Psyllid ID: psy5333


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------
MFNKCLLLLSLFSTCINSAHIGSHLNKEREEDGSFVSRDHNHYGQGGEHNTDFDHEAILDRYNNIPQEDGSFVSRDHNHYGQGGEHNTDFDHEAILGELIPATSKNQRPSPERIGSVKEAEEFEHLTTTLTGKSFKHGSYALFECYPWRNPIAGLKMQMKILTKKRLRLLLKNMDLNKDNNIDRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEHLKETYGTEDADDIDVTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQVLEEKDTDKDGFLSFQEFMGDRGQKHNRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVPSNEDIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDVFVGSEATDFGDHLTNPHLIKEEL
cHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccccHHHHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccHHHHHHHHHHHHcccccccccHHHHHHcHHHHHccccccccccccccccccccc
cccEEEEEEEHHHHHHHHHHHccccccccccccccccccHHHccccccccccccHHHHHcccHHHHHHccccccHHHHHHHHHHcccccccccHHHcccHHHcHHHHHHHHHHcccHHHHHHHcccccHHccccccccccccHHHHccccHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEcHHHHHHHHHccccccccccccHccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccHHHHHHHHHHHHHHHcccccccEcHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHcccEcccccccHHHHHHHcccccccc
MFNKCLLLLSLFSTCinsahigshlnkereedgsfvsrdhnhygqggehntdfdHEAILDrynnipqedgsfvsrdhnhygqggehntdfdheailgelipatsknqrpsperigsvkeaeeFEHLtttltgksfkhgsyalfecypwrnpiagLKMQMKILTKKRLRLLLKNmdlnkdnniDRKELQAWILRSFRMLSveesnsrfedadentdgvvdwdehlketygtedaddidvtnlgddMNLLLLFTQMVKQDKMIFnaadgdkngvldkteyqsfsapeehphmfPILIKQVLeekdtdkdgFLSFQEFmgdrgqkhnrQYIVEEkdkfdneydtnkdgllneneilswivpsnediaEEEVNHlfaasdddhddllsfdeivehhdvfvgseatdfgdhltnphlikeel
MFNKCLLLLSLFSTCINSAHIGSHLNKEREEDGSFVSRDHNHYGQGGEHNTDFDHEAILDRYNNIPQEDGSFVSRDHNHYGQGGEHNTDFDHEAILGELipatsknqrpsPERIGSVKEAEEFEHLTttltgksfkhgSYALFECYPWRNPIAGLKMQMKILTKKRLRLLLKnmdlnkdnnidrKELQAWILRSFRMLSVeesnsrfedadentdgvvdWDEHLKETygtedaddidvTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSfsapeehphMFPILIKQVLEEKDTDKDGFLSFQefmgdrgqkhnRQYIVEekdkfdneydTNKDGLLNENEILSWIVPSNEDIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDVFVGSeatdfgdhltnphlikeel
MFNKCLLLLSLFSTCINSAHIGSHLNKEREEDGSFVSRDHNHYGQGGEHNTDFDHEAILDRYNNIPQEDGSFVSRDHNHYGQGGEHNTDFDHEAILGELIPATSKNQRPSPERIGSVKEAEEFEHLTTTLTGKSFKHGSYALFECYPWRNPIAGLKMQmkiltkkrlrlllknmdlnkdnniDRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEHLKETYGTEDADDIDVTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQVLEEKDTDKDGFLSFQEFMGDRGQKHNRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVPSNEDIAEEEVNhlfaasdddhddllsfdEIVEHHDVFVGSEATDFGDHLTNPHLIKEEL
**NKCLLLLSLFSTCINSAHIG**********************************AILDRY********************************IL****************************HLTTTLTGKSFKHGSYALFECYPWRNPIAGLKMQMKILTKKRLRLLLKNMDLNKDNNIDRKELQAWILRSFRMLSV***************GVVDWDEHLKETYGTEDADDIDVTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVL***************HMFPILIKQVLEE*****DGFLSFQEFM*********QYIVE****F**EYDTNKDGLLNENEILSWIVPSNEDIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDVFVGSEATDFGDH***********
**NKCLLLLSLFSTCI******************************GEHNTDFDHEAIL*********************GQGGEHNTDFDHEAILGELIP****************************************LFECYPWR******************RLLLKNMDLNKDNNIDRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEHLKETYGTEDADDIDVTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQVLEEKDTDKDGFLSFQEFMGD***************KFDNEYDTNKDGLLNENEILSWIVPSNEDIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDVFVGSEATDFGDHLTNP****EE*
MFNKCLLLLSLFSTCINSAHIGSHLNKEREEDGSFVSRDHNHYGQGGEHNTDFDHEAILDRYNNIPQEDGSFVSRDHNHYGQGGEHNTDFDHEAILGELIPAT***********GSVKEAEEFEHLTTTLTGKSFKHGSYALFECYPWRNPIAGLKMQMKILTKKRLRLLLKNMDLNKDNNIDRKELQAWILRSFRMLSVE************TDGVVDWDEHLKETYGTEDADDIDVTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQVLEEKDTDKDGFLSFQEFMGDRGQKHNRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVPSNEDIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDVFVGSEATDFGDHLTNPHLIKEEL
MFNKCLLLLSLFSTCINSAHI************SFVSRDHNHYGQGGEHNTDFDHEAILDRYNNIPQEDGSFVSRDHNHYGQGGEHNTDFDHEAILGELIPATSKNQRPSPERIGSVKEAEEFEHLTTTLTGKSFKHGSYALFECYPWRNPIAGLKMQMKILTKKRLRLLLKNMDLNKDNNIDRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEHLKETYGTEDAD**D*TN*GDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQVLEEKDTDKDGFLSFQEFMGDRGQKHNRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVPSNEDIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDVFVGSEATDFGDHLTNPHLI****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNKCLLLLSLFSTCINSAHIGSHLNKEREEDGSFVSRDHNHYGQGGEHNTDFDHEAILDRYNNIPQEDGSFVSRDHNHYGQGGEHNTDFDHEAILGELIPATSKNQRPSPERIGSVKEAEEFEHLTTTLTGKSFKHGSYALFECYPWRNPIAGLKMQMKILTKKRLRLLLKNMDLNKDNNIDRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEHLKETYGTEDADDIDVTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQVLEEKDTDKDGFLSFQEFMGDRGQKHNRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVPSNEDIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDVFVGSEATDFGDHLTNPHLIKEEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query417 2.2.26 [Sep-21-2011]
Q62703320 Reticulocalbin-2 OS=Rattu yes N/A 0.601 0.784 0.368 5e-37
Q8BP92320 Reticulocalbin-2 OS=Mus m yes N/A 0.601 0.784 0.368 7e-37
Q14257317 Reticulocalbin-2 OS=Homo yes N/A 0.601 0.791 0.364 1e-35
B5X4E0316 Calumenin-B OS=Salmo sala N/A N/A 0.573 0.756 0.346 2e-34
B5X186315 Calumenin-A OS=Salmo sala N/A N/A 0.570 0.755 0.332 6e-34
Q3T0K1315 Calumenin OS=Bos taurus G no N/A 0.570 0.755 0.332 2e-33
Q6IQP3315 Calumenin-A OS=Danio reri no N/A 0.570 0.755 0.328 3e-33
Q28BT4315 Calumenin OS=Xenopus trop no N/A 0.570 0.755 0.34 2e-32
Q6XLQ7315 Calumenin OS=Oryctolagus no N/A 0.573 0.758 0.330 2e-31
Q6IP82315 Calumenin OS=Xenopus laev N/A N/A 0.570 0.755 0.336 2e-31
>sp|Q62703|RCN2_RAT Reticulocalbin-2 OS=Rattus norvegicus GN=Rcn2 PE=1 SV=2 Back     alignment and function desciption
 Score =  155 bits (393), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 152/258 (58%), Gaps = 7/258 (2%)

