Psyllid ID: psy535


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460
MNTKVGSLETRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTPTVQYLPFRLQGVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNHQGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQKPTITWQRRDGVALPKNRVKIVGGNITIEGLRRVDFGYYECVVSNEVATIVQAAQLVVEGTQPHAPYNITGVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTKGPKPGPPRNVSVTEVNNGFVISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTK
cccccccccccEEEEEccEEEEccccccccEEEEEEEEEcccccccEEEEEEEEcccEEEEcccEEEEEccccEEEEEEccccccccEEEEEEccEEccccccccEEEcccccEEEEcccccccEEEEEEEEccccccccEEEEEEEEccccEEEEcccccEEEccccEEEEEEEEEccccccccEEEEEEccEEccccccEEEEccEEEEEcccccccEEEEEEEEEccccEEEEEEEEEEcccccccccEEEEEEccEEEEEEEcccccccccEEEEEEEEEEccccccEEEEEEccccEEEEEccccccccEEEEEEEEcccccccccccEEEccccccccccccEEEEEEccEEEEEEEccccccccccEEEEEEEEcccccccccccccccccccccEEEcccccccEEEEEccccccEEEEcccccccEEEEEEEEEcccccccccccEEEEcc
ccccEccccccEEEEcccEEEEEccccccccEEEEEEEcccccEccccEEEEEEcccccccccccEEEEcccEEEEEEEEcccccccEEEEEEccEEcccccccEEEEccccEEEEEcccccccEEEEEEEEEcccccccccEEEEEEcccccccccccccEEEEcccEEEEEEEccccccccccEEEEEEccccccccccEEccccEEEEccccHHHcEEEEEEEEEcccccccccEEEEEccccccccccEEEEcccEEEEEEEcccccccccEEEEEEEEEccccccccEEEEEcccccEEEEEccccccEEEEEEEEEEcccccccccEEEEEcccccccccccEEEEEcccEEEEEEcccccccccEEEEEEEEEEcccccccccccccccccEEEEEEccccccccEEEEEEcccccEEEEEccccccEEEEEEEEEEccccccccccEEEEcc
MNTKVGSLETRVVIKkdgtlvinpvgsddsglymcevsngigepqaAQAYlnvefpakvtftptvqylpfrlqGVVQchikanptfqyvtwtkdkrllepyqtkdIVVMQNGSLLFTRVnqnhqgrytctpynahgtqgssgqmevlvrkppaftikpeamyqrkvgesvDMHCEAqeaegtqkptitwqrrdgvalpknrvkivggnitieglrrvdFGYYECVVSNEVATIVQAAQLVVegtqphapynitgVATEFSVTlewlpgysggpdlkqNYVIWYREQgnkdwlpipvtppgstqitinrltpattyefqvvgknelgdgmlSNIVVVktkgpkpgpprnvsvtevnngfviswqppleRASLIQYYLIKYRtdgswktlnkgqirpeensylgeyreqgnkdwlpipvtppgstqitinrltpattyefqvvgknelgdgmlsnIVVVKTK
mntkvgsletrvvikkdgtlvinpvgsddSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTPTVQYLPFRLQGVVQCHIKANptfqyvtwtkdKRLLEPYQTKDIVVMQNGSLLFTRVNQNHQGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQeaegtqkptitwqrrdgvalpknrvkivggnitieglrrvDFGYYECVVSNEVATIVQAAQLVVEGTQPHAPYNITGVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKtkgpkpgpprnvsvTEVNNGFviswqppleRASLIQYYLIKYRtdgswktlnkgqirpEENSYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVgknelgdgmlsnivvvktk
MNTKVGSLETRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTPTVQYLPFRLQGVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNHQGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQKPTITWQRRDGVALPKNRVKIVGGNITIEGLRRVDFGYYECVVSNEVATIVQAAQLVVEGTQPHAPYNITGVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIvvvktkgpkpgppRNVSVTEVNNGFVISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTK
*********TRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTPTVQYLPFRLQGVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNHQGRYTCTPYNAH******************FT******************************TITWQRRDGVALPKNRVKIVGGNITIEGLRRVDFGYYECVVSNEVATIVQAAQLVVEGTQPHAPYNITGVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKT***********SVTEVNNGFVISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIR****SYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVV***
***********VVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTPTVQYLPFRLQGVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNHQGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQKPTITWQRRDG*************NITIEGLRRVDFGYYECVVSNEVATIVQAAQLVV**************ATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNEL*********************************VISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNI**VKT*
MNTKVGSLETRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTPTVQYLPFRLQGVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNHQGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQKPTITWQRRDGVALPKNRVKIVGGNITIEGLRRVDFGYYECVVSNEVATIVQAAQLVVEGTQPHAPYNITGVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTKGPKPGPPRNVSVTEVNNGFVISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTK
***KVGSLETRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTPTVQYLPFRLQGVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNHQGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQKPTITWQRRDGVALPKNRVKIVGGNITIEGLRRVDFGYYECVVSNEVATIVQAAQLVVEGTQPHAPYNITGVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTKGPKPGPPRNVSVTEVNNGFVISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVV*K**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTKVGSLETRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTPTVQYLPFRLQGVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNHQGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQKPTITWQRRDGVALPKNRVKIVGGNITIEGLRRVDFGYYECVVSNEVATIVQAAQLVVEGTQPHAPYNITGVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTKGPKPGPPRNVSVTEVNNGFVISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query460 2.2.26 [Sep-21-2011]
Q967D7 1531 Protein turtle OS=Drosoph yes N/A 0.865 0.259 0.673 1e-174
Q9UPX0 1349 Protein turtle homolog B yes N/A 0.819 0.279 0.339 1e-62
Q9P2J2 1179 Protein turtle homolog A no N/A 0.882 0.344 0.305 3e-54
P0C5H6 1179 Protein turtle homolog A no N/A 0.828 0.323 0.311 1e-53
Q05BQ1 1179 Protein turtle homolog A no N/A 0.828 0.323 0.311 2e-53
P97603 1377 Neogenin (Fragment) OS=Ra no N/A 0.891 0.297 0.278 2e-34
P97798 1493 Neogenin OS=Mus musculus no N/A 0.9 0.277 0.273 2e-32
Q92859 1461 Neogenin OS=Homo sapiens no N/A 0.889 0.279 0.282 1e-31
Q63155 1445 Netrin receptor DCC OS=Ra no N/A 0.765 0.243 0.275 7e-31
P70211 1447 Netrin receptor DCC OS=Mu no N/A 0.765 0.243 0.275 2e-30
>sp|Q967D7|TUTL_DROME Protein turtle OS=Drosophila melanogaster GN=tutl PE=2 SV=2 Back     alignment and function desciption
 Score =  613 bits (1580), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 289/429 (67%), Positives = 343/429 (79%), Gaps = 31/429 (7%)

Query: 4   KVGSLETRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTP 63
           +V +LETRV I+KDG+L+INP+  DDSG Y+CEV+NGIG+PQ+A AYL+VE+PAKVTFTP
Sbjct: 388 EVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTP 447

Query: 64  TVQYLPFRLQGVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNH 123
           TVQYLPFRL GVVQC+IK++P  QYVTWTKDKRLLEPYQ KDIVVM NGSLLFTRVN+ H
Sbjct: 448 TVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEH 507

Query: 124 QGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQ 183
           QG+Y CTPYNA GT G+SG M+VLVRKPPAFT++PE +YQRKVG+SV+MHC+A EAEGT+
Sbjct: 508 QGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTE 567

Query: 184 KPTITWQRRDGVALP---KNRVKIVGGNITIEGLRRVDFGYYECVVSNEVATIVQAAQLV 240
           +PTI WQR++G  L    +NR+KI GGNITIE LRR DFGYY+CVVSNEVAT++   QLV
Sbjct: 568 RPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLV 627

Query: 241 VEGTQPHAPYNITGVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPG 300
           +EGTQPHAPYNITG ATE S+TL+WLPGYSGG + KQ+Y IW+RE G  DW  I VTP G
Sbjct: 628 IEGTQPHAPYNITGKATESSITLQWLPGYSGGSEYKQDYTIWFREAGVNDWQTISVTPSG 687

Query: 301 STQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKT---------------------- 338
           STQ+TIN L   TTYEFQVVG+N LGDGM+S ++ V+T                      
Sbjct: 688 STQVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAPAAPRNVKAATQPPDSFF 747

Query: 339 ------KGPKPGPPRNVSVTEVNNGFVISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQ 392
                  GPKPGPPRNVSVTEV+NGF+I+WQ PLERA ++++Y IKYRTD  WKTLN+GQ
Sbjct: 748 QLMPDEAGPKPGPPRNVSVTEVSNGFLITWQSPLERAHIVKFYTIKYRTDAQWKTLNRGQ 807

Query: 393 IRPEENSYL 401
           IRPEE  YL
Sbjct: 808 IRPEETQYL 816




Essential protein that plays a role in the establishment of coordinated motor control.
Drosophila melanogaster (taxid: 7227)
>sp|Q9UPX0|TUTLB_HUMAN Protein turtle homolog B OS=Homo sapiens GN=IGSF9B PE=2 SV=2 Back     alignment and function description
>sp|Q9P2J2|TUTLA_HUMAN Protein turtle homolog A OS=Homo sapiens GN=IGSF9 PE=1 SV=2 Back     alignment and function description
>sp|P0C5H6|TUTLA_RAT Protein turtle homolog A OS=Rattus norvegicus GN=Igsf9 PE=1 SV=1 Back     alignment and function description
>sp|Q05BQ1|TUTLA_MOUSE Protein turtle homolog A OS=Mus musculus GN=Igsf9 PE=1 SV=2 Back     alignment and function description
>sp|P97603|NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus GN=Neo1 PE=2 SV=1 Back     alignment and function description
>sp|P97798|NEO1_MOUSE Neogenin OS=Mus musculus GN=Neo1 PE=1 SV=1 Back     alignment and function description
>sp|Q92859|NEO1_HUMAN Neogenin OS=Homo sapiens GN=NEO1 PE=1 SV=2 Back     alignment and function description
>sp|Q63155|DCC_RAT Netrin receptor DCC OS=Rattus norvegicus GN=Dcc PE=1 SV=2 Back     alignment and function description
>sp|P70211|DCC_MOUSE Netrin receptor DCC OS=Mus musculus GN=Dcc PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query460
270006125 1219 hypothetical protein TcasGA2_TC008291 [T 0.745 0.281 0.783 0.0
157113626 1300 turtle protein, isoform [Aedes aegypti] 0.865 0.306 0.726 0.0
158297293 1478 AGAP007928-PA [Anopheles gambiae str. PE 0.865 0.269 0.724 0.0
242013609 1313 turtle protein, isoform, putative [Pedic 0.865 0.303 0.718 0.0
328790053 1174 PREDICTED: protein turtle isoform 2 [Api 0.867 0.339 0.715 0.0
322800587539 hypothetical protein SINV_13454 [Solenop 0.760 0.649 0.744 0.0
380011908 1197 PREDICTED: LOW QUALITY PROTEIN: protein 0.865 0.332 0.714 0.0
307167054 1161 Protein turtle [Camponotus floridanus] 0.867 0.343 0.706 0.0
307201185 744 Protein turtle [Harpegnathos saltator] 0.865 0.534 0.701 0.0
328699158 1256 PREDICTED: protein turtle-like isoform 1 0.863 0.316 0.718 1e-179
>gi|270006125|gb|EFA02573.1| hypothetical protein TcasGA2_TC008291 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/398 (78%), Positives = 351/398 (88%)

Query: 4   KVGSLETRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTP 63
           ++ SLETRV I++DG+LVINPV SDDSG Y+CEVSNGIGEPQ+A AYLNVE+PAKVTFTP
Sbjct: 301 ELASLETRVNIRRDGSLVINPVNSDDSGQYLCEVSNGIGEPQSASAYLNVEYPAKVTFTP 360

Query: 64  TVQYLPFRLQGVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNH 123
           TVQYLPFRL GVVQC+IKANP  QYVTWTKDKRLLEPYQTKDIV+M NGSLLFTRVN+NH
Sbjct: 361 TVQYLPFRLAGVVQCYIKANPPLQYVTWTKDKRLLEPYQTKDIVIMNNGSLLFTRVNENH 420

Query: 124 QGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQ 183
           QGRYTCTPYNA GTQGSSGQMEVLVRKPP FTI+PE +YQRKVG++V+MHCEAQEAEGTQ
Sbjct: 421 QGRYTCTPYNAQGTQGSSGQMEVLVRKPPVFTIEPEPLYQRKVGDTVEMHCEAQEAEGTQ 480

Query: 184 KPTITWQRRDGVALPKNRVKIVGGNITIEGLRRVDFGYYECVVSNEVATIVQAAQLVVEG 243
           KPTI WQRRDG  LP  R KIVGGNITIEGLR  DFG+Y+CV SNEVATIV + +LVVEG
Sbjct: 481 KPTIEWQRRDGSPLPPKRYKIVGGNITIEGLRAKDFGFYQCVASNEVATIVTSTRLVVEG 540

Query: 244 TQPHAPYNITGVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPGSTQ 303
           T+PHAPYN+TG A EF+VTL WLPGYSGGPD KQNY IWYRE G  +W  IPVTP GSTQ
Sbjct: 541 TEPHAPYNLTGNAMEFAVTLSWLPGYSGGPDYKQNYTIWYREAGTSEWSTIPVTPSGSTQ 600

Query: 304 ITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTKGPKPGPPRNVSVTEVNNGFVISWQ 363
           I INRL+P TTYEFQVVGKN LGDG++S ++ VKT GPKPG P+N++VTE++NGF+I+WQ
Sbjct: 601 IKINRLSPGTTYEFQVVGKNALGDGLMSKVITVKTLGPKPGIPKNLTVTEISNGFLITWQ 660

Query: 364 PPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYL 401
           PP ERA+LIQ+Y IKYRTDG WKTLNK QIRPE+  YL
Sbjct: 661 PPTERANLIQHYSIKYRTDGGWKTLNKAQIRPEDTQYL 698




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157113626|ref|XP_001652029.1| turtle protein, isoform [Aedes aegypti] gi|108877675|gb|EAT41900.1| AAEL006522-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|158297293|ref|XP_317553.4| AGAP007928-PA [Anopheles gambiae str. PEST] gi|157015125|gb|EAA12846.4| AGAP007928-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|242013609|ref|XP_002427495.1| turtle protein, isoform, putative [Pediculus humanus corporis] gi|212511890|gb|EEB14757.1| turtle protein, isoform, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328790053|ref|XP_392303.4| PREDICTED: protein turtle isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|322800587|gb|EFZ21573.1| hypothetical protein SINV_13454 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|380011908|ref|XP_003690035.1| PREDICTED: LOW QUALITY PROTEIN: protein turtle-like [Apis florea] Back     alignment and taxonomy information
>gi|307167054|gb|EFN60857.1| Protein turtle [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307201185|gb|EFN81091.1| Protein turtle [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328699158|ref|XP_003240846.1| PREDICTED: protein turtle-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query460
FB|FBgn0010473 1531 tutl "turtle" [Drosophila mela 0.954 0.286 0.580 1.2e-136
FB|FBgn0028482719 CG16857 [Drosophila melanogast 0.706 0.452 0.411 7.6e-74
UNIPROTKB|Q9UPX0 1349 IGSF9B "Protein turtle homolog 0.819 0.279 0.331 6e-56
ZFIN|ZDB-GENE-060810-28 2021 igsf9b "immunoglobulin superfa 0.806 0.183 0.341 1.3e-55
UNIPROTKB|H9L3A2632 IGSF9 "Uncharacterized protein 0.819 0.596 0.318 2.3e-55
UNIPROTKB|Q9P2J2 1179 IGSF9 "Protein turtle homolog 0.906 0.353 0.306 5e-49
UNIPROTKB|F1MNG8 1179 IGSF9 "Uncharacterized protein 0.904 0.352 0.305 1.4e-48
RGD|1304566 1179 Igsf9 "immunoglobulin superfam 0.943 0.368 0.304 3.6e-48
MGI|MGI:2135283 1179 Igsf9 "immunoglobulin superfam 0.697 0.272 0.339 9.7e-48
UNIPROTKB|F1PDU1 1432 NEO1 "Uncharacterized protein" 0.8 0.256 0.293 1.2e-38
FB|FBgn0010473 tutl "turtle" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1338 (476.1 bits), Expect = 1.2e-136, P = 1.2e-136
 Identities = 262/451 (58%), Positives = 324/451 (71%)

Query:     4 KVGSLETRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTP 63
             +V +LETRV I+KDG+L+INP+  DDSG Y+CEV+NGIG+PQ+A AYL+VE+PAKVTFTP
Sbjct:   388 EVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTP 447

Query:    64 TVQYLPFRLQGVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNH 123
             TVQYLPFRL GVVQC+IK++P  QYVTWTKDKRLLEPYQ KDIVVM NGSLLFTRVN+ H
Sbjct:   448 TVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEH 507

Query:   124 QGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQ 183
             QG+Y CTPYNA GT G+SG M+VLVRKPPAFT++PE +YQRKVG+SV+MHC+A EAEGT+
Sbjct:   508 QGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTE 567

Query:   184 KPTITWQRRDGVALP---KNRVKIVGGNITIEGLRRVDFGYYECVVSNEVATIVQAAQLV 240
             +PTI WQR++G  L    +NR+KI GGNITIE LRR DFGYY+CVVSNEVAT++   QLV
Sbjct:   568 RPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLV 627

Query:   241 VEGTQPHAPYNITGVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTPPG 300
             +EGTQPHAPYNITG ATE S+TL+WLPGYSGG + KQ+Y IW+RE G  DW  I VTP G
Sbjct:   628 IEGTQPHAPYNITGKATESSITLQWLPGYSGGSEYKQDYTIWFREAGVNDWQTISVTPSG 687

Query:   301 STQITINRLTPATTYEFQVVGKNELGDGMLSNIXXXXXXXXXXXXXRNV-SVTEVNNGFV 359
             STQ+TIN L   TTYEFQVVG+N LGDGM+S +             RNV + T+  + F 
Sbjct:   688 STQVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAPAAPRNVKAATQPPDSFF 747

Query:   360 -ISWQPPLERASLIQYYLIKYRTDG---SWKT-LNKGQIRPEENSYLGEYREQGNKDWLP 414
              +       +    +   +   ++G   +W++ L +  I      Y  +YR       L 
Sbjct:   748 QLMPDEAGPKPGPPRNVSVTEVSNGFLITWQSPLERAHI---VKFYTIKYRTDAQWKTLN 804

Query:   415 IPVTPPGSTQITINRLTPATTYEFQVVGKNE 445
                  P  TQ  +  L    TY F+V+  +E
Sbjct:   805 RGQIRPEETQYLVKNLVGGRTYYFRVLANSE 835


GO:0008344 "adult locomotory behavior" evidence=IMP
GO:0007629 "flight behavior" evidence=IMP
GO:0030537 "larval behavior" evidence=IMP
GO:0007422 "peripheral nervous system development" evidence=NAS
GO:0005575 "cellular_component" evidence=ND
GO:0003674 "molecular_function" evidence=ND
GO:0008039 "synaptic target recognition" evidence=IMP
GO:0048814 "regulation of dendrite morphogenesis" evidence=IMP
GO:0070593 "dendrite self-avoidance" evidence=IMP
GO:0007411 "axon guidance" evidence=IMP
GO:0007414 "axonal defasciculation" evidence=IMP
GO:0016199 "axon midline choice point recognition" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
FB|FBgn0028482 CG16857 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UPX0 IGSF9B "Protein turtle homolog B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060810-28 igsf9b "immunoglobulin superfamily, member 9b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9L3A2 IGSF9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P2J2 IGSF9 "Protein turtle homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNG8 IGSF9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1304566 Igsf9 "immunoglobulin superfamily, member 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2135283 Igsf9 "immunoglobulin superfamily, member 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDU1 NEO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q967D7TUTL_DROMENo assigned EC number0.67360.86520.2599yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query460
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 2e-15
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 1e-13
pfam0004184 pfam00041, fn3, Fibronectin type III domain 2e-09
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 3e-09
smart0006083 smart00060, FN3, Fibronectin type 3 domain 1e-08
cd0572371 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)- 4e-08
smart0041085 smart00410, IG_like, Immunoglobulin like 4e-08
smart0040985 smart00409, IG, Immunoglobulin 4e-08
cd0572486 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like 5e-08
cd0496973 cd04969, Ig5_Contactin_like, Fifth Ig domain of co 7e-08
pfam0004184 pfam00041, fn3, Fibronectin type III domain 1e-07
smart0006083 smart00060, FN3, Fibronectin type 3 domain 4e-07
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 4e-07
cd0572885 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of 6e-07
cd0574574 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig 7e-07
cd0572569 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like 3e-06
cd0572486 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like 4e-06
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 5e-06
cd0009674 cd00096, Ig, Immunoglobulin domain 8e-06
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 2e-05
cd0497876 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin 4e-05
cd0572985 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) 5e-05
cd0496791 cd04967, Ig1_Contactin, First Ig domain of contact 6e-05
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 6e-05
cd0585273 cd05852, Ig5_Contactin-1, Fifth Ig domain of conta 1e-04
cd0573171 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig 1e-04
pfam1392774 pfam13927, Ig_3, Immunoglobulin domain 1e-04
cd0573479 cd05734, Ig7_DSCAM, Seventh immunoglobulin (Ig)-li 2e-04
cd0572885 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of 4e-04
smart0041085 smart00410, IG_like, Immunoglobulin like 5e-04
smart0040985 smart00409, IG, Immunoglobulin 5e-04
cd0009674 cd00096, Ig, Immunoglobulin domain 5e-04
cd0587671 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-lik 5e-04
cd0575485 cd05754, Ig3_Perlecan_like, Third immunoglobulin ( 6e-04
cd0496888 cd04968, Ig3_Contactin_like, Third Ig domain of co 7e-04
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 0.001
cd0584993 cd05849, Ig1_Contactin-1, First Ig domain of conta 0.001
cd05714106 cd05714, Ig_CSPGs_LP, Immunoglobulin (Ig)-like dom 0.001
cd0009674 cd00096, Ig, Immunoglobulin domain 0.002
cd0496973 cd04969, Ig5_Contactin_like, Fifth Ig domain of co 0.003
cd0572690 cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like 0.003
cd0573377 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig 0.003
cd05877106 cd05877, Ig_LP_like, Immunoglobulin (Ig)-like doma 0.003
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
 Score = 71.4 bits (175), Expect = 2e-15
 Identities = 38/118 (32%), Positives = 50/118 (42%), Gaps = 26/118 (22%)

Query: 343 PGPPRNVSVTEVN-NGFVISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYL 401
           P PP N+ VT+V      +SW PP +    I  Y++                        
Sbjct: 1   PSPPTNLRVTDVTSTSVTLSWTPPEDDGGPITGYVV------------------------ 36

Query: 402 GEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKT 459
            EYRE+G+ DW  + VTP   T  T+  L P T YEF+V   N  G+   S  V V T
Sbjct: 37  -EYREKGSGDWKEVEVTPGSETSYTLTGLKPGTEYEFRVRAVNGGGESPPSESVTVTT 93


Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93

>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|212460 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|143179 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>gnl|CDD|143168 cd04967, Ig1_Contactin, First Ig domain of contactin Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143260 cd05852, Ig5_Contactin-1, Fifth Ig domain of contactin-1 Back     alignment and domain information
>gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>gnl|CDD|222457 pfam13927, Ig_3, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143211 cd05734, Ig7_DSCAM, Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143284 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>gnl|CDD|143231 cd05754, Ig3_Perlecan_like, Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>gnl|CDD|143169 cd04968, Ig3_Contactin_like, Third Ig domain of contactin Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|143257 cd05849, Ig1_Contactin-1, First Ig domain of contactin-1 Back     alignment and domain information
>gnl|CDD|143191 cd05714, Ig_CSPGs_LP, Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin Back     alignment and domain information
>gnl|CDD|143203 cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143210 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>gnl|CDD|143285 cd05877, Ig_LP_like, Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 460
KOG4221|consensus 1381 100.0
KOG3513|consensus 1051 100.0
KOG3513|consensus 1051 100.0
KOG4221|consensus 1381 100.0
KOG4222|consensus 1281 100.0
KOG4222|consensus 1281 100.0
KOG4194|consensus873 99.96
KOG4194|consensus873 99.93
PHA02785326 IL-beta-binding protein; Provisional 99.93
PHA02785326 IL-beta-binding protein; Provisional 99.91
KOG0196|consensus 996 99.79
PHA02826227 IL-1 receptor-like protein; Provisional 99.78
PHA02826227 IL-1 receptor-like protein; Provisional 99.75
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.65
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.63
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.62
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.61
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 99.6
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.6
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.58
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.58
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.56
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.56
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.55
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.55
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.55
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.54
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.54
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.54
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.53
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.53
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.53
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.53
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.53
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.52
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.52
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.52
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.52
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.51
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.51
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.51
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.51
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.51
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.5
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.5
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.5
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.5
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.49
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.49
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.49
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.49
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.49
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.48
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.48
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.48
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.48
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.47
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.47
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.46
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.46
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.46
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.44
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.44
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.44
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.44
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.44
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.44
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.43
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.43
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.43
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.43
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.42
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.41
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.41
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.41
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.41
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.4
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.4
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.4
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.39
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.39
KOG3515|consensus741 99.38
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.38
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.37
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.37
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.37
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.37
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.36
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.35
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.35
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.35
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.35
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.34
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.33
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.33
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.33
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.33
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.32
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.31
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.31
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 99.3
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.29
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.29
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.29
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.29
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.26
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.26
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 99.26
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.26
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.26
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.26
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.24
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 99.24
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.24
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.24
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.24
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 99.24
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 99.23
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.23
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.23
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 99.23
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.23
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.22
KOG3515|consensus 741 99.22
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.22
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.21
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.21
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.21
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.21
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.21
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.21
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 99.2
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.2
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.19
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.19
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.19
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.19
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.18
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.17
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.17
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.16
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.16
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.16
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.16
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.16
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.15
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.15
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.14
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.14
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.13
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.13
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.13
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 99.11
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.11
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.11
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.11
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.1
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.1
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.1
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.09
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 99.09
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.08
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.08
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.07
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.07
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.07
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 99.07
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.06
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.06
smart0040863 IGc2 Immunoglobulin C-2 Type. 99.05
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.04
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.03
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.03
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.01
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.0
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.0
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.0
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.99
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 98.98
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.97
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.96
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 98.96
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.96
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 98.96
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.95
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 98.94
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 98.94
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 98.93
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.92
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.91
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 98.91
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.91
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 98.91
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.9
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.9
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 98.9
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.88
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.87
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.85
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 98.85
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 98.83
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 98.82
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 98.82
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.81
smart0040986 IG Immunoglobulin. 98.81
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 98.81
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.8
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.8
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 98.79
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 98.78
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 98.78
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.78
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 98.76
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.75
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.75
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 98.73
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 98.71
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 98.69
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 98.68
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 98.67
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.67
PHA03376221 BARF1; Provisional 98.66
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.64
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.63
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 98.62
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 98.58
PHA03376221 BARF1; Provisional 98.58
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.57
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.57
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.55
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 98.54
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.54
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 98.53
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.53
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.52
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.52
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.52
KOG4802|consensus 516 98.52
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.5
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 98.48
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.47
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 98.47
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.47
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 98.47
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.46
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.46
KOG0196|consensus 996 98.45
PHA03270466 envelope glycoprotein C; Provisional 98.42
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.41
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 98.41
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 98.4
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 98.4
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.39
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.39
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 98.36
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 98.36
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 98.36
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.35
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.35
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 98.33
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 98.33
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 98.33
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.32
smart0040986 IG Immunoglobulin. 98.32
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.32
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 98.32
PHA02987189 Ig domain OX-2-like protein; Provisional 98.32
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 98.31
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.31
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.3
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.3
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.26
PHA03269566 envelope glycoprotein C; Provisional 98.25
PHA03273486 envelope glycoprotein C; Provisional 98.25
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 98.23
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 98.23
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 98.22
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.2
cd0577093 IgC_beta2m Class I major histocompatibility comple 98.17
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.17
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 98.16
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.15
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 98.13
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 98.13
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 98.13
PHA03271490 envelope glycoprotein C; Provisional 98.08
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.06
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.05
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 98.03
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 98.03
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 98.02
KOG4367|consensus 699 98.01
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 98.0
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 97.98
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 97.97
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 97.97
KOG4258|consensus 1025 97.95
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 97.93
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 97.92
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 97.91
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 97.89
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 97.88
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 97.87
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 97.86
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 97.85
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.85
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 97.84
KOG0613|consensus 1205 97.84
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 97.84
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 97.84
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 97.82
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 97.82
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 97.81
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 97.81
smart0040775 IGc1 Immunoglobulin C-Type. 97.8
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.8
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 97.8
cd0006393 FN3 Fibronectin type 3 domain; One of three types 97.8
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 97.79
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 97.78
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.78
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 97.78
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.77
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 97.75
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 97.73
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 97.73
KOG4258|consensus 1025 97.68
PHA0263363 hypothetical protein; Provisional 97.68
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 97.64
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 97.64
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 97.61
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 97.59
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 97.57
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 97.56
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 97.5
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 97.49
KOG4152|consensus830 97.47
smart0040681 IGv Immunoglobulin V-Type. 97.45
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 97.45
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 97.43
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 97.39
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 97.37
PHA02987189 Ig domain OX-2-like protein; Provisional 97.36
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 97.35
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 97.34
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 97.29
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 97.28
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 97.25
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 97.24
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 97.24
KOG1480|consensus 909 97.15
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.14
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 97.1
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 97.04
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.03
PHA0263363 hypothetical protein; Provisional 97.02
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 96.95
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 96.93
KOG0613|consensus 1205 96.92
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 96.87
smart0006083 FN3 Fibronectin type 3 domain. One of three types 96.85
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 96.72
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 96.69
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 96.69
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 96.63
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 96.63
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 96.62
smart0040681 IGv Immunoglobulin V-Type. 96.62
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 96.61
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 96.48
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 96.41
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 96.37
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 96.36
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 96.34
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 96.32
PHA03270466 envelope glycoprotein C; Provisional 96.28
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 96.24
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 96.04
KOG4367|consensus699 95.91
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 95.91
KOG1480|consensus 909 95.88
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 95.81
PHA02982251 hypothetical protein; Provisional 95.77
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 95.74
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 95.64
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 95.48
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 95.36
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 95.24
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 95.24
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 95.1
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 95.01
PHA03269566 envelope glycoprotein C; Provisional 94.84
KOG4802|consensus 516 94.59
KOG4806|consensus454 94.58
PHA02914500 Immunoglobulin-like domain protein; Provisional 94.36
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 94.25
PHA03042286 CD47-like protein; Provisional 94.22
smart0040775 IGc1 Immunoglobulin C-Type. 94.12
PHA03273486 envelope glycoprotein C; Provisional 93.99
PHA03286492 envelope glycoprotein E; Provisional 93.99
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 93.84
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 93.84
PHA02865338 MHC-like TNF binding protein; Provisional 93.81
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 93.81
PF10179 300 DUF2369: Uncharacterised conserved protein (DUF236 93.73
COG4733 952 Phage-related protein, tail component [Function un 93.48
KOG4597|consensus560 92.96
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 92.86
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 92.73
PHA02914500 Immunoglobulin-like domain protein; Provisional 92.69
KOG3632|consensus 1335 92.64
cd0577093 IgC_beta2m Class I major histocompatibility comple 92.43
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 92.21
PHA03283542 envelope glycoprotein E; Provisional 92.11
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 92.01
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 92.0
PF02124211 Marek_A: Marek's disease glycoprotein A; InterPro: 91.33
COG3401343 Fibronectin type 3 domain-containing protein [Gene 91.18
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 90.99
KOG4152|consensus 830 90.52
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 90.32
PHA02982251 hypothetical protein; Provisional 90.02
PRK14081667 triple tyrosine motif-containing protein; Provisio 89.62
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 89.44
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 89.03
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 89.03
PLN02533 427 probable purple acid phosphatase 88.13
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 87.53
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 87.28
PHA03042286 CD47-like protein; Provisional 87.25
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 86.89
PHA03282540 envelope glycoprotein E; Provisional 86.79
COG3401343 Fibronectin type 3 domain-containing protein [Gene 85.81
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 85.79
KOG4228|consensus 1087 85.23
COG547560 Uncharacterized small protein [Function unknown] 82.64
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 82.1
PF02010440 REJ: REJ domain; InterPro: IPR002859 The REJ (Rece 82.07
PF02480439 Herpes_gE: Alphaherpesvirus glycoprotein E; InterP 81.95
PHA03271490 envelope glycoprotein C; Provisional 81.91
KOG4597|consensus560 81.08
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 80.71
cd0589098 Ig2_Nectin-1_like Second immunoglobulin (Ig) domai 80.59
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 80.52
>KOG4221|consensus Back     alignment and domain information
Probab=100.00  E-value=2.3e-53  Score=395.10  Aligned_cols=423  Identities=28%  Similarity=0.474  Sum_probs=338.8

Q ss_pred             CCcccCcccceEEEeeCCeEEEeecCCCCCeeEEEEEEeCCCCcceeeeEEEEecCC------eeEEcceeeeecceeeE
Q psy535            1 MNTKVGSLETRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPA------KVTFTPTVQYLPFRLQG   74 (460)
Q Consensus         1 ~~~~~~~~~~r~~~~~~~~L~i~~~~~~d~G~Y~C~~~~~~~~~~~~~~~l~v~~~p------~~~~~~~~~~~~~g~~~   74 (460)
                      ||++..+.++|+.+..+|.|.|.++++.|.|.|+|.|+++.....+..+.|+|...+      .|...|....+.+|+++
T Consensus       176 kn~~pl~~~~r~i~lpsG~L~I~~~qp~d~g~yrc~vt~g~~~r~S~~a~ltv~s~~~~~~~~~fl~~p~~~~v~~g~~v  255 (1381)
T KOG4221|consen  176 KNDQPLPLDSRVIVLPSGALEISGLQPSDTGEYRCVVTGGASQRTSNEAELTVLSDPGALNKLVFLDEPSNAVVVEGDDV  255 (1381)
T ss_pred             cccccccCCCcEEEcCCCcEEecccccCCCceEEEEEecCCcCCccceeEEEecCCcccccceeeecCCCccccccCCcE
Confidence            355556777799999999999999999999999999999987777888999987322      35667888899999999


Q ss_pred             EEEEEEecCCCCCeEEEeeCCeecCccccccEEEeecCeEEEeecCCCCCeEEEEEEEcCCCCcceeeEEEEEeeCCCce
Q psy535           75 VVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLFTRVNQNHQGRYTCTPYNAHGTQGSSGQMEVLVRKPPAF  154 (460)
Q Consensus        75 ~l~C~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~y~C~~~~~~g~~~~~~~~~v~v~~~p~~  154 (460)
                      .|.|.+.+.|.+ +|.|.+||..+.... .++.....+.|.|.+++..|+|.|+|+|.|......++  .+|.|..+|.+
T Consensus       256 ~leCvvs~~p~p-~v~Wlrng~~i~~ds-~rivl~g~~slliS~a~~~dSg~YtC~Atn~~D~idas--aev~V~a~P~~  331 (1381)
T KOG4221|consen  256 VLECVVSGVPKP-SVKWLRNGEKISVDS-YRIVLVGGSSLLISNATDDDSGKYTCRATNTNDSIDAS--AEVTVLAPPGF  331 (1381)
T ss_pred             EEEEEecCCCCC-ceEEeeCCeeeeecc-eEEEEecccceEEeccccccCceEEEEecCCCcccccc--eEEEEEcCCCC
Confidence            999999999887 799999999987533 56666667889999999999999999999955554444  45556668999


Q ss_pred             eeCCCcccccCCCCeEEEEeeeeccCCCCCCeeEEEcCCCccCCcccEEEecc-eEEEccccceeceEEEEEEeccccee
Q psy535          155 TIKPEAMYQRKVGESVDMHCEAQEAEGTQKPTITWQRRDGVALPKNRVKIVGG-NITIEGLRRVDFGYYECVVSNEVATI  233 (460)
Q Consensus       155 ~~~~~~~~~~~~g~~~~l~C~~~~~~~~p~~~~~W~~~~~~~~~~~~~~~~~~-~l~i~~~~~~~~g~y~C~a~n~~g~~  233 (460)
                      ...|... .+..+.++.+.|.+   .|.|.|.+.|++++....+...+++..+ .+.|..+-..|.|.|.|.+.|..|..
T Consensus       332 ~~~p~~l-~A~e~~die~ec~~---~g~p~p~v~w~kNgd~~ipsdy~ki~~~~~lrIlgi~~sdeg~yQcvaen~~G~a  407 (1381)
T KOG4221|consen  332 TKAPTTL-VAHESMDIEFECPV---SGKPIPTVRWYKNGDRIIPSDYFKIVGGGNLRILGIVKSDEGFYQCVAENDAGSA  407 (1381)
T ss_pred             CCCCcce-eeeeccceeEeCCC---CCCCcceEEEEecCcccCcccceEecCCCCcEEEEEecccchhhhhhhccCcccc
Confidence            9999887 56679999999999   7889999999998877777666666433 37777777888888888888877765


Q ss_pred             eeeeEEEEecC---------------------------------------------------------------------
Q psy535          234 VQAAQLVVEGT---------------------------------------------------------------------  244 (460)
Q Consensus       234 ~~~~~l~v~~~---------------------------------------------------------------------  244 (460)
                      .....+.+...                                                                     
T Consensus       408 ~a~a~l~vv~~p~~~~s~~~~sap~~lv~~~~~srfi~~tw~~p~~~~g~i~~~~v~~~~~~~~rer~~~tss~g~~~tv  487 (1381)
T KOG4221|consen  408 QAAAQLEVVPQPASASSDLLPSAPRDLVANLVSSRFIQLTWRPPAQISGNISTYTVFYKVEGDVRERLQNTSSPGIQVTV  487 (1381)
T ss_pred             cchhhheeccCCcccccCccccCCcceecccccceeEEEeecCccccCCCcceEEEEEecCCchhhhheeccCCceEEEe
Confidence            55444422110                                                                     


Q ss_pred             --------------------------------CCCCCCcee-eeeecceEEEEeecCCCCCCCceeeEEEEEEecCCCCe
Q psy535          245 --------------------------------QPHAPYNIT-GVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDW  291 (460)
Q Consensus       245 --------------------------------~p~~p~~~~-~~~~~~~~~l~w~~~~~~~~~~~~~~~~~~~~~~~~~~  291 (460)
                                                      +|.+|..+. .......+.+.|.+|..++.++ ..|.+.|...+.+.|
T Consensus       488 ~nl~p~t~Y~~rv~A~n~~g~g~sS~pLkV~t~pEgp~~~~a~ats~~ti~v~WepP~~~n~~I-~~yk~~ys~~~~~~~  566 (1381)
T KOG4221|consen  488 QNLSPLTMYFFRVRAKNEAGSGESSAPLKVTTQPEGPVQLQAYATSPTTILVTWEPPPFGNGPI-TGYKLFYSEDDTGKE  566 (1381)
T ss_pred             eecccceeEEEEEeccCcccCCccCCceEEecCCCCCccccccccCcceEEEEecCCCCCCCCc-eEEEEEEEcCCCCce
Confidence                                            121222121 1234567899999988777776 799999988866777


Q ss_pred             eeeeccCCCCceEEEccCccCccEEEEEEEEcCCCCCCCCCcEEEEccCCCCC-CCcceEEEeec-ceEEEEecCCCCC-
Q psy535          292 LPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTKGPKPG-PPRNVSVTEVN-NGFVISWQPPLER-  368 (460)
Q Consensus       292 ~~~~~~~~~~~~~~i~~l~~~~~~~~~~~a~n~~G~~~~s~~~~~~~~~~~P~-~p~~~~~~~~~-~~v~l~W~~~~~~-  368 (460)
                      ..+..   +...++|.+|.+.+.|.|+|+|.|..|.|..|..+.+.+..+.|+ ||.|+++...+ ++|.|+|.+|... 
T Consensus       567 ~~~~~---n~~e~ti~gL~k~TeY~~~vvA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t  643 (1381)
T KOG4221|consen  567 LRVEN---NATEYTINGLEKYTEYSIRVVAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSET  643 (1381)
T ss_pred             EEEec---CccEEEeecCCCccceEEEEEEecCCCCCCCCCceEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCccc
Confidence            76654   678999999999999999999999999999999999999999996 66669998776 6999999998654 


Q ss_pred             -CccceEEEEEEEEcCCeeeeccccCCCCcccccccceecCceeeeeeccCCCCcceEEECCCCcCceEEEEEEEeecCC
Q psy535          369 -ASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELG  447 (460)
Q Consensus       369 -~~~i~~y~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~~~Y~~~v~a~n~~G  447 (460)
                       ++.+.+|+|+|+....                      .....|..+.   .+.+.|.+.+|+|++.|.|||.|.|..|
T Consensus       644 ~ng~itgYkIRy~~~~~----------------------~~~~~~t~v~---~n~~~~l~~~Lep~T~Y~vrIsa~t~nG  698 (1381)
T KOG4221|consen  644 QNGQITGYKIRYRKLSR----------------------EDEVNETVVK---GNTTQYLFNGLEPNTQYRVRISAMTVNG  698 (1381)
T ss_pred             ccceEEEEEEEecccCc----------------------ccccceeecc---cchhhhHhhcCCCCceEEEEEEEeccCC
Confidence             7789999999996543                      1222333332   3677888999999999999999999999


Q ss_pred             CCCCCceeEeecC
Q psy535          448 DGMLSNIVVVKTK  460 (460)
Q Consensus       448 ~s~~s~~~~~~T~  460 (460)
                      .|++|+|+.+.|.
T Consensus       699 tGpaS~w~~aeT~  711 (1381)
T KOG4221|consen  699 TGPASEWVSAETP  711 (1381)
T ss_pred             CCCcccceeccCc
Confidence            9999999999884



>KOG3513|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>PHA03286 envelope glycoprotein E; Provisional Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PHA03283 envelope glycoprotein E; Provisional Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>PF02124 Marek_A: Marek's disease glycoprotein A; InterPro: IPR001038 Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites [] Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>PRK14081 triple tyrosine motif-containing protein; Provisional Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PHA03282 envelope glycoprotein E; Provisional Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>COG5475 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF02010 REJ: REJ domain; InterPro: IPR002859 The REJ (Receptor for Egg Jelly) domain is found in PKD1 P98161 from SWISSPROT and the sperm receptor for egg jelly Q26627 from SWISSPROT Back     alignment and domain information
>PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query460
3laf_A403 Structure Of Dcc, A Netrin-1 Receptor Length = 403 1e-18
3b43_A570 I-band Fragment I65-i70 From Titin Length = 570 1e-13
3dmk_A816 Crystal Structure Of Down Syndrome Cell Adhesion Mo 4e-12
2om5_A381 N-Terminal Fragment Of Human Tax1 Length = 381 2e-10
2jll_A389 Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 8e-10
2iep_A192 Crystal Structure Of Immunoglobulin-Like Domains 1 2e-09
2iep_A192 Crystal Structure Of Immunoglobulin-Like Domains 1 1e-07
2rjm_A284 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat 3e-09
2rjm_A284 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat 3e-06
2rik_A284 I-Band Fragment I67-I69 From Titin Length = 284 5e-09
2rik_A284 I-Band Fragment I67-I69 From Titin Length = 284 2e-06
3jxa_A383 Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 5e-09
3kld_A384 Ptprg Cntn4 Complex Length = 384 5e-09
2xyc_A291 Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 4e-08
2xyc_A291 Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 8e-08
2wim_A291 Crystal Structure Of Ncam2 Ig1-3 Length = 291 4e-08
1cs6_A382 N-terminal Fragment Of Axonin-1 From Chicken Length 2e-07
1e07_A642 Model Of Human Carcinoembryonic Antigen By Homology 4e-07
2vra_A208 Drosophila Robo Ig1-2 (Monoclinic Form) Length = 20 7e-07
2vr9_A217 Drosophila Robo Ig1-2 (Tetragonal Form) Length = 21 7e-07
2v9q_A212 First And Second Ig Domains From Human Robo1 Length 8e-07
2yd9_A304 Crystal Structure Of The N-Terminal Ig1-3 Module Of 9e-07
3v2a_R772 Vegfr-2VEGF-A Complex Structure Length = 772 1e-06
1qz1_A291 Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam 1e-06
2v5r_A391 Structural Basis For Dscam Isoform Specificity Leng 2e-06
2v5m_A388 Structural Basis For Dscam Isoform Specificity Leng 2e-06
2v5s_A394 Structural Basis For Dscam Isoform Specificity Leng 2e-06
3pxj_A210 Tandem Ig Repeats Of Dlar Length = 210 8e-06
2yd1_A212 Crystal Structure Of The N-Terminal Ig1-2 Module Of 1e-05
1bih_A395 Crystal Structure Of The Insect Immune Protein Hemo 1e-05
3o4o_C339 Crystal Structure Of An Interleukin-1 Receptor Comp 5e-05
3lpw_A197 Crystal Structure Of The Fniii-Tandem A77-A78 From 7e-05
3p3y_A404 Crystal Structure Of Neurofascin Homophilic Adhesio 1e-04
2ed7_A119 Solution Structure Of The First Fibronectin Type Ii 2e-04
2ed7_A119 Solution Structure Of The First Fibronectin Type Ii 3e-04
2yd5_A214 Crystal Structure Of The N-Terminal Ig1-2 Module Of 3e-04
2yd5_A214 Crystal Structure Of The N-Terminal Ig1-2 Module Of 4e-04
2xy1_A192 Crystal Structure Of Ncam2 Ig3-4 Length = 192 4e-04
3pxh_A201 Tandem Ig Domains Of Tyrosine Phosphatase Lar Lengt 5e-04
>pdb|3LAF|A Chain A, Structure Of Dcc, A Netrin-1 Receptor Length = 403 Back     alignment and structure

Iteration: 1

Score = 91.3 bits (225), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 67/246 (27%), Positives = 112/246 (45%), Gaps = 27/246 (10%) Query: 9 ETRVVIKKDGTLVINPVGSDDSGLYMCEVSNGIGEPQAAQAYLNVEFPAKVTFTPTVQYL 68 ++RVV+ G L I+ + DSG+Y C N A E ++ P + Sbjct: 168 DSRVVVLPSGALQISRLQPGDSGVYRCSARN------PASTRTGNEAEVRILSDPGLHRQ 221 Query: 69 PFRLQ------------GVVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIVVMQNGSLLF 116 + LQ V++C + P + TW + + +++ ++K ++ +LL Sbjct: 222 LYFLQRPSNVIAIEGKDAVLECCVSGYPPPSF-TWLRGEEVIQ-LRSKKYSLLGGSNLLI 279 Query: 117 TRVNQNHQGRYTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEA 176 + V + G YTC + +S ++ VLV PP F P +Y ES+D+ E Sbjct: 280 SNVTDDDSGTYTCVVTYKNENISASAELTVLV--PPWFLNHPSNLYAY---ESMDIEFEC 334 Query: 177 QEAEGTQKPTITWQRRDGVALPKNRVKIVGG-NITIEGLRRVDFGYYECVVSNEVATIVQ 235 G PT+ W + V +P + +IVGG N+ I G+ + D G+Y+CV NE Sbjct: 335 A-VSGKPVPTVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQS 393 Query: 236 AAQLVV 241 +AQL+V Sbjct: 394 SAQLIV 399
>pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 Back     alignment and structure
>pdb|3DMK|A Chain A, Crystal Structure Of Down Syndrome Cell Adhesion Molecule (Dscam) Isoform 1.30.30, N-Terminal Eight Ig Domains Length = 816 Back     alignment and structure
>pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 Back     alignment and structure
>pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 Back     alignment and structure
>pdb|2IEP|A Chain A, Crystal Structure Of Immunoglobulin-Like Domains 1 And 2 Of The Receptor Tyrosine Kinase Musk Length = 192 Back     alignment and structure
>pdb|2IEP|A Chain A, Crystal Structure Of Immunoglobulin-Like Domains 1 And 2 Of The Receptor Tyrosine Kinase Musk Length = 192 Back     alignment and structure
>pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 Back     alignment and structure
>pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 Back     alignment and structure
>pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 Back     alignment and structure
>pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 Back     alignment and structure
>pdb|3JXA|A Chain A, Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 383 Back     alignment and structure
>pdb|3KLD|A Chain A, Ptprg Cntn4 Complex Length = 384 Back     alignment and structure
>pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 Back     alignment and structure
>pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 Back     alignment and structure
>pdb|2WIM|A Chain A, Crystal Structure Of Ncam2 Ig1-3 Length = 291 Back     alignment and structure
>pdb|1CS6|A Chain A, N-terminal Fragment Of Axonin-1 From Chicken Length = 382 Back     alignment and structure
>pdb|1E07|A Chain A, Model Of Human Carcinoembryonic Antigen By Homology Modelling And Curve-Fitting To Experimental Solution Scattering Data Length = 642 Back     alignment and structure
>pdb|2VRA|A Chain A, Drosophila Robo Ig1-2 (Monoclinic Form) Length = 208 Back     alignment and structure
>pdb|2VR9|A Chain A, Drosophila Robo Ig1-2 (Tetragonal Form) Length = 217 Back     alignment and structure
>pdb|2V9Q|A Chain A, First And Second Ig Domains From Human Robo1 Length = 212 Back     alignment and structure
>pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 Back     alignment and structure
>pdb|3V2A|R Chain R, Vegfr-2VEGF-A Complex Structure Length = 772 Back     alignment and structure
>pdb|1QZ1|A Chain A, Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam Length = 291 Back     alignment and structure
>pdb|2V5R|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 391 Back     alignment and structure
>pdb|2V5M|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 388 Back     alignment and structure
>pdb|2V5S|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 394 Back     alignment and structure
>pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 Back     alignment and structure
>pdb|2YD1|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Drosophila Receptor Protein Tyrosine Phosphatase Dlar Length = 212 Back     alignment and structure
>pdb|1BIH|A Chain A, Crystal Structure Of The Insect Immune Protein Hemolin: A New Domain Arrangement With Implications For Homophilic Adhesion Length = 395 Back     alignment and structure
>pdb|3O4O|C Chain C, Crystal Structure Of An Interleukin-1 Receptor Complex Length = 339 Back     alignment and structure
>pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 Back     alignment and structure
>pdb|3P3Y|A Chain A, Crystal Structure Of Neurofascin Homophilic Adhesion Complex In Space Group P6522 Length = 404 Back     alignment and structure
>pdb|2ED7|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 119 Back     alignment and structure
>pdb|2ED7|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 119 Back     alignment and structure
>pdb|2YD5|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Lar Length = 214 Back     alignment and structure
>pdb|2YD5|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Lar Length = 214 Back     alignment and structure
>pdb|2XY1|A Chain A, Crystal Structure Of Ncam2 Ig3-4 Length = 192 Back     alignment and structure
>pdb|3PXH|A Chain A, Tandem Ig Domains Of Tyrosine Phosphatase Lar Length = 201 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query460
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 8e-74
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-33
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-29
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-55
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-36
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 4e-23
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 8e-22
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 4e-50
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-30
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 4e-23
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-46
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 3e-31
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-16
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-45
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 9e-37
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-21
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-20
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 1e-45
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 8e-10
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-45
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-34
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 3e-22
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-19
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-43
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-35
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-29
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-21
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 8e-21
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-43
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 5e-26
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 6e-22
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-10
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-42
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 5e-42
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-37
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 4e-36
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-33
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-25
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 5e-20
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 9e-20
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 3e-42
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 3e-32
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 4e-21
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-20
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 4e-06
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 6e-42
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 6e-29
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 3e-13
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 4e-41
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 6e-23
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 9e-41
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 4e-29
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-25
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 4e-18
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 4e-17
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 3e-40
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 4e-21
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 2e-19
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-38
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-38
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-37
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-36
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 7e-25
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-19
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-38
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 8e-31
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-17
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 6e-13
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-36
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-24
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-21
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-17
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 8e-36
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 2e-14
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 1e-05
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-35
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-15
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-35
2vkw_A 209 Neural cell adhesion molecule 1,140 kDa isoform; a 1e-12
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 4e-12
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 5e-35
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 6e-31
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 6e-28
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 4e-16
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 8e-35
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 3e-11
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 4e-34
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 3e-30
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 8e-27
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 1e-25
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 3e-33
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 2e-16
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 3e-13
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 6e-04
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 6e-33
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-20
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-11
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 2e-07
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-32
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-20
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 7e-19
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-04
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 1e-32
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 4e-16
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 3e-32
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 5e-31
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 1e-30
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 4e-30
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 9e-27
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 2e-21
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 4e-05
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 6e-32
1i1r_A 303 GP130, interleukin-6 receptor beta chain; cytokine 7e-06
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-31
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-14
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-06
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-31
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 6e-15
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-31
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 3e-31
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 2e-19
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 2e-18
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 4e-31
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 1e-11
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 6e-31
3f7q_A 234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 1e-10
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 3e-10
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 1e-30
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 3e-17
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 6e-14
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-10
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 7e-05
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 7e-30
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 2e-22
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 1e-18
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 8e-30
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 5e-21
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 4e-12
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 5e-29
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 8e-16
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-08
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 5e-29
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 2e-21
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 3e-15
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 9e-11
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 4e-04
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 5e-29
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 2e-13
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 2e-06
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 1e-28
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 3e-22
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 2e-04
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-28
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-20
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-09
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 7e-28
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 1e-19
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 8e-11
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 7e-28
3e0g_A 483 Leukemia inhibitory factor receptor; IG domain, cy 6e-07
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 2e-27
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 6e-19
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 2e-12
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 3e-27
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 2e-16
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 5e-05
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 3e-27
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-25
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 3e-09
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 6e-27
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 3e-18
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 3e-11
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 8e-27
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 1e-12
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 1e-26
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 7e-17
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 1e-13
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 2e-10
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 5e-26
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 2e-23
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 1e-10
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 6e-26
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-24
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-12
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 6e-11
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 9e-26
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 3e-22
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 7e-12
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 4e-25
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 8e-10
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 1e-24
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 5e-20
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 6e-08
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 2e-24
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 1e-17
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 2e-13
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 3e-24
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 3e-23
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 4e-24
2ha1_A 201 Fibronectin; beta sandwich, protein-protein comple 9e-08
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 4e-24
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-23
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-22
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-08
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 6e-24
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 2e-10
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 7e-24
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 2e-19
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 5e-11
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 1e-23
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 6e-17
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 2e-10
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 1e-23
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 2e-17
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-23
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-22
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 3e-23
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 5e-22
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 3e-21
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 4e-09
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 1e-06
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 5e-23
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 4e-18
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 5e-12
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-22
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 5e-21
1tdq_A 283 Tenascin-R; extracellular matrix, lecticans, tenas 3e-09
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 2e-22
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 1e-16
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 2e-22
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 4e-18
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 3e-14
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 2e-22
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 3e-18
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 1e-17
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 6e-08
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 4e-05
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 3e-22
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 6e-16
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 2e-11
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 6e-22
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 2e-18
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 9e-11
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 1e-21
2q7n_A 488 Leukemia inhibitory factor receptor; cytokine cell 5e-04
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 1e-21
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 8e-19
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 5e-07
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 1e-21
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 4e-20
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 6e-16
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 1e-21
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 8e-19
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-21
3mjg_X289 Beta-type platelet-derived growth factor receptor; 1e-13
3mjg_X289 Beta-type platelet-derived growth factor receptor; 3e-12
3mjg_X289 Beta-type platelet-derived growth factor receptor; 3e-04
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 4e-21
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 2e-16
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 5e-07
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 6e-21
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 2e-08
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 6e-21
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-18
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 1e-13
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 5e-06
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 4e-20
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 5e-13
1gl4_B98 Basement membrane-specific heparan sulfate proteog 6e-20
1gl4_B98 Basement membrane-specific heparan sulfate proteog 6e-06
1gl4_B98 Basement membrane-specific heparan sulfate proteog 8e-05
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 7e-20
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 8e-20
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 7e-20
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 3e-17
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 3e-19
3bpo_C 314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 3e-08
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 4e-19
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 7e-16
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 2e-05
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 6e-04
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 5e-19
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 4e-06
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 6e-19
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-15
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 9e-08
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-05
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 6e-19
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 9e-16
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 4e-06
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 1e-18
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 7e-15
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-18
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 2e-15
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-05
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 3e-05
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 1e-18
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 2e-15
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 2e-18
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 2e-12
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 6e-07
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 3e-18
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 9e-06
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 4e-18
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 5e-18
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 2e-13
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 5e-04
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 6e-18
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 8e-18
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 4e-12
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 2e-17
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 2e-11
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 8e-10
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 4e-17
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 6e-14
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 3e-05
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 5e-17
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 3e-14
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 7e-08
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 5e-17
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 2e-12
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 7e-17
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 1e-15
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 4e-14
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 1e-12
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 9e-12
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 1e-16
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 1e-16
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 4e-13
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 1e-16
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 4e-13
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-16
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-12
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 2e-16
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 4e-08
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 2e-16
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 1e-09
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 4e-16
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 1e-14
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 5e-16
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 3e-12
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 6e-16
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 1e-10
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 9e-06
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 7e-16
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 1e-15
1x3d_A118 Fibronectin type-III domain containing protein 3A; 1e-15
1x3d_A118 Fibronectin type-III domain containing protein 3A; 3e-14
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 1e-15
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 2e-12
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 1e-15
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 5e-15
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 6e-04
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 1e-15
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 1e-08
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 5e-06
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 2e-15
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 2e-13
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 2e-15
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 3e-15
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 4e-12
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 4e-15
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 9e-15
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 4e-15
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-13
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 5e-15
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 8e-05
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 5e-15
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 5e-06
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 3e-05
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 6e-15
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 8e-13
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 7e-15
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 2e-10
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 7e-09
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 7e-15
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 2e-12
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 3e-05
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 2e-04
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 7e-15
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 2e-13
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 7e-15
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 6e-12
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 7e-15
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 3e-12
1x5x_A109 Fibronectin type-III domain containing protein 3A; 7e-15
1x5x_A109 Fibronectin type-III domain containing protein 3A; 4e-12
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 8e-15
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 5e-14
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 1e-14
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 8e-14
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 1e-14
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 5e-13
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 2e-11
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 5e-07
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 1e-14
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 4e-12
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 1e-14
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-13
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 1e-14
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 5e-09
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 6e-08
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-14
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-11
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 2e-14
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 3e-05
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 2e-14
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 5e-06
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 2e-14
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 1e-06
2erj_C247 Cytokine receptor common gamma chain; immune syste 2e-14
2erj_C247 Cytokine receptor common gamma chain; immune syste 3e-07
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 2e-14
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 3e-12
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 6e-12
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 1e-05
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 4e-14
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 4e-09
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 4e-14
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 1e-13
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 4e-14
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 6e-05
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 4e-14
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 2e-12
2fbo_J250 V1V2;, variable region-containing chitin-binding p 5e-14
2fbo_J250 V1V2;, variable region-containing chitin-binding p 7e-12
2fbo_J250 V1V2;, variable region-containing chitin-binding p 6e-07
2fbo_J250 V1V2;, variable region-containing chitin-binding p 1e-05
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 6e-14
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 8e-14
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 1e-10
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 1e-13
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 2e-05
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 6e-04
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 1e-13
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 1e-08
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 1e-13
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 5e-11
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 1e-13
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 4e-07
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 9e-05
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 2e-13
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 2e-12
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 3e-13
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 2e-09
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 2e-05
1x4x_A106 Fibronectin type-III domain containing protein 3A; 3e-13
1x4x_A106 Fibronectin type-III domain containing protein 3A; 4e-13
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 3e-13
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 7e-09
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 3e-13
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 2e-06
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 1e-05
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 4e-13
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 2e-07
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 5e-05
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 4e-13
3s98_A 306 Interferon alpha/beta receptor 1; human, type I in 1e-11
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 4e-13
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 6e-06
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 4e-05
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 5e-13
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 8e-13
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 5e-13
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 9e-12
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 5e-13
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 1e-04
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 5e-13
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 1e-12
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 5e-13
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 1e-06
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 2e-05
2crm_A120 Fibronectin type-III domain containing protein 3A; 6e-13
2crm_A120 Fibronectin type-III domain containing protein 3A; 1e-10
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 6e-13
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 3e-10
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 2e-06
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 8e-13
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 2e-05
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 4e-04
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 8e-13
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 3e-11
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 1e-12
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 7e-07
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 7e-06
2crz_A110 Fibronectin type-III domain containing protein 3A; 1e-12
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-09
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 2e-12
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 4e-12
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 2e-12
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 2e-07
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 7e-06
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 4e-12
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 4e-04
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 4e-12
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 9e-11
3t04_D103 Monobody 7C12; engineered binding protein, antibod 5e-12
3t04_D103 Monobody 7C12; engineered binding protein, antibod 2e-10
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 6e-12
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 4e-10
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 9e-12
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 1e-10
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 9e-12
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 4e-06
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 1e-05
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 1e-11
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 2e-10
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 1e-07
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 1e-11
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 4e-11
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 1e-11
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 1e-10
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 5e-04
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-11
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-07
3k2m_C101 Monobody HA4; engineered binding protein, antibody 2e-11
3k2m_C101 Monobody HA4; engineered binding protein, antibody 6e-11
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 2e-11
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 1e-06
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 3e-05
2gys_A419 Cytokine receptor common beta chain; dimer of inte 2e-11
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 6e-10
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 9e-10
2gys_A419 Cytokine receptor common beta chain; dimer of inte 1e-06
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 2e-11
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 3e-07
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 2e-05
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 2e-11
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 3e-10
2ens_A96 Advanced glycosylation END product-specific recept 2e-11
2ens_A96 Advanced glycosylation END product-specific recept 3e-08
2ens_A96 Advanced glycosylation END product-specific recept 6e-06
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 3e-11
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 3e-11
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 6e-08
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 9e-05
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 3e-11
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 3e-11
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 8e-07
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 3e-05
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 4e-11
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 6e-07
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 5e-11
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 7e-04
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 7e-11
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 3e-06
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 1e-05
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 7e-11
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 1e-07
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 9e-11
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 1e-06
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 9e-11
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 6e-09
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 1e-10
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 4e-07
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 2e-05
2v9t_A117 Roundabout homolog 1; structural protein-receptor 1e-10
2v9t_A117 Roundabout homolog 1; structural protein-receptor 5e-07
2v9t_A117 Roundabout homolog 1; structural protein-receptor 1e-06
1eer_B227 Epobp, erythropoietin receptor; signal transductio 1e-10
1eer_B227 Epobp, erythropoietin receptor; signal transductio 2e-05
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 2e-10
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 2e-07
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 2e-10
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 2e-07
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 6e-06
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 2e-10
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 7e-09
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 3e-10
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 2e-07
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 4e-10
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 8e-09
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 5e-10
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 7e-10
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 8e-10
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 4e-09
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 9e-10
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 4e-05
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 9e-10
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 2e-06
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 1e-04
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-09
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-09
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 2e-09
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 5e-05
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 2e-09
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 7e-04
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 8e-04
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 2e-09
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 3e-04
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 2e-09
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 3e-09
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 2e-09
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 5e-09
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 3e-09
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 6e-06
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 1e-04
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 3e-09
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 3e-09
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 7e-07
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 4e-09
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 3e-08
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 5e-09
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-08
1wwb_X103 Protein (brain derived neurotrophic factor recepto 6e-09
1wwb_X103 Protein (brain derived neurotrophic factor recepto 1e-06
1wwb_X103 Protein (brain derived neurotrophic factor recepto 8e-04
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 6e-09
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 7e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-05
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 7e-09
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 8e-04
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 8e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 8e-09
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 3e-08
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 7e-04
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 9e-09
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 9e-09
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 6e-06
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 4e-04
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 1e-08
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 1e-07
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 1e-08
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 2e-07
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 1e-08
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-08
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 1e-08
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 1e-06
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 2e-08
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 2e-07
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 2e-08
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-08
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-08
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 2e-08
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 7e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 5e-08
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 4e-06
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 2e-05
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 5e-08
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-06
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 5e-08
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-05
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 9e-04
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 5e-08
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 4e-06
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 5e-05
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 5e-08
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 1e-04
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 2e-04
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 5e-08
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 6e-08
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 8e-08
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 4e-06
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 9e-08
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 2e-04
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 1e-07
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 4e-06
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 1e-07
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 6e-04
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-07
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 2e-07
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 3e-06
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 2e-04
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 2e-07
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 5e-07
3s35_X122 Vascular endothelial growth factor receptor 2; ant 4e-07
3s35_X122 Vascular endothelial growth factor receptor 2; ant 1e-05
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 4e-07
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 2e-04
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 3e-04
1waa_A93 Titin; metal binding protein, calmodulin-binding, 6e-07
1waa_A93 Titin; metal binding protein, calmodulin-binding, 3e-04
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 6e-07
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 5e-05
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 1e-04
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 6e-07
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 6e-07
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 6e-07
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 7e-04
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 7e-07
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 8e-07
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 2e-04
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 1e-06
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 4e-04
3eow_R221 Poliovirus receptor; immunoglobulin super family, 1e-06
3eow_R221 Poliovirus receptor; immunoglobulin super family, 1e-04
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 1e-06
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 2e-06
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 4e-05
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 9e-04
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 2e-06
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 2e-06
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 3e-06
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 1e-05
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 3e-06
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 5e-04
1he7_A126 High affinity nerve growth factor receptor; transf 3e-06
1he7_A126 High affinity nerve growth factor receptor; transf 3e-06
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 3e-06
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 4e-04
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 5e-06
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 5e-06
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 8e-06
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 7e-05
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 1e-05
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 3e-05
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 1e-05
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 2e-05
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 1e-04
1olz_A663 Semaphorin 4D; developmental protein, CD100, beta- 2e-05
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 2e-05
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 2e-05
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 4e-05
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 7e-05
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 4e-05
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 1e-04
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 5e-05
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 9e-05
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 2e-04
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 2e-04
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 2e-04
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 3e-04
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 3e-04
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 3e-04
3bn3_B196 ICAM-5, intercellular adhesion molecule 5, telence 5e-04
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 7e-04
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
 Score =  236 bits (603), Expect = 8e-74
 Identities = 75/392 (19%), Positives = 133/392 (33%), Gaps = 52/392 (13%)

Query: 75  VVQCHIKANPTFQYVTWTKDKRLLEPYQTKDIV--------VMQNGSLLFTRVNQNHQGR 126
            + C  +  P  + +TW +        +    +           + SL    V  +  GR
Sbjct: 19  TLVCDAEGEPIPE-ITWKRAVDGFTFTEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSGR 77

Query: 127 YTCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQKPT 186
           Y C   +  G    S  +++     P F       Y    G  +++ C+ +        +
Sbjct: 78  YDCEAASRIGGHQKSMYLDIEY--APKFISNQTIYY-SWEGNPINISCDVK---SNPPAS 131

Query: 187 ITWQRRDGVALPKN---RVKIVG----GNITIEGLRRVDFGYYECVVSNEVATIVQAAQL 239
           I W RRD + LP      +K         + I      DFG Y C  +N + T  Q   L
Sbjct: 132 IHW-RRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYIL 190

Query: 240 VVEGTQPHAPYNIT-GVATEFSVTLEWLPGYSGGPDLKQNYVIWYREQGNKDWLPIPVTP 298
            +    P +PY +     ++ +  + +    S G     +Y +  +E  ++ W  +  + 
Sbjct: 191 ALADV-PSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVR-SH 248

Query: 299 PGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTKGPKPGPPRNVSVTEVN-NG 357
              T + +N L P TTYE +V   N  G G  S I + +T   +   P ++     +   
Sbjct: 249 GVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKS 308

Query: 358 FVISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYLGEYREQGNKDWLPIPV 417
           F +S     +  + I  Y++                         +YR +  +D      
Sbjct: 309 FKLSITKQDDGGAPILEYIV-------------------------KYRSKDKEDQWLEKK 343

Query: 418 TPPGSTQITINRLTPATTYEFQVVGKNELGDG 449
                  I +  L     YE Q+   N LG  
Sbjct: 344 VQGNKDHIILEHLQWTMGYEVQITAANRLGYS 375


>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 242 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 188 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Length = 316 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Length = 316 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 257 Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Length = 184 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Length = 196 Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Length = 196 Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Length = 196 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 Back     alignment and structure
>1olz_A Semaphorin 4D; developmental protein, CD100, beta-propeller, PSI domain, IG-like domain, extracellular receptor, neurogenesis; 2.0A {Homo sapiens} SCOP: b.1.1.4 b.69.12.1 g.16.2.1 PDB: 3ol2_A* Length = 663 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Length = 139 Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Length = 226 Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Length = 117 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Length = 198 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Length = 196 Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query460
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 100.0
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 100.0
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 100.0
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 100.0
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 100.0
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 100.0
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 100.0
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 100.0
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 100.0
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 100.0
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 100.0
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 100.0
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 100.0
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 100.0
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 100.0
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 100.0
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 100.0
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 100.0
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 100.0
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.98
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 99.98
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.98
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.98
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.97
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.97
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.97
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.97
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.97
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.97
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.97
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.97
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.97
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.97
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.97
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.97
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.97
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.96
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.96
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.96
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.96
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.96
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.96
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.96
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.96
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.96
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.96
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.96
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 99.96
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.96
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.96
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.95
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.95
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.95
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.95
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.95
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.95
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.95
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.95
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.95
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.95
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 99.95
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.95
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.95
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.94
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.94
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.94
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.94
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.94
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.94
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.94
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.94
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.93
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.93
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.93
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.93
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.93
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.93
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.93
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.93
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.92
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.92
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.92
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.92
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.92
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.92
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.92
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.92
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.92
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.92
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.92
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.92
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.91
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.91
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.91
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.91
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.91
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.91
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.91
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.91
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.91
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.91
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.91
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.91
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.9
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.9
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.9
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.9
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.9
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.9
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.9
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.9
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.9
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.89
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.89
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.89
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.89
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.89
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.89
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.89
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.88
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.88
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.88
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.88
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.88
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.88
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.88
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.88
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.88
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.88
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.88
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.88
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.88
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.88
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.87
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.87
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.87
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.87
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.87
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.87
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.87
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.87
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.87
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.87
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.87
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.87
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.87
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.86
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.86
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.86
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.85
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.85
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.85
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.85
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.85
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.85
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.85
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.85
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.85
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.85
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.85
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.85
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.84
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 99.84
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.84
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.84
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.84
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.83
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 99.83
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.83
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.83
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.83
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.83
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.83
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.83
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.82
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.82
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.82
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.82
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.82
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.82
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.82
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.81
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.81
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.81
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.81
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.81
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.81
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.81
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.81
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.81
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.81
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.81
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.81
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.81
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.8
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.8
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.8
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.8
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.8
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.79
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.79
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.79
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.79
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.79
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.79
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.79
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.79
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.79
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.79
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.78
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.78
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.78
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.78
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.78
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.77
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.77
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.77
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.77
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.77
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.77
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.77
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.77
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.77
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.77
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.77
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.77
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.77
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.76
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.76
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.76
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.76
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.76
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.76
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.76
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.76
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.76
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.76
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.75
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.75
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.75
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.75
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.75
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.75
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.75
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.75
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.75
3umt_A256 SCFV heavy chain and light chain; stability engine 99.75
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.75
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.75
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.74
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.74
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.74
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.74
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.74
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.74
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.74
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.74
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.74
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.74
3sob_L237 Antibody light chain; beta propeller, protein bind 99.74
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.74
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.73
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.73
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.73
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.73
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.73
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.73
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.73
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.73
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.73
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.73
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.73
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.73
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.73
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.73
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.73
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.73
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.72
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.72
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.72
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.72
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.72
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.72
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.72
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.72
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.72
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.72
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.72
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.72
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.72
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.72
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.71
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.71
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.71
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.71
3s98_A 306 Interferon alpha/beta receptor 1; human, type I in 99.71
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.71
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.71
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.71
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.71
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.71
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.71
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.7
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.7
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.7
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.7
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.7
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.7
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.7
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.7
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.7
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.7
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.7
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.7
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.69
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.69
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.69
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 99.69
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.69
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.69
3sob_L237 Antibody light chain; beta propeller, protein bind 99.69
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.69
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.69
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.69
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.69
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.69
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.68
3umt_A256 SCFV heavy chain and light chain; stability engine 99.68
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.68
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.68
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.68
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.68
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.68
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.68
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.68
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.68
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.68
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.68
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.67
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.67
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.67
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.67
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.67
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.67
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.67
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.67
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.67
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 99.67
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.67
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.67
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.67
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.67
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.66
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.66
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 99.66
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.66
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.66
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.66
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.66
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.66
4acp_A240 IG gamma-1 chain C region; immune system, antibody 99.66
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.66
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.66
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.65
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.65
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.65
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.65
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.65
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.65
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.65
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.65
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.65
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.65
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.65
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.65
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.65
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.65
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.65
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.64
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.64
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 99.64
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.64
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.64
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.64
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.64
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.64
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.64
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.64
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.63
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.63
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.63
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.63
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.63
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 99.63
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.63
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.63
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.63
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 99.63
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.63
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.62
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.62
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.62
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.62
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.62
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.62
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.62
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.62
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.62
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.62
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.62
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.61
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.61
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.61
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.61
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.61
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 99.61
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.6
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.6
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.6
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.6
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.6
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.6
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.59
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.59
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.59
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.59
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.59
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.59
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.58
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 99.58
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.58
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.58
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.58
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.58
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.58
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.58
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.57
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.57
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.57
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.57
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.57
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.57
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.57
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.57
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.56
1ypz_F230 T-cell receptor gamma chain, beta-2-microglobulin; 99.56
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.56
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.56
1bec_A238 14.3.D T cell antigen receptor; T cell receptor; 1 99.56
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.55
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.55
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.55
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.55
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.55
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 99.55
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.54
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.54
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.54
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.54
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.54
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.54
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.54
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.54
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.54
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.53
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.53
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.53
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.53
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.53
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.52
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.52
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.52
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.52
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.52
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.52
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.52
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.52
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.51
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 99.51
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.51
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.51
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.51
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.51
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.51
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 99.51
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.51
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.51
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 99.51
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.5
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.5
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.5
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.5
1oga_E252 TRBC1, T-cell receptor beta chain C region; immune 99.49
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.49
3n9g_H230 FAB fragment of MAB CR4354, heavy chain; human neu 99.49
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 99.49
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 99.48
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
Probab=100.00  E-value=1.8e-46  Score=344.00  Aligned_cols=368  Identities=21%  Similarity=0.321  Sum_probs=281.2

Q ss_pred             CCeeEEcceeeeecceeeEEEEEEEecCCCCCeEEEeeC--CeecCccc---cccEEEee---cCeEEEeecCCCCCeEE
Q psy535           56 PAKVTFTPTVQYLPFRLQGVVQCHIKANPTFQYVTWTKD--KRLLEPYQ---TKDIVVMQ---NGSLLFTRVNQNHQGRY  127 (460)
Q Consensus        56 ~p~~~~~~~~~~~~~g~~~~l~C~~~~~~~~~~v~W~~~--~~~~~~~~---~~~~~~~~---~~~l~i~~~~~~d~G~y  127 (460)
                      +|.+.. +....+.+|+++.|.|.+.|.|.+ .|+|+|+  |..+....   ..++.+..   .+.|.|.++..+|+|.|
T Consensus         1 ~P~i~~-~~~~~~~~G~~v~l~C~~~g~p~p-~v~W~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Y   78 (389)
T 2jll_A            1 QPHIIQ-LKNETTYENGQVTLVCDAEGEPIP-EITWKRAVDGFTFTEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRY   78 (389)
T ss_dssp             CCEEEE-CCCEEEETTSEEEEEEEEECSSCC-EEEEEETTTTEEECC--CCSSSSEEEEECSSEEEEEEESCCGGGCEEE
T ss_pred             CCeEEe-cCceEEeCCCeEEEEEEeecccCC-eEEEEeCCCCceeccCcCCCCCeEEEeccCCcceEEEcccChhhCEEE
Confidence            355554 445667779999999999998866 7999999  88775321   34454443   34799999999999999


Q ss_pred             EEEEEcCCCCcceeeEEEEEeeCCCceeeCCCcccccCCCCeEEEEeeeeccCCCCCCeeEEEcCCCccCCc--ccEEEe
Q psy535          128 TCTPYNAHGTQGSSGQMEVLVRKPPAFTIKPEAMYQRKVGESVDMHCEAQEAEGTQKPTITWQRRDGVALPK--NRVKIV  205 (460)
Q Consensus       128 ~C~~~~~~g~~~~~~~~~v~v~~~p~~~~~~~~~~~~~~g~~~~l~C~~~~~~~~p~~~~~W~~~~~~~~~~--~~~~~~  205 (460)
                      +|.|.|..|..  +..+.|.|..+|.+...+.. ..+..|+.+.|.|.+   .+.|.+.+.|++++..+...  .++...
T Consensus        79 ~C~a~n~~g~~--~~~~~l~V~~~P~~~~~~~~-~~~~~g~~~~l~C~~---~g~p~~~i~W~~~g~~l~~~~~~~~~~~  152 (389)
T 2jll_A           79 DCEAASRIGGH--QKSMYLDIEYAPKFISNQTI-YYSWEGNPINISCDV---KSNPPASIHWRRDKLVLPAKNTTNLKTY  152 (389)
T ss_dssp             EEEEECSSCEE--EEEEEEEEEEEEEECCSCCE-EEECTTCCEEEEECE---EEESCCEEEEEETTEESSCTTCTTEEEE
T ss_pred             EEEEEeCCCCc--ceEEEEEEEeCCEEecCcce-EEeccCCEEEEEEEE---EecCCCeEEEEECCccCCcccCceEEEe
Confidence            99999998875  45566666778877665443 257889999999999   68899999999954433222  234332


Q ss_pred             ----cceEEEccccceeceEEEEEEecccceeeeeeEEEEecCCCCCCCceee-eeecceEEEEeecCCCCCCCceeeEE
Q psy535          206 ----GGNITIEGLRRVDFGYYECVVSNEVATIVQAAQLVVEGTQPHAPYNITG-VATEFSVTLEWLPGYSGGPDLKQNYV  280 (460)
Q Consensus       206 ----~~~l~i~~~~~~~~g~y~C~a~n~~g~~~~~~~l~v~~~~p~~p~~~~~-~~~~~~~~l~w~~~~~~~~~~~~~~~  280 (460)
                          ...|.|.++...|.|.|+|.|.|..|.......+.+.. +|.+|..+.. ......+.|.|.++...++.++..|.
T Consensus       153 ~~~~~~~L~i~~~~~~d~G~Y~C~a~N~~G~~~~~~~l~v~~-~P~~P~~~~~~~~~~~~~~l~w~~p~~~~g~pi~~y~  231 (389)
T 2jll_A          153 STGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALAD-VPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQ  231 (389)
T ss_dssp             ECSSCEEEEECCCSTTSSEEEEEEEEETTEEEEEEEEEEECC-CCCCCEEEEEEEECSSCEEEEEECCSCCTTSCEEEEE
T ss_pred             ccCCEEEEEECCCChhhCEEEEEEEEcCCCcEEEEEEEEecC-CCCCCcceEEeeccCCEEEEEEeCCCCCCCcceEEEE
Confidence                23699999999999999999999999988887777754 5666755543 44567899999987666666667899


Q ss_pred             EEEEecCCCCeeeeeccCCCCceEEEccCccCccEEEEEEEEcCCCCCCCCCcEEEEccCC-CCCCCcceEEEeec-ceE
Q psy535          281 IWYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTKGP-KPGPPRNVSVTEVN-NGF  358 (460)
Q Consensus       281 ~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~~~~~~~~~a~n~~G~~~~s~~~~~~~~~~-~P~~p~~~~~~~~~-~~v  358 (460)
                      +.|+..+...|....... ....+.|.+|.+++.|.|+|.|.|..|.+..+..+.+.+... +|.+|. +.....+ +++
T Consensus       232 v~~~~~~~~~~~~~~~~~-~~~~~~i~~l~~~~~y~~~v~A~N~~G~~~~s~~~~~~t~~~~~p~~p~-~~~~~~~~~~v  309 (389)
T 2jll_A          232 VDVKEVASEIWKIVRSHG-VQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPS-IHGQPSSGKSF  309 (389)
T ss_dssp             EEEEETTCSCCEEEECST-TCSEEEECSCCTTCEEEEEEEEEESSCBCCCCCCEEEECCCCCCCCCCC-EEEEEETTTEE
T ss_pred             EEEEECCCcccEEeeccC-CcceEEECCccCCCEEEEEEEEEcCCccCCCCcceEEEecCCCCCCCCc-cccccCcCCEE
Confidence            999888777777654432 557899999999999999999999999999999888887665 566775 5554444 699


Q ss_pred             EEEecCCCCCCccceEEEEEEEEcCCeeeeccccCCCCcccccccceecCceeeeeeccCCCCcceEEECCCCcCceEEE
Q psy535          359 VISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEF  438 (460)
Q Consensus       359 ~l~W~~~~~~~~~i~~y~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~~~Y~~  438 (460)
                      .|+|.+|.++++++.+|.|+|+..+.                         ..|............+.|.+|.|++.|.|
T Consensus       310 ~l~W~~p~~~~~~i~~Y~v~~~~~~~-------------------------~~~~~~~~~~~~~~~~~i~~L~~~t~Y~~  364 (389)
T 2jll_A          310 KLSITKQDDGGAPILEYIVKYRSKDK-------------------------EDQWLEKKVQGNKDHIILEHLQWTMGYEV  364 (389)
T ss_dssp             EEEECCCCCCSSCCCEEEEEEEC------------------------------CCBCCEECTTCCEEEECSCCTTCEEEE
T ss_pred             EEEEECCCCCCCcccEEEEEEEeCCC-------------------------CcceeEeeccCCcceEEeCCcCCCCEEEE
Confidence            99999998888899999999997432                         12222222335667899999999999999


Q ss_pred             EEEEeecCCCCCCCceeEeecC
Q psy535          439 QVVGKNELGDGMLSNIVVVKTK  460 (460)
Q Consensus       439 ~v~a~n~~G~s~~s~~~~~~T~  460 (460)
                      +|+|.|..|.|++|.. .++|.
T Consensus       365 ~V~A~n~~G~s~~s~~-~~~T~  385 (389)
T 2jll_A          365 QITAANRLGYSEPTVY-EFSMP  385 (389)
T ss_dssp             EEEEEC-CCBCCCEEE-EEECC
T ss_pred             EEEEEcCCcCCCceee-EecCC
Confidence            9999999999999966 66663



>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 460
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 4e-14
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 5e-12
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 6e-14
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 2e-12
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 2e-04
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 8e-04
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 3e-12
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 3e-09
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 3e-12
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 4e-11
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 4e-12
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 2e-11
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 6e-12
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 1e-09
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 2e-11
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 1e-10
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 4e-11
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 5e-11
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 6e-11
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 2e-10
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 8e-11
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 1e-08
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 9e-11
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 3e-10
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-10
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 3e-09
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 1e-10
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 4e-09
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-10
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 5e-09
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 2e-10
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 4e-08
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 3e-10
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 2e-06
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 4e-10
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 5e-09
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 1e-09
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-08
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 2e-09
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 7e-05
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 2e-09
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 5e-07
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 3e-09
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 4e-04
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 3e-09
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 7e-06
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 3e-09
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 4e-07
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 4e-09
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 2e-06
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 5e-09
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 6e-06
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 6e-09
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-04
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 7e-09
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 5e-04
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 8e-09
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 2e-04
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 1e-08
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 4e-07
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 1e-08
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 1e-07
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 2e-08
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 5e-06
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 5e-04
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 2e-08
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 3e-08
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 3e-07
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 3e-08
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 3e-07
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 3e-08
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 0.001
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 3e-08
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 9e-05
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 4e-08
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 9e-07
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 5e-08
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 5e-08
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 9e-06
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 7e-08
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 3e-05
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 8e-08
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 8e-06
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 1e-07
d2gysa4100 b.1.2.1 (A:317-416) Common beta-chain in the GM-CS 1e-07
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 1e-07
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 1e-04
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 2e-07
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 1e-05
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 2e-07
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 3e-07
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-07
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-06
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 2e-07
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 1e-06
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 4e-07
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 4e-06
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 4e-07
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 7e-05
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 4e-07
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 2e-06
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 4e-07
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 5e-05
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 5e-07
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 0.001
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 9e-07
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 0.002
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 9e-07
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 9e-07
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 3e-05
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 1e-06
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 3e-05
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 2e-06
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 2e-06
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 2e-06
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 2e-05
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 3e-06
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 2e-05
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 3e-06
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 4e-06
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 3e-06
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 4e-04
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 5e-06
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 3e-04
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 5e-06
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 9e-05
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 5e-06
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 0.002
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 7e-06
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 2e-05
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 7e-06
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 8e-05
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 7e-06
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 1e-04
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 8e-06
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 8e-04
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 0.004
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 9e-06
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 9e-05
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 1e-05
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 4e-05
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 1e-05
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 5e-04
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 1e-05
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 1e-04
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 1e-05
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 5e-04
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 1e-05
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 2e-04
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 2e-05
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 3e-04
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 2e-05
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 3e-05
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 0.002
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 3e-05
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 2e-04
d1erna2105 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor 4e-05
d1erna2105 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor 7e-05
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 4e-05
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 6e-05
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 5e-05
d3d85d394 b.1.2.1 (D:212-305) The p40 domain of interleukin- 5e-05
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 5e-05
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 4e-04
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 5e-05
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 6e-05
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 7e-05
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 0.001
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 1e-04
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 1e-04
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 1e-04
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 0.002
d1iray2103 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor 1e-04
d1iray2103 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor 0.004
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 1e-04
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 1e-04
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 2e-04
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 2e-04
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 0.003
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 2e-04
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 2e-04
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 0.004
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 2e-04
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 4e-04
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 2e-04
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 3e-04
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-04
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 3e-04
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 7e-04
d1hnga198 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus no 4e-04
d1hnga198 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus no 6e-04
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 4e-04
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 8e-04
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 0.001
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 0.001
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 0.001
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 0.001
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 0.001
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 0.002
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 0.001
d1y6kr199 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 0.001
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 0.002
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 0.002
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 0.003
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 0.003
d1f97a1102 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM 0.003
d1f6fb196 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus 0.003
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 0.004
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 0.004
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Sidekick 2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 66.4 bits (161), Expect = 4e-14
 Identities = 32/138 (23%), Positives = 52/138 (37%), Gaps = 26/138 (18%)

Query: 325 LGDGMLSN-IVVVKTKGPKPGPPRNVSVTEVN-NGFVISWQPPLERASLIQYYLIKYRTD 382
           +GDG  S+  ++ +T    PGPP  +   EV      + WQPP     +I  Y I +R +
Sbjct: 2   IGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLN 61

Query: 383 GSWKTLNKGQIRPEENSYLGEYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVG 442
                                       +   + V  P + Q T   L P + Y F++  
Sbjct: 62  ------------------------TTTANTATVEVLAPSARQYTATGLKPESVYLFRITA 97

Query: 443 KNELGDGMLSNIVVVKTK 460
           +   G G  +  +VV T+
Sbjct: 98  QTRKGWGEAAEALVVTTE 115


>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 98 Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 98 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query460
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.71
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.7
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.69
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.68
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.68
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.66
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.66
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.65
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.65
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.65
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.64
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.64
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.63
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.63
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.62
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.62
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.62
d2crza197 Fibronectin type-III domain containing protein 3a, 99.61
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.61
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.61
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.61
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.61
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.6
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.6
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.6
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.6
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.6
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.59
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.59
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.58
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.58
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.58
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.57
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.57
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.57
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.57
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.55
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.55
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.55
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.54
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.54
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.54
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.54
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.54
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.53
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.53
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.52
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.52
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.52
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.52
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.52
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.52
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.51
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.51
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.51
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.5
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.5
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.5
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.5
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.5
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.49
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.48
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.48
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.48
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.48
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.48
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.47
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.46
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.46
d2avga1110 Cardiac myosin binding protein C, different domain 99.46
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.45
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.45
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.45
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.45
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.45
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.45
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.45
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.44
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.44
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.43
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.42
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.42
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.42
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.41
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.41
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.41
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.41
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.41
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.4
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.4
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.4
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.4
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.39
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.39
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.39
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.39
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.39
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.38
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.38
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.38
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.38
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.38
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.38
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.38
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.37
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.37
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.37
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 99.37
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.37
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.36
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.36
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.36
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.35
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.35
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.34
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.34
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.34
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.34
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.34
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.33
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.33
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.33
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.32
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.32
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.32
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.32
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.31
d1gxea_130 Cardiac myosin binding protein C, different domain 99.3
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.28
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.28
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.26
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.25
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.25
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.24
d2crza197 Fibronectin type-III domain containing protein 3a, 99.24
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.23
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.22
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.22
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.21
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 99.19
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.19
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.19
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.18
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.18
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.18
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 99.17
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.17
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.16
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.16
d2avga1110 Cardiac myosin binding protein C, different domain 99.15
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.15
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.15
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 99.14
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.14
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.13
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.12
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.11
d1gxea_130 Cardiac myosin binding protein C, different domain 99.1
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 99.1
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.1
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.09
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.08
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.08
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.08
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.08
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.08
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.08
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.07
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.07
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.06
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.06
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.06
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.06
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.05
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.05
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.05
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.05
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.05
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.04
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.03
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.03
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.02
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.02
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.01
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 99.01
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.01
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.99
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 98.98
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.97
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 98.96
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.96
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 98.95
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.94
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.94
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 98.92
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 98.91
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.91
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.89
d1pd6a_94 Cardiac myosin binding protein C, different domain 98.89
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.89
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 98.88
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.87
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.86
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.86
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 98.85
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 98.85
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 98.84
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 98.83
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.83
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.82
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 98.8
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.8
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.79
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.78
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.78
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 98.78
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 98.77
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.77
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.76
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.75
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.73
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.73
d1va9a1109 Down syndrome cell adhesion molecule-like protein 98.73
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 98.72
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 98.72
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.7
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 98.7
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 98.69
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 98.67
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.67
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.67
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 98.67
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.65
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.64
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.63
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.59
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.58
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 98.58
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 98.57
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 98.56
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.53
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 98.53
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.52
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 98.51
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 98.51
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 98.51
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 98.5
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.49
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.49
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.49
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 98.49
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 98.48
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 98.48
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.48
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.47
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 98.46
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.46
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 98.44
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.43
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.42
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.42
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 98.42
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 98.42
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 98.4
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 98.4
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 98.4
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.39
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 98.39
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 98.37
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 98.37
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.37
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 98.36
d1ospl1107 Immunoglobulin light chain kappa variable domain, 98.35
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.35
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 98.33
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 98.32
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 98.32
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.32
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.32
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 98.32
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.32
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.31
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.31
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 98.3
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 98.28
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 98.28
d1jhll_108 Immunoglobulin light chain kappa variable domain, 98.28
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 98.28
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.27
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.26
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 98.26
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 98.25
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 98.25
d1op3k1106 Immunoglobulin light chain kappa variable domain, 98.25
d2dtge2 196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.24
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.24
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 98.23
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 98.23
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 98.22
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 98.21
d1mexl1107 Immunoglobulin light chain kappa variable domain, 98.2
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.2
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 98.2
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 98.2
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 98.2
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 98.2
d1d5il1107 Immunoglobulin light chain kappa variable domain, 98.18
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.17
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 98.17
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 98.16
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 98.16
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.15
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 98.15
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 98.14
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 98.14
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.14
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 98.13
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.09
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 98.09
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 98.09
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.08
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 98.08
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.08
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 98.08
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 98.08
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 98.08
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.07
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.05
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 98.05
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 98.04
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 98.04
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 98.04
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 98.04
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 98.04
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 98.03
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 98.02
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 98.01
d8faba1103 Immunoglobulin light chain lambda variable domain, 98.01
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 98.0
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.0
d1oaql_110 Immunoglobulin light chain lambda variable domain, 97.99
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 97.99
d2gsia1111 Immunoglobulin light chain kappa variable domain, 97.98
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 97.98
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 97.98
d1mjul1112 Immunoglobulin light chain kappa variable domain, 97.97
d1w72l1109 Immunoglobulin light chain lambda variable domain, 97.97
d1j05a_111 Immunoglobulin light chain kappa variable domain, 97.97
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 97.95
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 97.95
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 97.95
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.94
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 97.93
d1lgva1112 Immunoglobulin light chain lambda variable domain, 97.92
d2rhea_114 Immunoglobulin light chain lambda variable domain, 97.91
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.9
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 97.89
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.88
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.86
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.86
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 97.86
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 97.86
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.85
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 97.84
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 97.83
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 97.83
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 97.83
d1nfde1108 Immunoglobulin light chain lambda variable domain, 97.81
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 97.8
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.79
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 97.77
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 97.76
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 97.75
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 97.75
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 97.75
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 97.73
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 97.7
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 97.7
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 97.69
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 97.69
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 97.69
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 97.67
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 97.65
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 97.63
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.63
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 97.62
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 97.6
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.6
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 97.6
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 97.59
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 97.59
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 97.58
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 97.56
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.56
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.55
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 97.52
d1mjul2107 Immunoglobulin light chain kappa constant domain, 97.5
d1hnfa1101 CD2, first domain {Human (Homo sapiens) [TaxId: 96 97.5
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 97.5
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 97.49
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 97.49
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 97.49
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 97.49
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 97.48
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.48
d1nfde2104 Immunoglobulin light chain lambda constant domain, 97.48
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 97.48
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 97.47
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 97.44
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 97.43
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 97.42
d1kcvh2101 Immunoglobulin heavy chain gamma constant domain 1 97.42
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 97.4
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 97.4
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 97.4
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.38
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 97.38
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.37
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 97.37
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 97.35
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 97.33
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.33
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.32
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.32
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 97.31
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 97.31
d1ospl1107 Immunoglobulin light chain kappa variable domain, 97.3
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 97.3
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 97.29
d1hnfa1101 CD2, first domain {Human (Homo sapiens) [TaxId: 96 97.29
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 97.29
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 97.29
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.28
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 97.28
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.28
d1mjuh2102 Immunoglobulin heavy chain gamma constant domain 1 97.27
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 97.27
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.26
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 97.26
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 97.25
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 97.25
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 97.25
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 97.23
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 97.23
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 97.23
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 97.22
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.22
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.22
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 97.21
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 97.21
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 97.2
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.2
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 97.19
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 97.19
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 97.17
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 97.17
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 97.16
d2fx7h1127 Immunoglobulin heavy chain variable domain, VH {Hu 97.16
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 97.16
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 97.15
d1op3k1106 Immunoglobulin light chain kappa variable domain, 97.15
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.15
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 97.15
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 97.14
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 97.14
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 97.13
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 97.13
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 97.13
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 97.12
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 97.11
d1mexl1107 Immunoglobulin light chain kappa variable domain, 97.11
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.11
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Sidekick 2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.78  E-value=4.3e-19  Score=129.41  Aligned_cols=112  Identities=29%  Similarity=0.486  Sum_probs=91.3

Q ss_pred             CCCCCCC-CcEEEEccCCCCCCCcceEEEeec-ceEEEEecCCCCCCccceEEEEEEEEcCCeeeeccccCCCCcccccc
Q psy535          325 LGDGMLS-NIVVVKTKGPKPGPPRNVSVTEVN-NGFVISWQPPLERASLIQYYLIKYRTDGSWKTLNKGQIRPEENSYLG  402 (460)
Q Consensus       325 ~G~~~~s-~~~~~~~~~~~P~~p~~~~~~~~~-~~v~l~W~~~~~~~~~i~~y~i~~~~~~~~~~~~~~~~~~~~~~~~~  402 (460)
                      +|.|.++ ..+.+++.+.+|.+|.++.+...+ ++|.|+|++|...+++|.+|.|+|+..+.-                 
T Consensus         2 ~G~G~pss~~v~~~T~~~~P~~P~~~~~~~~~~~sv~v~W~~P~~~~g~i~~Y~i~y~~~~~~-----------------   64 (117)
T d1wfoa1           2 IGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTT-----------------   64 (117)
T ss_dssp             CCCCCCCCCCSCCCCSCCCCCCCCCCEEEEECSSEEEEECCCCSCCCSCCCEEEEEEEESSCC-----------------
T ss_pred             ccCCCCCCCCEEEECCCCCCcCCCCcEEEEecCCEEEEEEECCCCCCCceEEEeeeeeeccCC-----------------
Confidence            5777665 467788888899999999999876 699999999988788999999999875530                 


Q ss_pred             cceecCceeeeeeccCCCCcceEEECCCCcCceEEEEEEEeecCCCCCCCceeEeecC
Q psy535          403 EYREQGNKDWLPIPVTPPGSTQITINRLTPATTYEFQVVGKNELGDGMLSNIVVVKTK  460 (460)
Q Consensus       403 ~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~~~Y~~~v~a~n~~G~s~~s~~~~~~T~  460 (460)
                             ..|..........++|.|.+|.|++.|.|+|+|.|..|.|++|+.+.++|+
T Consensus        65 -------~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~n~~G~g~~S~~~~~tT~  115 (117)
T d1wfoa1          65 -------ANTATVEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTTE  115 (117)
T ss_dssp             -------CSCCCEEEECTTCCEEEEESCCSSSEEEEEEEEECSSCEEEEEEEEEECCS
T ss_pred             -------CceEeEEecCCceEEEEECCCCCCCEEEEEEEEECCCcCCCCcCCEEEECC
Confidence                   111112223356789999999999999999999999999999999999885



>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure