Psyllid ID: psy5317


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MNSTSYTLLPKYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFGRGKTSRPHVLTTGIAAAFILMSAAKLTKPSF
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHccccccccc
cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccc
mnstsytllpkygLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHlskdglypyigwfgrgktsrphvlTTGIAAAFILMSAakltkpsf
mnstsytllpkYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFGRGKTSRPHVLTTGIAAAFILMSAakltkpsf
MNSTSYTLLPKYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFGRGKTSRPHVLTTGIAAAFILMSAAKLTKPSF
*****YTLLPKYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFGRGKTSRPHVLTTGIAAAFILMSA********
********LPKYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFGRGKTSRPHVLTTGIAAAFILMSAAKLTKPSF
MNSTSYTLLPKYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFGRGKTSRPHVLTTGIAAAFILMSAAKLTKPSF
****SYTLLPKYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFGRGKTSRPHVLTTGIAAAFILMSAAKLTKPSF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooo
ooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSTSYTLLPKYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFGRGKTSRPHVLTTGIAAAFILMSAAKLTKPSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query101 2.2.26 [Sep-21-2011]
P55019 1023 Solute carrier family 12 N/A N/A 0.881 0.086 0.393 3e-13
Q13621 1099 Solute carrier family 12 yes N/A 0.881 0.080 0.361 1e-10
P55011 1212 Solute carrier family 12 no N/A 0.871 0.072 0.354 7e-10
P55016 1095 Solute carrier family 12 no N/A 0.881 0.081 0.351 7e-10
P55012 1205 Solute carrier family 12 yes N/A 0.871 0.073 0.354 8e-10
P55014 1095 Solute carrier family 12 no N/A 0.881 0.081 0.351 9e-10
P55013 1191 Solute carrier family 12 N/A N/A 0.871 0.073 0.365 1e-09
P55015 1099 Solute carrier family 12 no N/A 0.881 0.080 0.351 1e-09
P55018 1002 Solute carrier family 12 no N/A 0.663 0.066 0.391 4e-09
P59158 1002 Solute carrier family 12 no N/A 0.613 0.061 0.403 5e-09
>sp|P55019|S12A3_PSEAM Solute carrier family 12 member 3 OS=Pseudopleuronectes americanus GN=slc12a3 PE=2 SV=1 Back     alignment and function desciption
 Score = 73.6 bits (179), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 59/94 (62%), Gaps = 5/94 (5%)

Query: 11  KYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFG 70
           K+G+  Y++S+ L+SAF+PL  + +  + L+ A + L  AP+VF+ L KD LYP IG+FG
Sbjct: 436 KHGIMNYYQSMSLVSAFAPLISAGIFGATLSSALACLVSAPKVFQCLCKDQLYPLIGFFG 495

Query: 71  R--GKTSRP---HVLTTGIAAAFILMSAAKLTKP 99
           +  GK + P   ++LT  IA  F+L++      P
Sbjct: 496 KGYGKNAEPLRAYLLTYVIAVCFVLIAELNTIAP 529




Electrically silent transporter system. Mediates sodium and chloride reabsorption.
Pseudopleuronectes americanus (taxid: 8265)
>sp|Q13621|S12A1_HUMAN Solute carrier family 12 member 1 OS=Homo sapiens GN=SLC12A1 PE=1 SV=2 Back     alignment and function description
>sp|P55011|S12A2_HUMAN Solute carrier family 12 member 2 OS=Homo sapiens GN=SLC12A2 PE=1 SV=1 Back     alignment and function description
>sp|P55016|S12A1_RAT Solute carrier family 12 member 1 OS=Rattus norvegicus GN=Slc12a1 PE=1 SV=1 Back     alignment and function description
>sp|P55012|S12A2_MOUSE Solute carrier family 12 member 2 OS=Mus musculus GN=Slc12a2 PE=1 SV=2 Back     alignment and function description
>sp|P55014|S12A1_MOUSE Solute carrier family 12 member 1 OS=Mus musculus GN=Slc12a1 PE=2 SV=2 Back     alignment and function description
>sp|P55013|S12A2_SQUAC Solute carrier family 12 member 2 OS=Squalus acanthias GN=SLC12A2 PE=1 SV=1 Back     alignment and function description
>sp|P55015|S12A1_RABIT Solute carrier family 12 member 1 OS=Oryctolagus cuniculus GN=SLC12A1 PE=2 SV=1 Back     alignment and function description
>sp|P55018|S12A3_RAT Solute carrier family 12 member 3 OS=Rattus norvegicus GN=Slc12a3 PE=2 SV=2 Back     alignment and function description
>sp|P59158|S12A3_MOUSE Solute carrier family 12 member 3 OS=Mus musculus GN=Slc12a3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
195327109 1171 GM24663 [Drosophila sechellia] gi|194119 0.881 0.076 0.478 6e-14
195440758 1189 GK12754 [Drosophila willistoni] gi|19416 0.881 0.074 0.468 9e-14
195589804 1167 GD12726 [Drosophila simulans] gi|1941966 0.881 0.076 0.468 2e-13
21358517 1171 sodium chloride cotransporter 69, isofor 0.881 0.076 0.468 2e-13
242016302 1067 sodium-potassium-chloride cotransporter, 0.881 0.083 0.436 2e-13
442631930 1191 sodium chloride cotransporter 69, isofor 0.881 0.074 0.468 2e-13
442631934 1207 sodium chloride cotransporter 69, isofor 0.881 0.073 0.468 2e-13
170071595 799 bumetanide-sensitive Na-K-Cl cotransport 0.881 0.111 0.436 2e-13
195160607 942 GL24962 [Drosophila persimilis] gi|19411 0.881 0.094 0.446 3e-13
198464853 1187 GA18131 [Drosophila pseudoobscura pseudo 0.881 0.074 0.446 4e-13
>gi|195327109|ref|XP_002030264.1| GM24663 [Drosophila sechellia] gi|194119207|gb|EDW41250.1| GM24663 [Drosophila sechellia] Back     alignment and taxonomy information
 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 58/94 (61%), Gaps = 5/94 (5%)

Query: 11  KYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWF- 69
           KYGL+  F+ +EL+SAF PL Y+    + L+ A +SL  AP+VF+ L KD LYP I WF 
Sbjct: 506 KYGLQNSFQVIELVSAFGPLIYAGCYAATLSSALASLVSAPKVFQALCKDELYPKIVWFA 565

Query: 70  -GRGKTSRP---HVLTTGIAAAFILMSAAKLTKP 99
            G GK + P   +VLT  IA AFIL+    L  P
Sbjct: 566 KGYGKNNEPVRGYVLTFVIACAFILIGELNLIAP 599




Source: Drosophila sechellia

Species: Drosophila sechellia

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195440758|ref|XP_002068207.1| GK12754 [Drosophila willistoni] gi|194164292|gb|EDW79193.1| GK12754 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195589804|ref|XP_002084639.1| GD12726 [Drosophila simulans] gi|194196648|gb|EDX10224.1| GD12726 [Drosophila simulans] Back     alignment and taxonomy information
>gi|21358517|ref|NP_648572.1| sodium chloride cotransporter 69, isoform A [Drosophila melanogaster] gi|45553077|ref|NP_996066.1| sodium chloride cotransporter 69, isoform G [Drosophila melanogaster] gi|7294587|gb|AAF49927.1| sodium chloride cotransporter 69, isoform A [Drosophila melanogaster] gi|20151457|gb|AAM11088.1| GH27027p [Drosophila melanogaster] gi|45445912|gb|AAS65014.1| sodium chloride cotransporter 69, isoform G [Drosophila melanogaster] gi|220956690|gb|ACL90888.1| Ncc69-PA [synthetic construct] Back     alignment and taxonomy information
>gi|242016302|ref|XP_002428768.1| sodium-potassium-chloride cotransporter, putative [Pediculus humanus corporis] gi|212513453|gb|EEB16030.1| sodium-potassium-chloride cotransporter, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|442631930|ref|NP_001261756.1| sodium chloride cotransporter 69, isoform C [Drosophila melanogaster] gi|442631932|ref|NP_001261757.1| sodium chloride cotransporter 69, isoform D [Drosophila melanogaster] gi|442631936|ref|NP_001261759.1| sodium chloride cotransporter 69, isoform F [Drosophila melanogaster] gi|440215687|gb|AGB94449.1| sodium chloride cotransporter 69, isoform C [Drosophila melanogaster] gi|440215688|gb|AGB94450.1| sodium chloride cotransporter 69, isoform D [Drosophila melanogaster] gi|440215690|gb|AGB94452.1| sodium chloride cotransporter 69, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442631934|ref|NP_001261758.1| sodium chloride cotransporter 69, isoform E [Drosophila melanogaster] gi|440215689|gb|AGB94451.1| sodium chloride cotransporter 69, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|170071595|ref|XP_001869952.1| bumetanide-sensitive Na-K-Cl cotransport protein [Culex quinquefasciatus] gi|167867542|gb|EDS30925.1| bumetanide-sensitive Na-K-Cl cotransport protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195160607|ref|XP_002021166.1| GL24962 [Drosophila persimilis] gi|194118279|gb|EDW40322.1| GL24962 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198464853|ref|XP_001353388.2| GA18131 [Drosophila pseudoobscura pseudoobscura] gi|198149909|gb|EAL30895.2| GA18131 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
FB|FBgn0036279 1171 Ncc69 "sodium chloride cotrans 0.871 0.075 0.473 1.2e-13
UNIPROTKB|F1N9F6 976 SLC12A3 "Uncharacterized prote 0.881 0.091 0.404 1.7e-12
ZFIN|ZDB-GENE-040625-53 1136 slc12a2 "solute carrier family 0.881 0.078 0.404 9.3e-12
ZFIN|ZDB-GENE-060503-330 1020 slc12a10.1 "solute carrier fam 0.871 0.086 0.387 5.8e-11
RGD|3686 1002 Slc12a3 "solute carrier family 0.881 0.088 0.361 1.5e-10
ZFIN|ZDB-GENE-030131-9505 1012 slc12a3 "solute carrier family 0.871 0.086 0.387 1.5e-10
MGI|MGI:108114 1002 Slc12a3 "solute carrier family 0.881 0.088 0.361 1.9e-10
UNIPROTKB|J9PA00 408 SLC12A1 "Uncharacterized prote 0.881 0.218 0.361 3.5e-10
UNIPROTKB|F6UKR7 1028 SLC12A3 "Uncharacterized prote 0.881 0.086 0.351 4.2e-10
UNIPROTKB|E2QRQ5 1029 SLC12A3 "Uncharacterized prote 0.881 0.086 0.351 4.2e-10
FB|FBgn0036279 Ncc69 "sodium chloride cotransporter 69" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 191 (72.3 bits), Expect = 1.2e-13, P = 1.2e-13
 Identities = 44/93 (47%), Positives = 57/93 (61%)

Query:    12 YGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWF-- 69
             YGL+  F+ +EL+SAF PL Y+    + L+ A +SL  AP+VF+ L KD LYP I WF  
Sbjct:   507 YGLQNSFQVIELVSAFGPLIYAGCYAATLSSALASLVSAPKVFQALCKDELYPKIVWFAK 566

Query:    70 GRGKTSRP---HVLTTGIAAAFILMSAAKLTKP 99
             G GK + P   +VLT  IA AFIL+    L  P
Sbjct:   567 GYGKNNEPVRGYVLTFIIACAFILIGELNLIAP 599




GO:0015378 "sodium:chloride symporter activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0003333 "amino acid transmembrane transport" evidence=ISS
GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS
GO:0008511 "sodium:potassium:chloride symporter activity" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0006813 "potassium ion transport" evidence=IDA
GO:0035826 "rubidium ion transport" evidence=IDA
GO:0006821 "chloride transport" evidence=IDA
UNIPROTKB|F1N9F6 SLC12A3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-53 slc12a2 "solute carrier family 12 (potassium/chloride transporters), member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-330 slc12a10.1 "solute carrier family 12 (sodium/potassium/chloride transporters), member 10.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|3686 Slc12a3 "solute carrier family 12 (sodium/chloride transporters), member 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9505 slc12a3 "solute carrier family 12 (sodium/chloride transporters), member 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:108114 Slc12a3 "solute carrier family 12, member 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9PA00 SLC12A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6UKR7 SLC12A3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QRQ5 SLC12A3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
TIGR00930 953 TIGR00930, 2a30, K-Cl cotransporter 1e-14
pfam00324 473 pfam00324, AA_permease, Amino acid permease 1e-07
>gnl|CDD|233194 TIGR00930, 2a30, K-Cl cotransporter Back     alignment and domain information
 Score = 67.0 bits (164), Expect = 1e-14
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 5/94 (5%)

Query: 11  KYGLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFG 70
            YGL    + + L+S F PL  + + ++ L+ A +SL  APR+F+ L KD +YP++ +FG
Sbjct: 370 SYGLMNNLQVMSLVSPFPPLITAGIFSATLSSALASLVSAPRLFQALCKDNIYPFLQFFG 429

Query: 71  R--GKTSRPH---VLTTGIAAAFILMSAAKLTKP 99
           +  GK   P    +LT  IA  FIL++      P
Sbjct: 430 KGYGKNGEPLRAYLLTAFIAEGFILIAELNTIAP 463


[Transport and binding proteins, Other]. Length = 953

>gnl|CDD|215858 pfam00324, AA_permease, Amino acid permease Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 101
KOG2082|consensus 1075 99.9
KOG1288|consensus 945 99.86
TIGR00930 953 2a30 K-Cl cotransporter. 99.68
KOG2083|consensus 643 99.66
TIGR00908442 2A0305 ethanolamine permease. The three genes used 98.07
TIGR03810 468 arg_ornith_anti arginine/ornithine antiporter. Mem 98.07
TIGR00909429 2A0306 amino acid transporter. 98.06
TIGR00906 557 2A0303 cationic amino acid transport permease. 98.05
PRK11021410 putative transporter; Provisional 97.94
PRK10836 489 lysine transporter; Provisional 97.94
PRK11357445 frlA putative fructoselysine transporter; Provisio 97.93
TIGR00905 473 2A0302 transporter, basic amino acid/polyamine ant 97.93
TIGR03428475 ureacarb_perm permease, urea carboxylase system. A 97.91
TIGR00907482 2A0304 amino acid permease (GABA permease). 97.89
PF00324 478 AA_permease: Amino acid permease; InterPro: IPR004 97.87
TIGR00913 478 2A0310 amino acid permease (yeast). 97.83
PRK15049 499 L-asparagine permease; Provisional 97.83
TIGR00911 501 2A0308 L-type amino acid transporter. 97.82
TIGR01773452 GABAperm gamma-aminobutyrate permease. GabP is hig 97.81
PF13520426 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3G 97.78
PRK11387 471 S-methylmethionine transporter; Provisional 97.74
PRK10249458 phenylalanine transporter; Provisional 97.74
PRK10197 446 gamma-aminobutyrate transporter; Provisional 97.69
PRK10238456 aromatic amino acid transporter; Provisional 97.68
PRK10644445 arginine:agmatin antiporter; Provisional 97.64
PRK10655438 potE putrescine transporter; Provisional 97.6
PRK11049469 D-alanine/D-serine/glycine permease; Provisional 97.57
KOG1286|consensus 554 97.53
PRK10580457 proY putative proline-specific permease; Provision 97.51
PRK10435435 cadB lysine/cadaverine antiporter; Provisional 97.42
COG0531 466 PotE Amino acid transporters [Amino acid transport 97.41
TIGR03813 474 put_Glu_GABA_T putative glutamate/gamma-aminobutyr 97.35
TIGR00910 507 2A0307_GadC glutamate:gamma-aminobutyrate antiport 97.35
KOG1287|consensus 479 96.96
PRK10746 461 putative transport protein YifK; Provisional 96.89
COG0833 541 LysP Amino acid transporters [Amino acid transport 96.54
KOG1289|consensus 550 96.22
PRK15238 496 inner membrane transporter YjeM; Provisional 95.56
COG1113 462 AnsP Gamma-aminobutyrate permease and related perm 93.92
>KOG2082|consensus Back     alignment and domain information
Probab=99.90  E-value=2.3e-25  Score=191.21  Aligned_cols=89  Identities=22%  Similarity=0.325  Sum_probs=84.9

Q ss_pred             hhhhhhhhhhhcccchhHHHHHHHHhhHHHHHhhhhhhhHHHHHhhhCCCCccccccCcC-CC---chHHHHHHHHHHHH
Q psy5317          13 GLREYFESLELISAFSPLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFGRG-KT---SRPHVLTTGIAAAF   88 (101)
Q Consensus        13 ~L~~~~~v~~~~s~~~~li~~Gi~~stlssaL~~l~gApRvLqAia~D~l~P~l~~f~~g-~~---~~A~llt~~i~~~~   88 (101)
                      ++.++..|....|++||+|++|.|.||++++||||+||||+|||||||+++|+++.|+|+ +|   .||+++|.+||+++
T Consensus       481 sv~g~lVva~laWPsPwVi~IGsFlST~GAgLQsLtgAPRLLQAIAkD~IiPfL~~F~~~~~ngEPt~aLlLT~~Ice~g  560 (1075)
T KOG2082|consen  481 SVGGNLVVATLAWPSPWVIVIGSFLSTCGAGLQSLTGAPRLLQAIAKDDIIPFLAPFGHGKANGEPTWALLLTAIICECG  560 (1075)
T ss_pred             hccCcEEEEEecCCCceeeehhHHHHHhHHHHhhhcCcHHHHHHHhhcCccchhhhhccccCCCCccHHHHHHHHHHHhh
Confidence            467788899999999999999999999999999999999999999999999999999999 55   99999999999999


Q ss_pred             HHHhcccccccCC
Q psy5317          89 ILMSAAKLTKPSF  101 (101)
Q Consensus        89 ilig~Ln~IApi~  101 (101)
                      |++|++|.|||++
T Consensus       561 ILigslD~iApil  573 (1075)
T KOG2082|consen  561 ILIGSLDLIAPIL  573 (1075)
T ss_pred             heeechhHHHHHH
Confidence            9999999999974



>KOG1288|consensus Back     alignment and domain information
>TIGR00930 2a30 K-Cl cotransporter Back     alignment and domain information
>KOG2083|consensus Back     alignment and domain information
>TIGR00908 2A0305 ethanolamine permease Back     alignment and domain information
>TIGR03810 arg_ornith_anti arginine/ornithine antiporter Back     alignment and domain information
>TIGR00909 2A0306 amino acid transporter Back     alignment and domain information
>TIGR00906 2A0303 cationic amino acid transport permease Back     alignment and domain information
>PRK11021 putative transporter; Provisional Back     alignment and domain information
>PRK10836 lysine transporter; Provisional Back     alignment and domain information
>PRK11357 frlA putative fructoselysine transporter; Provisional Back     alignment and domain information
>TIGR00905 2A0302 transporter, basic amino acid/polyamine antiporter (APA) family Back     alignment and domain information
>TIGR03428 ureacarb_perm permease, urea carboxylase system Back     alignment and domain information
>TIGR00907 2A0304 amino acid permease (GABA permease) Back     alignment and domain information
>PF00324 AA_permease: Amino acid permease; InterPro: IPR004841 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>TIGR00913 2A0310 amino acid permease (yeast) Back     alignment and domain information
>PRK15049 L-asparagine permease; Provisional Back     alignment and domain information
>TIGR00911 2A0308 L-type amino acid transporter Back     alignment and domain information
>TIGR01773 GABAperm gamma-aminobutyrate permease Back     alignment and domain information
>PF13520 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3GI8_C 3GIA_A 3GI9_C 3OB6_A 3L1L_A 3LRC_D 3LRB_B 4DJK_A 4DJI_A Back     alignment and domain information
>PRK11387 S-methylmethionine transporter; Provisional Back     alignment and domain information
>PRK10249 phenylalanine transporter; Provisional Back     alignment and domain information
>PRK10197 gamma-aminobutyrate transporter; Provisional Back     alignment and domain information
>PRK10238 aromatic amino acid transporter; Provisional Back     alignment and domain information
>PRK10644 arginine:agmatin antiporter; Provisional Back     alignment and domain information
>PRK10655 potE putrescine transporter; Provisional Back     alignment and domain information
>PRK11049 D-alanine/D-serine/glycine permease; Provisional Back     alignment and domain information
>KOG1286|consensus Back     alignment and domain information
>PRK10580 proY putative proline-specific permease; Provisional Back     alignment and domain information
>PRK10435 cadB lysine/cadaverine antiporter; Provisional Back     alignment and domain information
>COG0531 PotE Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03813 put_Glu_GABA_T putative glutamate/gamma-aminobutyrate antiporter Back     alignment and domain information
>TIGR00910 2A0307_GadC glutamate:gamma-aminobutyrate antiporter Back     alignment and domain information
>KOG1287|consensus Back     alignment and domain information
>PRK10746 putative transport protein YifK; Provisional Back     alignment and domain information
>COG0833 LysP Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1289|consensus Back     alignment and domain information
>PRK15238 inner membrane transporter YjeM; Provisional Back     alignment and domain information
>COG1113 AnsP Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
3gia_A444 Uncharacterized protein MJ0609; membrane protein, 98.63
4djk_A 511 Probable glutamate/gamma-aminobutyrate antiporter; 98.23
3l1l_A445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 98.18
>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Back     alignment and structure
Probab=98.63  E-value=4e-08  Score=75.82  Aligned_cols=69  Identities=20%  Similarity=0.207  Sum_probs=61.3

Q ss_pred             hHHHHHHHHhhHHHHHhhhhhhhHHHHHhhhCCCCccccccCcC-CC--chHHHHHHHHHHHHHHHhccccccc
Q psy5317          29 PLFYSAVLTSGLTCAFSSLQEAPRVFRHLSKDGLYPYIGWFGRG-KT--SRPHVLTTGIAAAFILMSAAKLTKP   99 (101)
Q Consensus        29 ~li~~Gi~~stlssaL~~l~gApRvLqAia~D~l~P~l~~f~~g-~~--~~A~llt~~i~~~~ilig~Ln~IAp   99 (101)
                      .++.++.+.+.+++..+.+.+++|+++++|||+.+|  ++|+|. ++  .+|++++.+++.++.+++++|.+.+
T Consensus       274 ~~i~~~~~~~~~~~~~~~~~~~sR~l~a~a~dg~lP--~~f~~~~~~~P~~a~~~~~~~~~~~~~~~~~~~l~~  345 (444)
T 3gia_A          274 LLISIGALFSISSAMNATIYGGANVAYSLAKDGELP--EFFERKVWFKSTEGLYITSALGVLFALLFNMEGVAS  345 (444)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTTHHHHHHHHHHSSCC--SSCCTTSCCSCTHHHHHHHHHHHHHHHHSCHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--HHHhCCCCCCCcHHHHHHHHHHHHHHHHcCHHHHHH
Confidence            467789999999999999999999999999999999  678877 33  8999999999999988888887654



>4djk_A Probable glutamate/gamma-aminobutyrate antiporter; LEUT, glutamate-GABA antiporter, transport protein; 3.10A {Escherichia coli} PDB: 4dji_A Back     alignment and structure
>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00