_type_XV Myosin motor domain, type XV myosins. | 100.0 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 100.0 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 100.0 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 100.0 | |
| cd01385 | 692 | MYSc_type_IX Myosin motor domain, type IX myosins. | 100.0 | |
| cd01382 | 717 | MYSc_type_VI Myosin motor domain, type VI myosins. | 100.0 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 100.0 | |
| cd01380 | 691 | MYSc_type_V Myosin motor domain, type V myosins. M | 100.0 | |
| smart00242 | 677 | MYSc Myosin. Large ATPases. ATPase; molecular moto | 100.0 | |
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 100.0 | |
| cd01386 | 767 | MYSc_type_XVIII Myosin motor domain, type XVIII my | 100.0 | |
| PF00063 | 689 | Myosin_head: Myosin head (motor domain); InterPro: | 100.0 | |
| KOG0164|consensus | 1001 | 100.0 | ||
| KOG0161|consensus | 1930 | 100.0 | ||
| KOG0162|consensus | 1106 | 100.0 | ||
| KOG0163|consensus | 1259 | 100.0 | ||
| KOG0160|consensus | 862 | 100.0 | ||
| KOG4229|consensus | 1062 | 99.97 | ||
| KOG0967|consensus | 714 | 98.63 | ||
| PLN03113 | 744 | DNA ligase 1; Provisional | 97.67 | |
| PF04675 | 177 | DNA_ligase_A_N: DNA ligase N terminus; InterPro: I | 97.35 | |
| PRK01109 | 590 | ATP-dependent DNA ligase; Provisional | 96.28 | |
| TIGR00574 | 514 | dnl1 DNA ligase I, ATP-dependent (dnl1). All prote | 96.26 | |
| PRK03180 | 508 | ligB ATP-dependent DNA ligase; Reviewed | 95.99 | |
| PRK09247 | 539 | ATP-dependent DNA ligase; Validated | 92.88 |
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.9e-45 Score=319.41 Aligned_cols=142 Identities=20% Similarity=0.211 Sum_probs=137.7
Q ss_pred CCCCCHHHHHHHHHHHHHHHhHHHHHHHHHHhhhhhhcCCcCcceeeeeeccchhhhhhhHHHHHHHhhhhhhHHHHHHH
Q psy5254 4 PAPLTVATVFDKLKDIAGMTGQASVSRKIDKIQSLFVACRHCEARYLIRSLAGKLRIGLAEHFEQLCINYANEHLQYYFN 83 (147)
Q Consensus 4 ~~~Ltv~~v~~~~~~ia~~ly~~lf~~iv~~in~~L~~~~~~~~~i~ildi~Gfe~~~~~~~~eql~iN~~nE~l~~~~~ 83 (147)
..|+|+++|..+||++|+++|++||+|+|+.||..|.+......+|||+||+|||.+. .|+|||||||||||+||++|+
T Consensus 419 ~~~~~~~qA~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~~~~~IGiLDI~GFE~f~-~NSfEQLcINy~NEkLQq~F~ 497 (821)
T PTZ00014 419 EGPWSKDESEMLKDSLSKAVYEKLFLWIIRNLNATIEPPGGFKVFIGMLDIFGFEVFK-NNSLEQLFINITNEMLQKNFV 497 (821)
T ss_pred ecCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccCceEEEEecccccccC-cchHHHHHHHHHHHHHHHHHH
Confidence 3689999999999999999999999999999999998877777899999999999999 999999999999999999999
Q ss_pred HhhhHHHHHHhhhhCcccccccccCchhHHHHhhcCcccccccchhhhhcCCCCchHHHHhhh
Q psy5254 84 QHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQAKFSLIPPDDILCRYF 146 (147)
Q Consensus 84 ~~~~~~~~~~~~~Egi~~~~~~~~dn~~~~~li~~~p~Gll~lLdee~~~p~~td~~fl~kl~ 146 (147)
+++|..+|++|.+|||.|..++|.||++|+|||+++|.|||++|||||++|++||++|++||+
T Consensus 498 ~~vF~~EqeeY~~EgI~~~~i~f~dN~~~idLie~k~~GIl~lLDEec~~p~~tD~~f~~kl~ 560 (821)
T PTZ00014 498 DIVFERESKLYKDEGISTEELEYTSNESVIDLLCGKGKSVLSILEDQCLAPGGTDEKFVSSCN 560 (821)
T ss_pred HHHHHHHHHHHHHccccCCCCCCCCcHHHHHHHhcCCccHHHHHHHHhCCCCCCHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999999999999986
|
|
| >cd01381 MYSc_type_VII Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >cd01387 MYSc_type_XV Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >cd01385 MYSc_type_IX Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >cd01382 MYSc_type_VI Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01380 MYSc_type_V Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >smart00242 MYSc Myosin | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0164|consensus | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG0163|consensus | Back alignment and domain information |
|---|
| >KOG0160|consensus | Back alignment and domain information |
|---|
| >KOG4229|consensus | Back alignment and domain information |
|---|
| >KOG0967|consensus | Back alignment and domain information |
|---|
| >PLN03113 DNA ligase 1; Provisional | Back alignment and domain information |
|---|
| >PF04675 DNA_ligase_A_N: DNA ligase N terminus; InterPro: IPR012308 DNA ligase (polydeoxyribonucleotide synthase) is the enzyme that joins two DNA fragments by catalysing the formation of an internucleotide ester bond between phosphate and deoxyribose | Back alignment and domain information |
|---|
| >PRK01109 ATP-dependent DNA ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR00574 dnl1 DNA ligase I, ATP-dependent (dnl1) | Back alignment and domain information |
|---|
| >PRK03180 ligB ATP-dependent DNA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK09247 ATP-dependent DNA ligase; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 147 | ||||
| 2ec6_A | 838 | Placopecten Striated Muscle Myosin Ii Length = 838 | 3e-16 | ||
| 2os8_A | 840 | Rigor-Like Structures Of Muscle Myosins Reveal Key | 3e-16 | ||
| 1b7t_A | 835 | Myosin Digested By Papain Length = 835 | 5e-16 | ||
| 1dfl_A | 831 | Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra | 5e-16 | ||
| 1dfk_A | 830 | Nucleotide-Free Scallop Myosin S1-Near Rigor State | 5e-16 | ||
| 1qvi_A | 840 | Crystal Structure Of Scallop Myosin S1 In The Pre-P | 6e-16 | ||
| 1kk7_A | 837 | Scallop Myosin In The Near Rigor Conformation Lengt | 6e-16 | ||
| 1x9n_A | 688 | Crystal Structure Of Human Dna Ligase I Bound To 5' | 8e-16 | ||
| 3i5g_A | 839 | Crystal Structure Of Rigor-Like Squid Myosin S1 Len | 9e-16 | ||
| 2xo8_A | 776 | Crystal Structure Of Myosin-2 In Complex With Tribr | 1e-15 | ||
| 3mnq_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-15 | ||
| 2x9h_A | 695 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-15 | ||
| 2xel_A | 776 | Molecular Mechanism Of Pentachloropseudilin Mediate | 1e-15 | ||
| 2jhr_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-15 | ||
| 1mma_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 1e-15 | ||
| 2y9e_X | 758 | Structural Basis For The Allosteric Interference Of | 1e-15 | ||
| 1jwy_A | 776 | Crystal Structure Of The Dynamin A Gtpase Domain Co | 1e-15 | ||
| 2aka_A | 776 | Structure Of The Nucleotide-Free Myosin Ii Motor Do | 1e-15 | ||
| 1fmv_A | 761 | Crystal Structure Of The Apo Motor Domain Of Dictyo | 1e-15 | ||
| 2y0r_X | 758 | Structural Basis For The Allosteric Interference Of | 1e-15 | ||
| 1d0x_A | 761 | Dictyostelium Myosin S1dc (Motor Domain Fragment) C | 2e-15 | ||
| 1yv3_A | 762 | The Structural Basis Of Blebbistatin Inhibition And | 2e-15 | ||
| 3myh_X | 762 | Insights Into The Importance Of Hydrogen Bonding In | 2e-15 | ||
| 1mmn_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 2e-15 | ||
| 1g8x_A | 1010 | Structure Of A Genetically Engineered Molecular Mot | 2e-15 | ||
| 1oe9_A | 795 | Crystal Structure Of Myosin V Motor With Essential | 2e-15 | ||
| 1mmg_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 2e-15 | ||
| 1mmd_A | 762 | Truncated Head Of Myosin From Dictyostelium Discoid | 2e-15 | ||
| 1w8j_A | 766 | Crystal Structure Of Myosin V Motor Domain - Nucleo | 2e-15 | ||
| 1w9l_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 2e-15 | ||
| 1w9j_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 2e-15 | ||
| 1w9i_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 2e-15 | ||
| 2dfs_A | 1080 | 3-D Structure Of Myosin-V Inhibited State Length = | 2e-15 | ||
| 3mkd_A | 692 | Crystal Structure Of Myosin-2 Dictyostelium Discoid | 2e-15 | ||
| 1w9k_A | 770 | Dictyostelium Discoideum Myosin Ii Motor Domain S45 | 2e-15 | ||
| 2w4g_M | 840 | Isometrically Contracting Insect Asynchronous Fligh | 2e-15 | ||
| 4db1_A | 783 | Cardiac Human Myosin S1dc, Beta Isoform Complexed W | 4e-15 | ||
| 1lvk_A | 762 | X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N | 5e-15 | ||
| 2mys_A | 843 | Myosin Subfragment-1, Alpha Carbon Coordinates Only | 7e-14 | ||
| 1m8q_A | 840 | Molecular Models Of Averaged Rigor Crossbridges Fro | 7e-14 | ||
| 1br1_A | 820 | Smooth Muscle Myosin Motor Domain-Essential Light C | 3e-13 | ||
| 1br2_A | 791 | Smooth Muscle Myosin Motor Domain Complexed With Mg | 3e-13 | ||
| 3dtp_A | 971 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 3e-13 | ||
| 3dtp_B | 973 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 3e-13 | ||
| 3j04_A | 909 | Em Structure Of The Heavy Meromyosin Subfragment Of | 3e-13 | ||
| 1i84_S | 1184 | Cryo-Em Structure Of The Heavy Meromyosin Subfragme | 3e-13 | ||
| 2ycu_A | 995 | Crystal Structure Of Human Non Muscle Myosin 2c In | 4e-13 | ||
| 2bki_A | 858 | Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St | 3e-12 | ||
| 4dbr_A | 786 | Myosin Vi D179y (md) Pre-powerstroke State Length = | 3e-12 | ||
| 4e7z_A | 798 | Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F | 3e-12 | ||
| 4e7s_A | 798 | Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat | 3e-12 | ||
| 2x51_A | 789 | M6 Delta Insert1 Length = 789 | 3e-12 | ||
| 2vas_A | 788 | Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo | 3e-12 | ||
| 4dbq_A | 788 | Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos | 3e-12 | ||
| 4dbp_A | 814 | Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal | 3e-12 | ||
| 3l9i_A | 814 | Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant | 3e-12 | ||
| 2bkh_A | 814 | Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc | 3e-12 | ||
| 2v26_A | 784 | Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L | 3e-12 | ||
| 4anj_A | 1052 | Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St | 4e-12 | ||
| 1lkx_A | 697 | Motor Domain Of Myoe, A Class-I Myosin Length = 697 | 4e-12 | ||
| 4a7f_C | 697 | Structure Of The Actin-Tropomyosin-Myosin Complex ( | 5e-12 | ||
| 2cfm_A | 561 | Atp-Dependent Dna Ligase From Pyrococcus Furiosus L | 4e-06 | ||
| 4eq5_A | 571 | Dna Ligase From The Archaeon Thermococcus Sibiricus | 9e-06 | ||
| 3rr5_A | 570 | Dna Ligase From The Archaeon Thermococcus Sp. 1519 | 2e-05 | ||
| 3gde_A | 558 | The Closed Conformation Of Atp-Dependent Dna Ligase | 3e-05 | ||
| 2hiv_A | 621 | Atp-Dependent Dna Ligase From S. Solfataricus Lengt | 5e-04 |
| >pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 | Back alignment and structure |
|
| >pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 | Back alignment and structure |
| >pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 | Back alignment and structure |
| >pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 | Back alignment and structure |
| >pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 | Back alignment and structure |
| >pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 | Back alignment and structure |
| >pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 | Back alignment and structure |
| >pdb|1X9N|A Chain A, Crystal Structure Of Human Dna Ligase I Bound To 5'-Adenylated, Nicked Dna Length = 688 | Back alignment and structure |
| >pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 | Back alignment and structure |
| >pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 | Back alignment and structure |
| >pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 | Back alignment and structure |
| >pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 | Back alignment and structure |
| >pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 | Back alignment and structure |
| >pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 | Back alignment and structure |
| >pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 | Back alignment and structure |
| >pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 | Back alignment and structure |
| >pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 | Back alignment and structure |
| >pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 | Back alignment and structure |
| >pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 | Back alignment and structure |
| >pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 | Back alignment and structure |
| >pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 | Back alignment and structure |
| >pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 | Back alignment and structure |
| >pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 | Back alignment and structure |
| >pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 | Back alignment and structure |
| >pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 | Back alignment and structure |
| >pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 | Back alignment and structure |
| >pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 | Back alignment and structure |
| >pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 | Back alignment and structure |
| >pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 | Back alignment and structure |
| >pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 | Back alignment and structure |
| >pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 | Back alignment and structure |
| >pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 | Back alignment and structure |
| >pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 | Back alignment and structure |
| >pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 | Back alignment and structure |
| >pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 | Back alignment and structure |
| >pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 | Back alignment and structure |
| >pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 | Back alignment and structure |
| >pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 | Back alignment and structure |
| >pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 | Back alignment and structure |
| >pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 | Back alignment and structure |
| >pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 | Back alignment and structure |
| >pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 | Back alignment and structure |
| >pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 | Back alignment and structure |
| >pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 | Back alignment and structure |
| >pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 | Back alignment and structure |
| >pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 | Back alignment and structure |
| >pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 | Back alignment and structure |
| >pdb|2CFM|A Chain A, Atp-Dependent Dna Ligase From Pyrococcus Furiosus Length = 561 | Back alignment and structure |
| >pdb|4EQ5|A Chain A, Dna Ligase From The Archaeon Thermococcus Sibiricus Length = 571 | Back alignment and structure |
| >pdb|3RR5|A Chain A, Dna Ligase From The Archaeon Thermococcus Sp. 1519 Length = 570 | Back alignment and structure |
| >pdb|3GDE|A Chain A, The Closed Conformation Of Atp-Dependent Dna Ligase From Archaeoglobus Fulgidus Length = 558 | Back alignment and structure |
| >pdb|2HIV|A Chain A, Atp-Dependent Dna Ligase From S. Solfataricus Length = 621 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 147 | |||
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 3e-36 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 3e-35 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-34 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 8e-34 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 3e-32 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 4e-32 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 4e-32 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 1e-31 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 1e-31 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-31 | |
| 3gde_A | 558 | DNA ligase; DNA-binding domain, adenylation domain | 2e-17 | |
| 2hiv_A | 621 | Thermostable DNA ligase; ATP-dependent, open confo | 2e-17 | |
| 1x9n_A | 688 | DNA ligase I; 5'-adenylated nicked DNA, protein-DN | 1e-16 | |
| 2cfm_A | 561 | Thermostable DNA ligase; protein-nucleotide comple | 1e-15 | |
| 3l2p_A | 579 | DNA ligase 3; DNA ligase, DNA repair, ATP-binding, | 3e-14 |
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 | Back alignment and structure |
|---|
Score = 130 bits (329), Expect = 3e-36
Identities = 29/68 (42%), Positives = 44/68 (64%)
Query: 66 FEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLC 125
FEQ CINY NE LQ +FN+ + + EQE Y KEG+ + + DN C+ L+E + G+L
Sbjct: 464 FEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEARLVGILD 523
Query: 126 VLDDQAKF 133
+LD++ +
Sbjct: 524 ILDEENRL 531
|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3gde_A DNA ligase; DNA-binding domain, adenylation domain, OB-fold domain, ATP-binding, cell cycle, cell division, DNA damage, DNA recombination; HET: DNA; 2.30A {Archaeoglobus fulgidus} Length = 558 | Back alignment and structure |
|---|
| >2hiv_A Thermostable DNA ligase; ATP-dependent, open conformation; 2.05A {Sulfolobus solfataricus} PDB: 2hix_A* Length = 621 | Back alignment and structure |
|---|
| >1x9n_A DNA ligase I; 5'-adenylated nicked DNA, protein-DNA complex, L complex; HET: DNA DOC AMP; 3.00A {Homo sapiens} SCOP: a.235.1.1 b.40.4.6 d.142.2.1 Length = 688 | Back alignment and structure |
|---|
| >2cfm_A Thermostable DNA ligase; protein-nucleotide complex, cell cycle, cell division, DNA damage, DNA recombination, DNA repair, DNA replication; HET: AMP; 1.8A {Pyrococcus furiosus} PDB: 3rr5_A* Length = 561 | Back alignment and structure |
|---|
| >3l2p_A DNA ligase 3; DNA ligase, DNA repair, ATP-binding, cell cycle, cell divisi damage; HET: DNA AMP; 3.00A {Homo sapiens} Length = 579 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 147 | |||
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 100.0 | |
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 100.0 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 100.0 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 100.0 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 100.0 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 100.0 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 100.0 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 100.0 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 100.0 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 100.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 100.0 | |
| 4htp_A | 240 | DNA ligase 4; helical domain, DNA binding domain, | 97.39 | |
| 1x9n_A | 688 | DNA ligase I; 5'-adenylated nicked DNA, protein-DN | 96.85 | |
| 3gde_A | 558 | DNA ligase; DNA-binding domain, adenylation domain | 96.4 | |
| 2hiv_A | 621 | Thermostable DNA ligase; ATP-dependent, open confo | 96.05 | |
| 3l2p_A | 579 | DNA ligase 3; DNA ligase, DNA repair, ATP-binding, | 95.72 | |
| 2cfm_A | 561 | Thermostable DNA ligase; protein-nucleotide comple | 95.71 |
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-46 Score=324.49 Aligned_cols=142 Identities=27% Similarity=0.377 Sum_probs=137.5
Q ss_pred CCCCCHHHHHHHHHHHHHHHhHHHHHHHHHHhhhhhhcCCcCcceeeeeeccchhhhhhhHHHHHHHhhhhhhHHHHHHH
Q psy5254 4 PAPLTVATVFDKLKDIAGMTGQASVSRKIDKIQSLFVACRHCEARYLIRSLAGKLRIGLAEHFEQLCINYANEHLQYYFN 83 (147)
Q Consensus 4 ~~~Ltv~~v~~~~~~ia~~ly~~lf~~iv~~in~~L~~~~~~~~~i~ildi~Gfe~~~~~~~~eql~iN~~nE~l~~~~~ 83 (147)
.+|+|+++|.++||++||++|++||+|+|++||..|.+..+...+|||+||+|||.+. .|+|||||||||||+||++|+
T Consensus 337 ~~~l~~~qA~~~rdalaK~lY~rLF~wlV~~IN~~l~~~~~~~~~IGvLDI~GFE~f~-~NsFEQlcINy~NEkLQq~F~ 415 (697)
T 1lkx_A 337 SVPMDCNQAAYSRDALAKALYERLFNWLVSKINTIINCTTEKGPVIGILDIYGFEVFQ-NNSFEQLNINFCNEKLQQLFI 415 (697)
T ss_dssp CCBCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCSCCCCEEEEEECCCCCCCS-SBCHHHHHHHHHHHHHHHHHH
T ss_pred EecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCceeEEeeccccccccC-cCCHHHHHHHhhhhHHHHHHH
Confidence 4789999999999999999999999999999999998766668899999999999999 999999999999999999999
Q ss_pred HhhhHHHHHHhhhhCcccccccccCchhHHHHhhcCcccccccchhhhhcCCCCchHHHHhhh
Q psy5254 84 QHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQAKFSLIPPDDILCRYF 146 (147)
Q Consensus 84 ~~~~~~~~~~~~~Egi~~~~~~~~dn~~~~~li~~~p~Gll~lLdee~~~p~~td~~fl~kl~ 146 (147)
+++|..+|++|.+|||+|..++|.||++|+|||+++|.|||++|||||++|++||++|++||+
T Consensus 416 ~~~f~~EqeeY~~EgI~w~~i~f~dN~~~idLie~kp~GilslLDEec~~p~~tD~~f~~kl~ 478 (697)
T 1lkx_A 416 ELTLKSEQEEYVREGIEWKNIEYFNNKPICELIEKKPIGLISLLDEACLIAKSTDQTFLDSIC 478 (697)
T ss_dssp HHHTHHHHHHHHHTTCCCCCCCCSCCCHHHHHTTSSSSSHHHHHHHHHHSTTCCHHHHHHHHH
T ss_pred HHHHHHHHHHHHhcCCcccccCCCCCHHHHHHHhcccCChhhhhHHhhCCCCCChHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999999999999986
|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >4htp_A DNA ligase 4; helical domain, DNA binding domain, DNA, ligase-HYD complex; HET: DNA; 2.25A {Homo sapiens} PDB: 4hto_A* | Back alignment and structure |
|---|
| >1x9n_A DNA ligase I; 5'-adenylated nicked DNA, protein-DNA complex, L complex; HET: DNA DOC AMP; 3.00A {Homo sapiens} SCOP: a.235.1.1 b.40.4.6 d.142.2.1 | Back alignment and structure |
|---|
| >3gde_A DNA ligase; DNA-binding domain, adenylation domain, OB-fold domain, ATP-binding, cell cycle, cell division, DNA damage, DNA recombination; HET: DNA; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2hiv_A Thermostable DNA ligase; ATP-dependent, open conformation; 2.05A {Sulfolobus solfataricus} PDB: 2hix_A* | Back alignment and structure |
|---|
| >3l2p_A DNA ligase 3; DNA ligase, DNA repair, ATP-binding, cell cycle, cell divisi damage; HET: DNA AMP; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2cfm_A Thermostable DNA ligase; protein-nucleotide complex, cell cycle, cell division, DNA damage, DNA recombination, DNA repair, DNA replication; HET: AMP; 1.8A {Pyrococcus furiosus} PDB: 3rr5_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 147 | ||||
| d1lkxa_ | 684 | c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli | 5e-17 | |
| d1x9na1 | 272 | a.235.1.1 (A:262-533) DNA ligase I (LIG1) {Human ( | 6e-16 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 2e-15 | |
| d1br2a2 | 710 | c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick | 3e-15 | |
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 3e-15 | |
| d1w7ja2 | 730 | c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick | 7e-15 | |
| d1d0xa2 | 712 | c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain | 7e-14 |
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]
Score = 74.3 bits (182), Expect = 5e-17
Identities = 31/69 (44%), Positives = 44/69 (63%)
Query: 65 HFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 124
FEQL IN+ NE LQ F + + EQEEY +EGI W++IE+ +N +L+E KP GL+
Sbjct: 389 SFEQLNINFCNEKLQQLFIELTLKSEQEEYVREGIEWKNIEYFNNKPICELIEKKPIGLI 448
Query: 125 CVLDDQAKF 133
+LD+
Sbjct: 449 SLLDEACLI 457
|
| >d1x9na1 a.235.1.1 (A:262-533) DNA ligase I (LIG1) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 147 | |||
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 100.0 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 100.0 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 100.0 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 100.0 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 100.0 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 100.0 | |
| d1x9na1 | 272 | DNA ligase I (LIG1) {Human (Homo sapiens) [TaxId: | 98.1 |
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]
Probab=100.00 E-value=1.8e-41 Score=290.98 Aligned_cols=142 Identities=27% Similarity=0.377 Sum_probs=137.7
Q ss_pred CCCCCHHHHHHHHHHHHHHHhHHHHHHHHHHhhhhhhcCCcCcceeeeeeccchhhhhhhHHHHHHHhhhhhhHHHHHHH
Q psy5254 4 PAPLTVATVFDKLKDIAGMTGQASVSRKIDKIQSLFVACRHCEARYLIRSLAGKLRIGLAEHFEQLCINYANEHLQYYFN 83 (147)
Q Consensus 4 ~~~Ltv~~v~~~~~~ia~~ly~~lf~~iv~~in~~L~~~~~~~~~i~ildi~Gfe~~~~~~~~eql~iN~~nE~l~~~~~ 83 (147)
..|+++++|...||++|+++|+++|+|+|+.||..|.+......+|+|+|+||||.+. .|+|||||||||||+||++|+
T Consensus 329 ~~~~~~~~A~~~rdalak~LY~~LF~wiv~~IN~~L~~~~~~~~~IgiLDifGFE~f~-~NsfEQLcINyaNEkLq~~f~ 407 (684)
T d1lkxa_ 329 SVPMDCNQAAYSRDALAKALYERLFNWLVSKINTIINCTTEKGPVIGILDIYGFEVFQ-NNSFEQLNINFCNEKLQQLFI 407 (684)
T ss_dssp CCBCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCSCCCCEEEEEECCCCCCCS-SBCHHHHHHHHHHHHHHHHHH
T ss_pred EecCCHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcCCCCcccceEEEeeccCCcCCC-CCcHHHHHHHHHHHHHHHHHH
Confidence 4689999999999999999999999999999999998877778899999999999999 999999999999999999999
Q ss_pred HhhhHHHHHHhhhhCcccccccccCchhHHHHhhcCcccccccchhhhhcCCCCchHHHHhhh
Q psy5254 84 QHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQAKFSLIPPDDILCRYF 146 (147)
Q Consensus 84 ~~~~~~~~~~~~~Egi~~~~~~~~dn~~~~~li~~~p~Gll~lLdee~~~p~~td~~fl~kl~ 146 (147)
+++|..++++|..|||+|..++|.||++|++||+++|.||+++|||||++|++||++|++|++
T Consensus 408 ~~if~~e~~~Y~~EgI~~~~i~~~dN~~~l~li~~~~~Gil~lLdee~~~~~~tD~~~l~kl~ 470 (684)
T d1lkxa_ 408 ELTLKSEQEEYVREGIEWKNIEYFNNKPICELIEKKPIGLISLLDEACLIAKSTDQTFLDSIC 470 (684)
T ss_dssp HHHTHHHHHHHHHTTCCCCCCCCSCCCHHHHHTTSSSSSHHHHHHHHHHSTTCCHHHHHHHHH
T ss_pred HHHHhHHHHHHHhccCCCCCCCcCCchHHHHHHHhccchHHHHhHHHhcCCCCchHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999999999999985
|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x9na1 a.235.1.1 (A:262-533) DNA ligase I (LIG1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|