Query: 164 KKRLRLLLKNMDLNKDNNIDRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEH 223
           ++RL+ ++K +D + D  +   EL  WI  SF+  +++E+  +F + D+N+DG V WDE+
Sbjct: 66  QRRLQSIIKKIDSDSDGFLTENELSQWIQMSFKHYAMQEAKQQFVEYDKNSDGTVTWDEY 125

Query: 224 LKETYGTEDADDIDVTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSA 283
             + Y      D D     DD      F Q+  +DK  F  A+ D    L+  E+ +F  
Sbjct: 126 NVQMYDR--VIDFDENTALDDTEEES-FRQLHLKDKKRFEKANQDSGPGLNLEEFIAFEH 182

Query: 284 PEEHPHMFPILIKQVLEEKDTDKDGFLSFQEFMGDRGQ----KHNRQYIVEEKDKFDNEY 339
           PEE  +M   +I++ LEE D + DGF+S +EF+GD  +      + ++I+ EKD+F N+Y
Sbjct: 183 PEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRRDPTANEDPEWILVEKDRFVNDY 242

Query: 340 DTNKDGLLNENEILSWIVPSNEDIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDVFVGSE 399
           D + DG L+  E+LSW+VP+N+ IA+EE  HL    D + D  LS +EI+E+ D+F+ SE
Sbjct: 243 DKDSDGRLDPQELLSWVVPNNQGIAQEEALHLIDEMDLNSDKKLSEEEILENQDLFLTSE 302

Query: 400 ATDFGDHLTNPHLIKEEL 417
           ATD+G  L + +   +EL
Sbjct: 303 ATDYGRQLHDDYFYHDEL 320




Not known. Binds calcium.
Rattus norvegicus (taxid: 10116)
>sp|Q8BP92|RCN2_MOUSE Reticulocalbin-2 OS=Mus musculus GN=Rcn2 PE=2 SV=1 Back     alignment and function description
>sp|Q14257|RCN2_HUMAN Reticulocalbin-2 OS=Homo sapiens GN=RCN2 PE=1 SV=1 Back     alignment and function description
>sp|B5X4E0|CALUB_SALSA Calumenin-B OS=Salmo salar GN=calub PE=2 SV=1 Back     alignment and function description
>sp|B5X186|CALUA_SALSA Calumenin-A OS=Salmo salar GN=calua PE=2 SV=1 Back     alignment and function description
>sp|Q3T0K1|CALU_BOVIN Calumenin OS=Bos taurus GN=CALU PE=2 SV=1 Back     alignment and function description
>sp|Q6IQP3|CALUA_DANRE Calumenin-A OS=Danio rerio GN=calua PE=2 SV=1 Back     alignment and function description
>sp|Q28BT4|CALU_XENTR Calumenin OS=Xenopus tropicalis GN=calu PE=2 SV=1 Back     alignment and function description
>sp|Q6XLQ7|CALU_RABIT Calumenin OS=Oryctolagus cuniculus GN=CALU PE=1 SV=2 Back     alignment and function description
>sp|Q6IP82|CALU_XENLA Calumenin OS=Xenopus laevis GN=calu PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
91082161328 PREDICTED: similar to AGAP010191-PA [Tri 0.709 0.902 0.488 2e-84
383848197341 PREDICTED: reticulocalbin-2-like [Megach 0.685 0.838 0.494 4e-82
66517554331 PREDICTED: reticulocalbin-2-like [Apis m 0.697 0.879 0.487 5e-81
380029672331 PREDICTED: reticulocalbin-2-like [Apis f 0.697 0.879 0.487 5e-81
350400962331 PREDICTED: reticulocalbin-2-like [Bombus 0.697 0.879 0.481 2e-80
340719721330 PREDICTED: LOW QUALITY PROTEIN: reticulo 0.697 0.881 0.476 1e-79
307202124329 Reticulocalbin-2 [Harpegnathos saltator] 0.697 0.884 0.481 2e-79
242011204328 restculocalbin-2 precursor, putative [Pe 0.705 0.896 0.462 1e-78
322786075330 hypothetical protein SINV_10013 [Solenop 0.685 0.866 0.474 2e-78
332017914330 Reticulocalbin-2 [Acromyrmex echinatior] 0.697 0.881 0.470 9e-78
>gi|91082161|ref|XP_970591.1| PREDICTED: similar to AGAP010191-PA [Tribolium castaneum] gi|270007433|gb|EFA03881.1| hypothetical protein TcasGA2_TC014005 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  319 bits (817), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 175/358 (48%), Positives = 233/358 (65%), Gaps = 62/358 (17%)

Query: 63  NNIPQE---DGSFVSRDHNHYGQGGEHNTDFDHEAILGELIPATSKNQRPSPERIGSVKE 119
           N+I +E   DG++  RDH+H+   GEH+ +FDHEAI                  IGS KE
Sbjct: 30  NDIHKERETDGAYSPRDHSHFTDSGEHHNEFDHEAI------------------IGSHKE 71

Query: 120 AEEFEHLTTTLTGKSFKHGSYALFECYPWRNPIAGLKMQMKILTKKRLRLLLKNMDLNKD 179
           AEE++HL                                     K+RLR+LLK MDLN D
Sbjct: 72  AEEYDHLPPD--------------------------------EAKRRLRILLKKMDLNGD 99

Query: 180 NNIDRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEHLKETYGTEDADDIDVT 239
             ID+KEL+AWILRSF+MLS EE+N R EDADE+ +G+V W E+L + YG +  D++ V 
Sbjct: 100 EQIDKKELKAWILRSFKMLSEEEANERLEDADEDNNGIVTWQEYLSDAYGVDKEDNLSV- 158

Query: 240 NLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQVL 299
             GD+        Q++K DK ++ AAD + +GVLD  E+ +FS PEEHP M PI+++Q L
Sbjct: 159 --GDENE------QLIKDDKEMWAAADTNNDGVLDSKEWIAFSHPEEHPSMLPIILEQTL 210

Query: 300 EEKDTDKDGFLSFQEFMGDRGQKHNRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVPS 359
            +KD D D  +SFQEF+GDR  +H+++++  EKDKFD++ D + DG L  NEILSWIVPS
Sbjct: 211 RDKDKDGDKSISFQEFVGDRAHEHDKEWLQVEKDKFDHDLDKDGDGKLTSNEILSWIVPS 270

Query: 360 NEDIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDVFVGSEATDFGDHLTNPHLIKEEL 417
           NE+IAEEEV+HLFA+SDDDH+D+LSFDE+VEHH+ FVGSEATD+GDHL N H  ++EL
Sbjct: 271 NEEIAEEEVDHLFASSDDDHNDVLSFDEVVEHHETFVGSEATDYGDHLHNIHHFEDEL 328




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383848197|ref|XP_003699738.1| PREDICTED: reticulocalbin-2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|66517554|ref|XP_393699.2| PREDICTED: reticulocalbin-2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380029672|ref|XP_003698491.1| PREDICTED: reticulocalbin-2-like [Apis florea] Back     alignment and taxonomy information
>gi|350400962|ref|XP_003486013.1| PREDICTED: reticulocalbin-2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340719721|ref|XP_003398296.1| PREDICTED: LOW QUALITY PROTEIN: reticulocalbin-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307202124|gb|EFN81624.1| Reticulocalbin-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242011204|ref|XP_002426345.1| restculocalbin-2 precursor, putative [Pediculus humanus corporis] gi|212510422|gb|EEB13607.1| restculocalbin-2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322786075|gb|EFZ12686.1| hypothetical protein SINV_10013 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332017914|gb|EGI58568.1| Reticulocalbin-2 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
FB|FBgn0031673342 CG31650 [Drosophila melanogast 0.546 0.666 0.451 1.7e-69
UNIPROTKB|F1SJ93317 RCN2 "Uncharacterized protein" 0.549 0.722 0.355 1.1e-40
UNIPROTKB|Q0VCQ9317 RCN2 "Reticulocalbin 2, EF-han 0.549 0.722 0.360 1.7e-40
MGI|MGI:1349765320 Rcn2 "reticulocalbin 2" [Mus m 0.549 0.715 0.364 4.6e-40
RGD|3548320 Rcn2 "reticulocalbin 2, EF-han 0.549 0.715 0.364 5.8e-40
UNIPROTKB|Q62703320 Rcn2 "Reticulocalbin-2" [Rattu 0.549 0.715 0.364 5.8e-40
UNIPROTKB|F1N9R2346 RCN2 "Uncharacterized protein" 0.553 0.667 0.357 7.4e-40
UNIPROTKB|Q14257317 RCN2 "Reticulocalbin-2" [Homo 0.549 0.722 0.347 1.7e-36
UNIPROTKB|F1PEG9470 RCN2 "Uncharacterized protein" 0.549 0.487 0.364 2.4e-35
ZFIN|ZDB-GENE-040625-166315 calua "calumenin a" [Danio rer 0.513 0.679 0.314 8.1e-35
FB|FBgn0031673 CG31650 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 561 (202.5 bits), Expect = 1.7e-69, Sum P(3) = 1.7e-69
 Identities = 108/239 (45%), Positives = 157/239 (65%)

Query:   183 DRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEHLKETYGTEDAD----DIDV 238
             DR EL+AWILRSF+ LS EE+  RFE+ D++ D  + W E+L++TY  ED D     ID 
Sbjct:   111 DRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDY 170

Query:   239 TNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQV 298
              +  D+        +M+KQDK +FNAAD +K+GVL   E+  F  PEEHP M PIL++  
Sbjct:   171 DSYEDEQ-------KMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHT 223

Query:   299 LEEKDTDKDGFLSFQEFMGDRGQKHNRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVP 358
             +++KD D DG ++FQEF+GD    H++++++ EK++FD ++D+N DG+L  +E+LSWIVP
Sbjct:   224 MQDKDADHDGKINFQEFVGDAASHHDKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVP 283

Query:   359 SNEDIAEEEVNXXXXXXXXXXXXXXXXXEIVEHHDVFVGSEATDFGDHLTNPHLIKEEL 417
             SN  IA +EV+                 EI+ ++D FVGSEATD+GDHL N + + +EL
Sbjct:   284 SNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQNINHLSDEL 342


GO:0005788 "endoplasmic reticulum lumen" evidence=ISS
GO:0005509 "calcium ion binding" evidence=ISS
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0007030 "Golgi organization" evidence=IMP
UNIPROTKB|F1SJ93 RCN2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VCQ9 RCN2 "Reticulocalbin 2, EF-hand calcium binding domain" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1349765 Rcn2 "reticulocalbin 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3548 Rcn2 "reticulocalbin 2, EF-hand calcium binding domain" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q62703 Rcn2 "Reticulocalbin-2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9R2 RCN2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q14257 RCN2 "Reticulocalbin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PEG9 RCN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-166 calua "calumenin a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BP92RCN2_MOUSENo assigned EC number0.36820.60190.7843yesN/A
Q62703RCN2_RATNo assigned EC number0.36820.60190.7843yesN/A
Q14257RCN2_HUMANNo assigned EC number0.36430.60190.7917yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 8e-05
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 5e-04
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 0.002
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 0.003
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 0.004
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
 Score = 40.2 bits (95), Expect = 8e-05
 Identities = 15/62 (24%), Positives = 25/62 (40%), Gaps = 1/62 (1%)

Query: 295 IKQVLEEKDTDKDGFLSFQEFMGDRGQKHNRQYIVEEKDKFDNEYDTNKDGLLNENEILS 354
           +++     D D DG +S  E      +        EE D+   E D + DG ++  E L 
Sbjct: 2   LREAFRLFDKDGDGTISADELK-AALKSLGEGLSEEEIDEMIREVDKDGDGKIDFEEFLE 60

Query: 355 WI 356
            +
Sbjct: 61  LM 62


Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers. Length = 63

>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 417
KOG4223|consensus325 100.0
KOG4251|consensus362 99.93
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.87
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.87
KOG0027|consensus151 99.85
KOG0027|consensus151 99.84
KOG4223|consensus325 99.77
PTZ00184149 calmodulin; Provisional 99.77
PTZ00183158 centrin; Provisional 99.76
PTZ00183158 centrin; Provisional 99.75
PTZ00184149 calmodulin; Provisional 99.74
KOG0028|consensus172 99.72
KOG0028|consensus172 99.72
KOG0031|consensus171 99.71
KOG0037|consensus221 99.7
KOG0031|consensus171 99.6
KOG0036|consensus 463 99.58
KOG0030|consensus152 99.57
KOG0034|consensus187 99.56
KOG0044|consensus193 99.56
KOG0034|consensus187 99.55
KOG0037|consensus221 99.54
KOG2643|consensus489 99.53
KOG0030|consensus152 99.48
KOG0044|consensus193 99.44
KOG0036|consensus 463 99.44
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.15
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.15
KOG0377|consensus631 99.14
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.08
KOG4251|consensus362 99.07
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.06
KOG2562|consensus493 99.03
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.97
PLN02964 644 phosphatidylserine decarboxylase 98.96
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.95
PLN02964 644 phosphatidylserine decarboxylase 98.92
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.85
KOG0377|consensus631 98.85
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.84
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.8
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.8
KOG2643|consensus489 98.79
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.79
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.79
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.77
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.75
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.75
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.75
cd0005267 EH Eps15 homology domain; found in proteins implic 98.75
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.73
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.72
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.72
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.7
cd0005267 EH Eps15 homology domain; found in proteins implic 98.69
KOG0751|consensus 694 98.69
KOG0038|consensus189 98.69
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.63
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.63
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.61
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.6
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.6
KOG2562|consensus493 98.58
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.57
KOG0038|consensus189 98.45
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.4
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.34
KOG0041|consensus244 98.29
KOG0751|consensus 694 98.25
KOG0041|consensus244 98.23
PF1465866 EF-hand_9: EF-hand domain 98.23
KOG0040|consensus2399 98.22
PF1465866 EF-hand_9: EF-hand domain 98.15
KOG0040|consensus2399 98.07
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.98
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.97
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.93
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.9
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.89
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.81
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.78
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.64
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.63
KOG4666|consensus412 97.61
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.61
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.55
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 97.44
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.37
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 97.35
KOG0046|consensus 627 97.3
KOG1029|consensus 1118 97.27
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.25
KOG4666|consensus412 97.24
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.06
KOG0169|consensus 746 96.93
KOG0998|consensus 847 96.74
KOG1029|consensus 1118 96.6
KOG4065|consensus144 96.44
KOG4065|consensus144 96.36
KOG0046|consensus 627 96.32
KOG0169|consensus 746 96.3
KOG1707|consensus 625 95.96
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.6
KOG1707|consensus 625 95.49
KOG1955|consensus 737 95.47
KOG1955|consensus 737 95.0
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 94.88
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 94.42
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 94.39
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 94.23
KOG3866|consensus442 92.78
KOG0035|consensus890 91.73
KOG3555|consensus 434 90.68
KOG4578|consensus421 90.55
KOG3866|consensus442 90.52
KOG0042|consensus680 90.23
KOG3555|consensus434 90.0
KOG0035|consensus890 89.74
KOG4578|consensus421 89.56
KOG4347|consensus671 86.55
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 86.54
KOG0042|consensus680 85.62
KOG2243|consensus 5019 84.69
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 83.14
PF08976118 DUF1880: Domain of unknown function (DUF1880); Int 82.08
PF08976118 DUF1880: Domain of unknown function (DUF1880); Int 82.04
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 82.01
PF0731284 DUF1459: Protein of unknown function (DUF1459); In 81.89
>KOG4223|consensus Back     alignment and domain information
Probab=100.00  E-value=9.9e-46  Score=339.99  Aligned_cols=278  Identities=41%  Similarity=0.700  Sum_probs=252.8

Q ss_pred             CCCCCCCccchhhhcccccccccCCCCCCCCCCCCHHHHHHhhcCCCcccCccccCCcccccccCCCCCchhhhhhhhhH
Q psy5333          82 QGGEHNTDFDHEAILGELIPATSKNQRPSPERIGSVKEAEEFEHLTTTLTGKSFKHGSYALFECYPWRNPIAGLKMQMKI  161 (417)
Q Consensus        82 ~~~~~~~~~d~~~~l~~~~~~~~~~~~~s~~r~g~~e~~~~f~~l~~e~~g~~~kdg~~~~~e~~~~~~~~~~~~~~~~~  161 (417)
                      ..++|+.+|||++++                  |..+.++.|++|+|+                                
T Consensus        44 ~~~~~~~~~dhe~~~------------------~d~e~~~~fd~l~~e--------------------------------   73 (325)
T KOG4223|consen   44 KDGEHNFQYDHEAFL------------------GDDEFADEFDQLTPE--------------------------------   73 (325)
T ss_pred             cccCCCcCccccccc------------------cchhhhhhhhhhCcc--------------------------------
Confidence            345688889998889                  667889999999999                                


Q ss_pred             HHHHHHHHHHHhhcCCCCCcccHHHHHHHHHHHcCCCCHHHHHHHHHHhCCCCCCceehHhHHHHhcCCCCCCccccccc
Q psy5333         162 LTKKRLRLLLKNMDLNKDNNIDRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEHLKETYGTEDADDIDVTNL  241 (417)
Q Consensus       162 e~~~~L~~~F~~~D~d~dG~Is~~El~~~l~~~~~~~~~~ei~~lf~~~D~d~dG~Is~~EF~~~~~~~~~~~~~~~~~~  241 (417)
                      +...+|..++.++|.++||+|+..|++.|+.....+....++.+.|..+|.|.||.|+|+||+..++.... .+.+..+.
T Consensus        74 e~~~rl~~l~~~iD~~~Dgfv~~~El~~wi~~s~k~~v~~~~~~~~~~~d~~~Dg~i~~eey~~~~~~~~~-~~~~~~d~  152 (325)
T KOG4223|consen   74 ESQERLGKLVPKIDSDSDGFVTESELKAWIMQSQKKYVVEEAARRWDEYDKNKDGFITWEEYLPQTYGRVD-LPDEFPDE  152 (325)
T ss_pred             hhHHHHHHHHhhhcCCCCCceeHHHHHHHHHHHHHHHHHHHHHHHHHHhccCccceeeHHHhhhhhhhccc-Cccccccc
Confidence            88999999999999999999999999999999888888899999999999999999999999999997643 11111211


Q ss_pred             cchhhHHHHHHHHHHHHHHHHHHhCCCCCCceeHHHHHHhhccCCCCCCcHHHHHHHHHHhCCCCCCceeHHHHHHHhcc
Q psy5333         242 GDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQVLEEKDTDKDGFLSFQEFMGDRGQ  321 (417)
Q Consensus       242 ~~~~~~~~~~~~~~~~l~~~F~~~D~d~dG~Is~~Ef~~~l~~~~~~~~~~~~i~~l~~~~D~d~dg~Is~~EFl~~~~~  321 (417)
                      +.    -+.+++++.+.++.|+..|.|++|.+|++||..+|+|...+.|....+.+.+..+|+|+||+|+++||+..+..
T Consensus       153 e~----~~~~~km~~rDe~rFk~AD~d~dg~lt~EEF~aFLHPEe~p~M~~iVi~Etl~d~Dkn~DG~I~~eEfigd~~~  228 (325)
T KOG4223|consen  153 ED----NEEYKKMIARDEERFKAADQDGDGSLTLEEFTAFLHPEEHPHMKDIVIAETLEDIDKNGDGKISLEEFIGDLYS  228 (325)
T ss_pred             hh----cHHHHHHHHHHHHHHhhcccCCCCcccHHHHHhccChhhcchHHHHHHHHHHhhcccCCCCceeHHHHHhHHhh
Confidence            11    14588999999999999999999999999999999999999999999999999999999999999999999765


Q ss_pred             cc----CcccHHHHHHHHhhhhcCCCCCcccHHHHHHHHhhcCCCCcHHHHHHHHHhccCCCCCcccHHHHHHHHHHhhc
Q psy5333         322 KH----NRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVPSNEDIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDVFVG  397 (417)
Q Consensus       322 ~~----~~~~~~~~~~~F~~~~D~d~dG~Is~~El~~~l~~~~~~~~~~e~~~l~~~~D~d~DG~Is~~EF~~~~~~f~~  397 (417)
                      ..    .|.|....+..|.+.+|+|+||+|+.+|+++|+.|.+...++.++.+|+..+|.|+||+||++|++.++++|++
T Consensus       229 ~~~~~~epeWv~~Ere~F~~~~DknkDG~L~~dEl~~WI~P~~~d~A~~EA~hL~~eaD~dkD~kLs~eEIl~~~d~Fvg  308 (325)
T KOG4223|consen  229 HEGNEEEPEWVLTEREQFFEFRDKNKDGKLDGDELLDWILPSEQDHAKAEARHLLHEADEDKDGKLSKEEILEHYDVFVG  308 (325)
T ss_pred             ccCCCCCcccccccHHHHHHHhhcCCCCccCHHHHhcccCCCCccHHHHHHHHHhhhhccCccccccHHHHhhCcceeee
Confidence            54    58999999999998999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcCCCccccCCCCCCCCCCC
Q psy5333         398 SEATDFGDHLTNPHLIKEEL  417 (417)
Q Consensus       398 s~~td~g~~l~~~~~~~~e~  417 (417)
                      |+||+||++|++.   ||||
T Consensus       309 SqAtdyge~L~~~---HDEl  325 (325)
T KOG4223|consen  309 SQATDYGEDLDYF---HDEL  325 (325)
T ss_pred             eecccchhhcccc---cCCC
Confidence            9999999999974   9997



>KOG4251|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>KOG0998|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG3866|consensus Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>KOG3866|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>KOG4347|consensus Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] Back     alignment and domain information
>PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>PF07312 DUF1459: Protein of unknown function (DUF1459); InterPro: IPR009924 This family consists of several hypothetical Caenorhabditis elegans proteins of around 85 residues in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-14
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-09
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-14
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 1e-04
2hps_A186 Coelenterazine-binding protein with bound coelent; 7e-14
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-08
2hps_A186 Coelenterazine-binding protein with bound coelent; 5e-04
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-12
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 7e-05
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 8e-05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-10
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-08
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-10
3akb_A166 Putative calcium binding protein; EF-hand, metal b 3e-07
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-10
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 8e-08
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 6e-04
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 3e-10
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 8e-08
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 5e-10
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-07
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 5e-04
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 8e-04
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 6e-10
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 7e-10
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 6e-08
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-09
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-07
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-09
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-07
3lij_A494 Calcium/calmodulin dependent protein kinase with A 3e-04
1y1x_A191 Leishmania major homolog of programmed cell death 6e-09
1y1x_A191 Leishmania major homolog of programmed cell death 3e-04
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 7e-09
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 7e-05
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 3e-04
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 1e-08
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 6e-05
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 5e-08
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 3e-07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 4e-07
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 8e-08
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 2e-05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 1e-07
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 1e-07
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 1e-04
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-07
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 3e-06
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-05
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 3e-07
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 4e-04
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 6e-07
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 2e-04
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 6e-07
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 1e-04
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 6e-07
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-06
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 8e-07
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 7e-04
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 1e-06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-04
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-06
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-05
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 1e-06
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 5e-05
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 7e-04
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 2e-06
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 2e-05
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 2e-06
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 3e-06
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 3e-04
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 4e-06
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 1e-05
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 4e-06
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 7e-06
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 1e-05
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 1e-05
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 7e-05
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 1e-05
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 3e-04
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-05
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 5e-05
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 2e-05
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-04
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 3e-05
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 3e-05
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 3e-05
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 1e-04
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 4e-05
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 1e-04
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 5e-05
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 7e-05
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 8e-05
3li6_A66 Calcium-binding protein; calcium signaling protein 8e-05
3li6_A66 Calcium-binding protein; calcium signaling protein 2e-04
3li6_A66 Calcium-binding protein; calcium signaling protein 3e-04
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 1e-04
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 1e-04
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 1e-04
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 2e-04
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-04
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 4e-04
1c07_A95 Protein (epidermal growth factor receptor pathway 6e-04
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
 Score = 73.7 bits (181), Expect = 1e-14
 Identities = 33/227 (14%), Positives = 73/227 (32%), Gaps = 39/227 (17%)

Query: 164 KKRLRLLLKNMDLNKDNNIDRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEH 223
              LR L  +  ++       ++L+  + +    +        F   + +T G + +   
Sbjct: 121 TNILRQLFLSSAVSGSGKFSFQDLKQVLAKYADTIPEGPLKKLFVMVENDTKGRMSYITL 180

Query: 224 LKETYGTEDADDIDVTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSA 283
           +                  +D+  L             F   D + NG L + E++    
Sbjct: 181 VAVA---------------NDLAAL----------VADFRKIDTNSNGTLSRKEFR--EH 213

Query: 284 PEEHPHMFPILIKQVLEEKDTDKDGFLSFQEF--MGDRGQKHNRQYIVEEKDKFDNEYDT 341
                     +   +    D D+   + F E+  +G              +  +    D 
Sbjct: 214 FVRLGFDKKSVQDALFRYADEDESDDVGFSEYVHLGLCLLV--------LRILY-AFADF 264

Query: 342 NKDGLLNENEILSWIVPSN-EDIAEEEVNHLFAASDDDHDDLLSFDE 387
           +K G L++ E+   +  ++  + A ++  H F+  D D    LS+ E
Sbjct: 265 DKSGQLSKEEVQKVLEDAHIPESARKKFEHQFSVVDVDDSKSLSYQE 311


>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.96
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.96
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.95
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.91
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.91
1y1x_A191 Leishmania major homolog of programmed cell death 99.91
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.9
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.9
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.89
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.89
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.88
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.88
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.88
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.88
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.88
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.87
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.87
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.87
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.87
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.86
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.86
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.86
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.86
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.86
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.86
3fwb_A161 Cell division control protein 31; gene gating, com 99.86
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.85
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.85
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.85
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.85
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.85
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.85
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.85
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.85
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.84
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.84
3fwb_A161 Cell division control protein 31; gene gating, com 99.84
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.84
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.84
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.84
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.84
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.84
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.84
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.84
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.83
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.83
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.83
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.83
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.83
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.82
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.82
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.82
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.82
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.82
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.82
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.82
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.82
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.82
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.82
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.82
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.82
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.82
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.82
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.82
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.81
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.81
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.81
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.81
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.81
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.81
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.81
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.81
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.81
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.81
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.81
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.81
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.81
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.81
1y1x_A191 Leishmania major homolog of programmed cell death 99.81
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.81
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.8
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.8
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.8
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.8
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.8
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.8
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.8
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.8
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.8
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.8
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.8
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.8
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.79
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.79
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.79
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.79
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.79
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.79
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.79
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.79
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.79
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.79
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.79
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.79
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.79
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.79
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.79
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.78
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.78
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.78
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.78
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.78
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.77
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.77
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.77
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.77
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.77
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.77
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.77
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.77
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.76
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.76
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.75
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.75
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.75
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.75
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.75
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.75
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.75
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.75
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.74
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.74
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.74
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.74
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.74
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.74
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.74
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.74
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.74
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.74
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.74
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.73
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.73
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.73
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.73
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.73
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.73
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.73
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.73
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.73
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.73
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.73
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.72
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.72
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.72
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.72
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.72
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.71
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.71
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.71
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.71
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.71
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.7
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.7
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.69
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.69
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.69
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.68
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.68
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.65
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.65
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.6
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.59
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.59
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.59
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.58
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.58
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.56
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.55
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.55
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.53
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.53
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.53
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.52
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.51
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.5
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.5
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.49
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.49
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.49
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.47
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.45
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.44
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.39
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.37
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.36
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.32
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.31
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.3
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.3
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.29
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.28
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.25
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.23
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.23
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.22
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.21
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.21
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.2
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.2
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.2
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.16
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.15
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.15
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.15
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.14
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.14
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.14
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.14
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.14
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.13
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.13
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.13
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.12
1c07_A95 Protein (epidermal growth factor receptor pathway 99.11
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.11
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.11
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.1
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.1
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.1
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.1
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.09
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.09
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 99.09
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.09
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.08
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.08
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.08
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.08
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.07
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.07
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.06
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.06
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.06
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.06
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.06
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.06
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.05
3li6_A66 Calcium-binding protein; calcium signaling protein 99.05
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.05
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.05
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.05
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.04
3li6_A66 Calcium-binding protein; calcium signaling protein 99.04
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.03
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.03
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.03
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.03
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.02
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.02
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.02
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.01
1c07_A95 Protein (epidermal growth factor receptor pathway 99.01
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.01
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.01
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.0
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.0
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.0
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.99
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.99
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.99
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.99
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.99
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.98
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.98
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.98
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.98
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.97
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.95
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.95
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.95
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.95
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.94
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.93
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.93
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.91
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.91
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.91
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.91
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.9
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.9
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.89
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.88
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.88
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.88
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.88
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.88
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.87
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.86
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.84
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.8
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.8
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.79
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.79
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.78
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.75
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.75
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.71
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.62
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.54
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.3
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.15
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.72
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.5
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.7
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.66
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 96.1
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 95.01
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 90.36
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 89.26
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 88.81
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 88.01
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 87.99
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 87.49
3bq3_A270 Defective in cullin neddylation protein 1; ubiquit 85.33
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 85.26
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 85.01
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 84.37
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 83.03
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 82.92
2vn6_B64 Endoglucanase A; cell adhesion, carbohydrate metab 82.88
2jrf_A184 Tubulin polymerization-promoting protein family me 82.56
2k60_A150 Protein (stromal interaction molecule 1); EF-hand, 82.18
2ccl_B63 Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d 81.92
2y3n_B71 Cellulosomal family-48 processive glycoside hydro; 81.66
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 81.22
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
Probab=99.96  E-value=1.9e-29  Score=235.95  Aligned_cols=220  Identities=15%  Similarity=0.135  Sum_probs=181.1

Q ss_pred             HHHHHHHHHHHhhcCCCCCcccHHHHHHHHHHHcCCCCH------HHHHHHHHHhCCCCCCceehHhHHHHhcCCCCCCc
Q psy5333         162 LTKKRLRLLLKNMDLNKDNNIDRKELQAWILRSFRMLSV------EESNSRFEDADENTDGVVDWDEHLKETYGTEDADD  235 (417)
Q Consensus       162 e~~~~L~~~F~~~D~d~dG~Is~~El~~~l~~~~~~~~~------~ei~~lf~~~D~d~dG~Is~~EF~~~~~~~~~~~~  235 (417)
                      ....+++.+|..+|+|++|.|+..||..+++.++..++.      ..+..+|..+|.|++|.|+|+||+..+........
T Consensus        13 ~~~~~l~~~F~~~D~d~~G~i~~~El~~~l~~l~~~~~~~~~~~~~~~~~l~~~~D~~~~g~i~~~Ef~~~~~~~~~~~~   92 (263)
T 2f33_A           13 ITASQFFEIWLHFDADGSGYLEGKELQNLIQELLQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLL   92 (263)
T ss_dssp             CCHHHHHHHHHHHCTTCSSSBCSHHHHHHHHHHHHHHHHHTCCCCHHHHHHHHHHTTGGGCCBCHHHHHHHTTSCTTHHH
T ss_pred             ccHHHHHHHHHHhCCCCCCCcCHHHHHHHHHHHHhhcCCCccchHHHHHHHHHHhCCCCCCcCcHHHHHHHHhhhhhHHH
Confidence            467889999999999999999999999999988755444      78899999999999999999999998764311000


Q ss_pred             cccccccchhhHHHHHHHHHHHHHHHHHHhCCCCCCceeHHHHHHhhccCC---CCCCcHHHHHH----HHHHhCCCCCC
Q psy5333         236 IDVTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEE---HPHMFPILIKQ----VLEEKDTDKDG  308 (417)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~~~~~l~~~F~~~D~d~dG~Is~~Ef~~~l~~~~---~~~~~~~~i~~----l~~~~D~d~dg  308 (417)
                       .....         .......++.+|..+|.+++|.|+.+||..++....   +..++..++..    ++..+|.+++|
T Consensus        93 -~~~~~---------~~~~~~~l~~~F~~~D~d~~G~i~~~el~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~d~~~dg  162 (263)
T 2f33_A           93 -LFRCQ---------QLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDG  162 (263)
T ss_dssp             -HHGGG---------TSSCHHHHHHHHTTSSTTTCSSBCHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHTCSSSSS
T ss_pred             -HHHHh---------hccHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHHhcCCCCCC
Confidence             00000         001245688999999999999999999999997542   45677777776    99999999999


Q ss_pred             ceeHHHHHHHhccc--------cCcccHHHHHHHHhhhhcCCCCCcccHHHHHHHHhhcCC----CCcHHHHHHHHHh-c
Q psy5333         309 FLSFQEFMGDRGQK--------HNRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVPSNE----DIAEEEVNHLFAA-S  375 (417)
Q Consensus       309 ~Is~~EFl~~~~~~--------~~~~~~~~~~~~F~~~~D~d~dG~Is~~El~~~l~~~~~----~~~~~e~~~l~~~-~  375 (417)
                      .|+|.||+.++...        ........++.+|+ .+|+|++|+|+.+||+.++..++.    .++++++..++.. +
T Consensus       163 ~i~~~ef~~~~~~~~~~~~~~~~~~~~~~~~~~~F~-~~D~d~~G~is~~El~~~l~~~~~~~~~~~~~~e~~~~~~~~~  241 (263)
T 2f33_A          163 KLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFE-LYDQDGNGYIDENELDALLKDLCEKNKQELDINNISTYKKNIM  241 (263)
T ss_dssp             CBCHHHHHHHSCTTTCSHHHHHHTCCCHHHHHHHHH-HHCCSSSSCEEHHHHHHHHHHHHHHCTTTCCTTTHHHHHHHHH
T ss_pred             eEcHHHHHHHHHHHHHHHHHhcCcchHHHHHHHHHH-HhCCCCCCcccHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHhh
Confidence            99999999986541        12344677899999 999999999999999999988876    7899999999987 7


Q ss_pred             cCCCCCcccHHHHHHHH
Q psy5333         376 DDDHDDLLSFDEIVEHH  392 (417)
Q Consensus       376 D~d~DG~Is~~EF~~~~  392 (417)
                      |.|+||.|+|+||+..+
T Consensus       242 D~d~dG~i~~~EF~~~~  258 (263)
T 2f33_A          242 ALSDGGKLYRTDLALIL  258 (263)
T ss_dssp             TTSBTTEECGGGTHHHH
T ss_pred             ccCCCCeEcHHHHHHHH
Confidence            99999999999999866



>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Back     alignment and structure
>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B Back     alignment and structure
>2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 417
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 1e-10
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 0.003
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 0.004
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 6e-09
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 7e-09
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-08
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-05
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-04
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 3e-07
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-06
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.001
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.001
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 1e-06
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 5e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 1e-06
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 8e-06
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 2e-06
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 2e-06
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 2e-06
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 2e-06
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 2e-04
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 4e-06
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 3e-05
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 0.001
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 5e-06
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 4e-04
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 7e-06
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 0.001
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 0.003
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-05
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.001
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 3e-05
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-05
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-05
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 7e-04
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 8e-04
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 0.001
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 6e-05
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 7e-05
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 8e-05
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 0.001
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 0.001
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 8e-05
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 0.003
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 9e-05
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-04
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.003
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-04
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.001
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 1e-04
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-04
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 2e-04
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 0.001
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 2e-04
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 8e-04
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 0.002
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-04
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.003
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 3e-04
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 3e-04
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 0.003
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 3e-04
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 0.001
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 0.002
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-04
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-04
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 6e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 7e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 0.001
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 9e-04
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 0.002
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 0.003
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.004
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 0.004
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Ciliate (Paramecium tetraurelia) [TaxId: 5888]
 Score = 56.8 bits (136), Expect = 1e-10
 Identities = 29/133 (21%), Positives = 59/133 (44%), Gaps = 1/133 (0%)

Query: 259 KMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQVLEEKDTDKDGFLSFQEFMGD 318
           K  F   D D +G +   E  +        +     ++ ++ E D D +G + F EF+  
Sbjct: 12  KEAFALFDKDGDGTITTKELGTVM-RSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSL 70

Query: 319 RGQKHNRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVPSNEDIAEEEVNHLFAASDDD 378
             +K   Q   EE  +    +D + +GL++  E+   +    E + ++EV+ +   +D D
Sbjct: 71  MARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADID 130

Query: 379 HDDLLSFDEIVEH 391
            D  ++++E V  
Sbjct: 131 GDGHINYEEFVRM 143


>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.9
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.89
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.88
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.87
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.85
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.85
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.84
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.84
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.84
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.83
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.82
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.82
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.82
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.82
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.82
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.82
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.81
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.81
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.81
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.8
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.8
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.8
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.8
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.79
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.78
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.78
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.78
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.78
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.77
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.77
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.76
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.75
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.75
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.75
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.74
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.74
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.73
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.73
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.72
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.72
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.7
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.69
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.69
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.68
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.68
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.67
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.67
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.67
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.66
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.65
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.65
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.65
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.65
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.65
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.64
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.63
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.63
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.62
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.6
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.6
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.59
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.55
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.54
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.53
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.52
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.5
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.47
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.44
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.43
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.42
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.41
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.41
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.41
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.38
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.37
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.37
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.36
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.36
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.36
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.35
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.35
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.34
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.33
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.33
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.31
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.31
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.31
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.3
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.3
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.29
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.29
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.29
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.28
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.26
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.26
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.25
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.23
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.22
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.22
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.21
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.19
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.19
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.09
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.01
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.0
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.99
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.95
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.92
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.91
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.9
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.87
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.87
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.87
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.85
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.85
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.84
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.82
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.82
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.81
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.8
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.8
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.77
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.71
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.69
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.69
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.68
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.67
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.66
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.64
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.63
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.51
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.51
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.31
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.29
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.12
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.11
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.11
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.03
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.96
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.86
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.85
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.85
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.84
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.83
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.3
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.03
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 96.83
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 96.69
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 93.5
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 92.6
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 88.92
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 88.82
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 88.34
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 87.74
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 83.8
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 83.36
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 83.26
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 80.66
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
domain: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
species: Physarum polycephalum [TaxId: 5791]
Probab=99.90  E-value=2.7e-24  Score=204.65  Aligned_cols=203  Identities=15%  Similarity=0.173  Sum_probs=179.0

Q ss_pred             hhhHHHHHHHHHHHHhhcCCCCCcccHHHHHHHHHHHcCCCCHHHHHHHHHHhCCCCCCceehHhHHHHhcCCCCCCccc
Q psy5333         158 QMKILTKKRLRLLLKNMDLNKDNNIDRKELQAWILRSFRMLSVEESNSRFEDADENTDGVVDWDEHLKETYGTEDADDID  237 (417)
Q Consensus       158 ~~~~e~~~~L~~~F~~~D~d~dG~Is~~El~~~l~~~~~~~~~~ei~~lf~~~D~d~dG~Is~~EF~~~~~~~~~~~~~~  237 (417)
                      +++.+....++++|..+|.|++|.|+..||..+|..++..++..++..+|..+|.|++|.|+|.||+..+..        
T Consensus       115 ~l~~~~~~~~~~~F~~~D~~~~g~i~~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~--------  186 (321)
T d1ij5a_         115 MLSEEDTNILRQLFLSSAVSGSGKFSFQDLKQVLAKYADTIPEGPLKKLFVMVENDTKGRMSYITLVAVAND--------  186 (321)
T ss_dssp             CCCHHHHHHHHHHHTSSSSTTSSCCCHHHHHHHHHHHHTTSCSSHHHHHHHHHHHCCSSTHHHHHHTTSHHH--------
T ss_pred             cCCHHHHHHHHHHHHHHcCCCCCeEcHHHHHHHHHHcCCcccHHHHHHHHHHHhhcCCccccchhhhhhhhh--------
Confidence            445678899999999999999999999999999999999999999999999999999999999999875442        


Q ss_pred             cccccchhhHHHHHHHHHHHHHHHHHHhCCCCCCceeHHHHHHhhccCCCCCCcHHHHHHHHHHhCCCCCCceeHHHHHH
Q psy5333         238 VTNLGDDMNLLLLFTQMVKQDKMIFNAADGDKNGVLDKTEYQSFSAPEEHPHMFPILIKQVLEEKDTDKDGFLSFQEFMG  317 (417)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~l~~~F~~~D~d~dG~Is~~Ef~~~l~~~~~~~~~~~~i~~l~~~~D~d~dg~Is~~EFl~  317 (417)
                                       ...+...|+.+|.+++|.++..++...+... +. ........++..++.+.+|.+.+.+|+.
T Consensus       187 -----------------~~~~~~~F~~~d~d~~~~i~~~~~~~~~~~~-~~-~~~~~~~~~~~~~~~~~~~~i~~~ef~~  247 (321)
T d1ij5a_         187 -----------------LAALVADFRKIDTNSNGTLSRKEFREHFVRL-GF-DKKSVQDALFRYADEDESDDVGFSEYVH  247 (321)
T ss_dssp             -----------------HHTSCCCHHHHCTTCCSEECHHHHHHHHHHT-TC-CCHHHHHHHHHHHCTTCSSCEEHHHHHH
T ss_pred             -----------------hhhhhHHHHHHhhcccccchhHHHhhhhhcc-cc-cchHHHHHHHHhhhcccccccccccccc
Confidence                             2334467999999999999999999999865 33 3566778899999999999999999998


Q ss_pred             HhccccCcccHHHHHHHHhhhhcCCCCCcccHHHHHHHHhhcCC-CCcHHHHHHHHHhccCCCCCcccHHHHHHHHHH
Q psy5333         318 DRGQKHNRQYIVEEKDKFDNEYDTNKDGLLNENEILSWIVPSNE-DIAEEEVNHLFAASDDDHDDLLSFDEIVEHHDV  394 (417)
Q Consensus       318 ~~~~~~~~~~~~~~~~~F~~~~D~d~dG~Is~~El~~~l~~~~~-~~~~~e~~~l~~~~D~d~DG~Is~~EF~~~~~~  394 (417)
                      ....      ...+..+|. .+|.|++|+|+..||+.+|...+. .+++.++..+|..+|.|+||.|||+||++.+-+
T Consensus       248 ~~~~------~~~~~~~F~-~~D~d~~G~Is~~E~~~~l~~~~~~~~~~~~~~~l~~~~D~d~dG~Is~~EF~~~ml~  318 (321)
T d1ij5a_         248 LGLC------LLVLRILYA-FADFDKSGQLSKEEVQKVLEDAHIPESARKKFEHQFSVVDVDDSKSLSYQEFVMLVLL  318 (321)
T ss_dssp             HHHH------HHHHHHHHH-HTCSSSCSSEEHHHHHHHHHHTTCCGGGCSTHHHHHHHHTTTTCSEECHHHHHHHHHH
T ss_pred             hhhh------hhHHHHHHH-HHhcCCCCCCcHHHHHHHHHHcCCCcCcHHHHHHHHHHhCCCCCCcCcHHHHHHHHHH
Confidence            7443      345677898 999999999999999999999996 488999999999999999999999999998844



>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure