Psyllid ID: psy5411


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MNLTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNPQELLFDSASTLYLGQAGPIIKGALDIL
cEEEEEEEccccccccEEEEEEEccccccccEEEEEEEEccEEEEEEccccccEEEEEEccccEEEccccEEEEEEcccccccccccc
ccEEEEEEccccccccHHHHEccccccccccEEEEEEEEccEEEEEEEccccccEEEEEcccccEEcccccEEEEcccccccccEEEc
MNLTLLYTdvtkfsttqpiasflipaptgkYFKFALKVTLDGVTAFVnceeiestrvvrnpqellfdsastlylgqagpiIKGALDIL
MNLTLLYTdvtkfsttqpiASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEiestrvvrnpqeLLFDSAstlylgqagpiikgaldil
MNLTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNPQELLFDSASTLYLGQAGPIIKGALDIL
**LTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNPQELLFDSASTLYLGQAGPIIKGAL***
MNLTLLYTDVTK****QPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRV*RNP***LFDSASTLYLGQAGPII***LDI*
MNLTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNPQELLFDSASTLYLGQAGPIIKGALDIL
*NLTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNPQELLFDSASTLYLGQAGPIIKGALDIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNPQELLFDSASTLYLGQAGPIIKGALDIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
P39061 1774 Collagen alpha-1(XVIII) c no N/A 0.863 0.042 0.402 1e-07
P39059 1388 Collagen alpha-1(XV) chai yes N/A 0.840 0.053 0.337 2e-05
P39060 1754 Collagen alpha-1(XVIII) c no N/A 0.863 0.043 0.324 0.0002
>sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 Back     alignment and function desciption
 Score = 55.1 bits (131), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 2   NLTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNP 61
           N++LLYT+    S TQ  ASF +PA  G++  FAL V    V  +V+CEE +     R  
Sbjct: 585 NISLLYTEPGA-SQTQTGASFRLPAFVGQWTHFALSVDGGSVALYVDCEEFQRVPFARAS 643

Query: 62  QELLFDSASTLYLGQAG 78
           Q L  +  + L++GQAG
Sbjct: 644 QGLELERGAGLFVGQAG 660




Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.
Mus musculus (taxid: 10090)
>sp|P39059|COFA1_HUMAN Collagen alpha-1(XV) chain OS=Homo sapiens GN=COL15A1 PE=1 SV=2 Back     alignment and function description
>sp|P39060|COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens GN=COL18A1 PE=1 SV=5 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
357609363 643 putative ankyrin 2,3/unc44 [Danaus plexi 0.977 0.133 0.558 2e-20
328718614 2172 PREDICTED: hypothetical protein LOC10016 1.0 0.040 0.516 7e-18
322794000 243 hypothetical protein SINV_05987 [Solenop 0.977 0.353 0.441 4e-15
307168620 225 Collagen alpha-1(XV) chain [Camponotus f 0.988 0.386 0.436 4e-15
307213951 275 Collagen alpha-1(XV) chain [Harpegnathos 0.988 0.316 0.425 2e-14
270004433 525 hypothetical protein TcasGA2_TC003785 [T 0.886 0.148 0.481 1e-13
242013570 227 conserved hypothetical protein [Pediculu 0.863 0.334 0.447 2e-13
189235665 213 PREDICTED: similar to CG8647 CG8647-PA [ 0.886 0.366 0.481 2e-13
350397952 1146 PREDICTED: collagen alpha-1(XXII) chain- 0.988 0.075 0.425 3e-13
340720911 1163 PREDICTED: collagen alpha-1(XXII) chain- 0.988 0.074 0.425 3e-13
>gi|357609363|gb|EHJ66410.1| putative ankyrin 2,3/unc44 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/86 (55%), Positives = 65/86 (75%)

Query: 2   NLTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNP 61
           N++LLYTD   ++ +Q IASF++P+   K+ +FALKVT D VT F+NC E ++  V RNP
Sbjct: 544 NISLLYTDPNIYALSQTIASFVVPSFAKKWSRFALKVTSDNVTLFLNCHEFDTLVVKRNP 603

Query: 62  QELLFDSASTLYLGQAGPIIKGALDI 87
            EL+FDSASTLY+GQAGP+I GA  +
Sbjct: 604 LELVFDSASTLYVGQAGPLITGAFHV 629




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328718614|ref|XP_001948081.2| PREDICTED: hypothetical protein LOC100163477 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322794000|gb|EFZ17238.1| hypothetical protein SINV_05987 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307168620|gb|EFN61665.1| Collagen alpha-1(XV) chain [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307213951|gb|EFN89185.1| Collagen alpha-1(XV) chain [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|270004433|gb|EFA00881.1| hypothetical protein TcasGA2_TC003785 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242013570|ref|XP_002427477.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212511866|gb|EEB14739.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|189235665|ref|XP_001810454.1| PREDICTED: similar to CG8647 CG8647-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350397952|ref|XP_003485042.1| PREDICTED: collagen alpha-1(XXII) chain-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340720911|ref|XP_003398872.1| PREDICTED: collagen alpha-1(XXII) chain-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
FB|FBgn0260660 1023 mp "multiplexin" [Drosophila m 0.954 0.082 0.423 5.3e-10
UNIPROTKB|F1LR02 1528 Col18a1 "Protein Col18a1" [Rat 0.863 0.049 0.402 1.9e-07
UNIPROTKB|F1LRI2 1771 Col18a1 "Protein Col18a1" [Rat 0.863 0.042 0.402 2.2e-07
MGI|MGI:88451 1774 Col18a1 "collagen, type XVIII, 0.863 0.042 0.402 1.2e-06
UNIPROTKB|F1NYI0 1274 F1NYI0 "Uncharacterized protei 0.852 0.058 0.289 2.6e-05
UNIPROTKB|P39059 1388 COL15A1 "Collagen alpha-1(XV) 0.852 0.054 0.342 2.9e-05
UNIPROTKB|F6Y3U7 1500 COL18A1 "Uncharacterized prote 0.840 0.049 0.367 8.4e-05
UNIPROTKB|F1NW38 1340 COL18A1 "Uncharacterized prote 0.670 0.044 0.355 9.5e-05
UNIPROTKB|E2QZK7 1736 COL18A1 "Uncharacterized prote 0.840 0.042 0.367 9.9e-05
UNIPROTKB|F1NEY6 1403 COL18A1 "Uncharacterized prote 0.670 0.042 0.355 0.0001
FB|FBgn0260660 mp "multiplexin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 156 (60.0 bits), Expect = 5.3e-10, P = 5.3e-10
 Identities = 36/85 (42%), Positives = 53/85 (62%)

Query:     2 NLTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNP 61
             N++L+YT   + +  + +ASF +     K+   AL+V  D V+ + +CE   +T V R P
Sbjct:   130 NVSLVYTQADQ-NIGRKLASFGVAHVPDKWNSIALQVLSDKVSFYYDCELRNTTLVTREP 188

Query:    62 QELLFDSASTLYLGQAGPIIKGALD 86
              EL+FDSASTLY+GQAG II G  +
Sbjct:   189 IELVFDSASTLYIGQAGSIIGGKFE 213




GO:0005581 "collagen" evidence=ISS
GO:0031012 "extracellular matrix" evidence=IEA
GO:0007155 "cell adhesion" evidence=IEA
GO:0005198 "structural molecule activity" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=ISS
GO:0008045 "motor neuron axon guidance" evidence=IMP
UNIPROTKB|F1LR02 Col18a1 "Protein Col18a1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRI2 Col18a1 "Protein Col18a1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:88451 Col18a1 "collagen, type XVIII, alpha 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYI0 F1NYI0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P39059 COL15A1 "Collagen alpha-1(XV) chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y3U7 COL18A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NW38 COL18A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZK7 COL18A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEY6 COL18A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
KOG3546|consensus 1167 99.87
smart00210184 TSPN Thrombospondin N-terminal -like domains. Hepa 99.72
KOG3546|consensus1167 98.86
PF02210128 Laminin_G_2: Laminin G domain; InterPro: IPR012680 98.64
smart00282135 LamG Laminin G domain. 98.36
cd00110151 LamG Laminin G domain; Laminin G-like domains are 98.29
PF13385157 Laminin_G_3: Concanavalin A-like lectin/glucanases 98.01
PF00054131 Laminin_G_1: Laminin G domain; InterPro: IPR012679 97.53
smart00159206 PTX Pentraxin / C-reactive protein / pentaxin fami 97.29
cd00152201 PTX Pentraxins are plasma proteins characterized b 97.13
PF00354195 Pentaxin: Pentaxin family; InterPro: IPR001759 Pen 97.05
smart00560133 LamGL LamG-like jellyroll fold domain. 94.54
KOG3514|consensus 1591 93.35
PF06439185 DUF1080: Domain of Unknown Function (DUF1080); Int 91.73
PF02057669 Glyco_hydro_59: Glycosyl hydrolase family 59; Inte 88.5
KOG1834|consensus 952 87.6
KOG3516|consensus 1306 84.46
KOG3516|consensus 1306 84.2
>KOG3546|consensus Back     alignment and domain information
Probab=99.87  E-value=4e-23  Score=168.05  Aligned_cols=85  Identities=29%  Similarity=0.488  Sum_probs=82.4

Q ss_pred             CceEEEEecCCCCccceeeeEEECCCCCCCceEEEEEEECCeEEEEECCccceeEEEecCCCceeeecCcEEEEeecCCC
Q psy5411           1 MNLTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNPQELLFDSASTLYLGQAGPI   80 (88)
Q Consensus         1 ~~i~l~Ytd~~~~~~s~~~asF~v~~~d~~Whr~alsV~~~~VtL~~DC~~~~~~~~~R~p~~l~~~~~~~l~iGqaG~~   80 (88)
                      |+|+||||+++ +..++++|+|++|.|.++|+|||++|++..|+||+|||+.++.++.||.+.|.|++++.||+||||++
T Consensus       130 q~i~l~ytepg-~~~s~~aa~f~~p~~~~~w~~~a~~v~g~~v~l~v~cee~~r~p~~rss~~l~~e~~ag~f~~~ag~~  208 (1167)
T KOG3546|consen  130 QDISLLYTEPG-AGQTHTAASFRLPAFVGQWTHLALSVAGGFVALYVDCEEFQRMPLARSSRGLELEPGAGLFVAQAGGA  208 (1167)
T ss_pred             ceeEEEeccCC-CCccchhheeccchhhchhhheeeeecCceEEEEechHHhcccchhccccceeecCCcceEEeccCCC
Confidence            78999999998 77899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcee
Q psy5411          81 IKGALD   86 (88)
Q Consensus        81 ~~~~f~   86 (88)
                      ..++|.
T Consensus       209 ~~~~f~  214 (1167)
T KOG3546|consen  209 DPDKFQ  214 (1167)
T ss_pred             ChHhhh
Confidence            999986



>smart00210 TSPN Thrombospondin N-terminal -like domains Back     alignment and domain information
>KOG3546|consensus Back     alignment and domain information
>PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>smart00282 LamG Laminin G domain Back     alignment and domain information
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A Back     alignment and domain information
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>smart00159 PTX Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity Back     alignment and domain information
>PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits Back     alignment and domain information
>smart00560 LamGL LamG-like jellyroll fold domain Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>PF06439 DUF1080: Domain of Unknown Function (DUF1080); InterPro: IPR010496 This is a family of proteins of unknown function Back     alignment and domain information
>PF02057 Glyco_hydro_59: Glycosyl hydrolase family 59; InterPro: IPR001286 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 6e-04
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Length = 245 Back     alignment and structure
 Score = 35.6 bits (81), Expect = 6e-04
 Identities = 14/78 (17%), Positives = 28/78 (35%), Gaps = 4/78 (5%)

Query: 2   NLTLLYTDVTKFSTTQPIASFLIPAP-TGKYFKFALKVTLDGVTAFVNCEEIESTRVVRN 60
             +++++      + Q  A   + +    ++ K  + V     T FV+C  IES  +   
Sbjct: 127 TQSVVFSYKGLDGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVDCNRIESLPIKPR 186

Query: 61  PQELLFDSASTLYLGQAG 78
                 D      LG+  
Sbjct: 187 GP---IDIDGFAVLGKLA 201


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 99.78
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 99.76
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 99.76
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 98.02
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 97.93
3v64_A191 Low-density lipoprotein receptor-related protein; 97.9
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 97.87
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 97.78
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 97.77
3pvn_A206 C-reactive protein; pentraxin family, immune syste 97.69
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 97.64
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 97.61
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 97.39
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 97.25
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 97.23
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 97.19
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 97.17
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 96.95
2jd4_A 383 Laminin subunit alpha-1; basement membrane protein 96.67
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 96.66
4dqa_A355 Uncharacterized protein; two domains structure, DU 96.61
1dyk_A 394 Laminin alpha 2 chain; metal binding protein; 2.0A 96.6
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 96.58
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 96.46
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 96.27
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 96.01
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 95.6
4b1m_A185 Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil 94.84
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 94.82
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 94.68
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 93.24
1a8d_A 452 Tetanus neurotoxin; clostridial, ganglioside bindi 90.58
4azz_A172 Levanase; hydrolase; 1.70A {Bacillus subtilis} 87.4
3zr5_A656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 87.46
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 85.3
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
Probab=99.78  E-value=2.5e-19  Score=126.70  Aligned_cols=80  Identities=21%  Similarity=0.277  Sum_probs=63.6

Q ss_pred             CceEEEEecCCCCccceeeeEEE-CCCCCCCceEEEEEEECCeEEEEECCccceeEEEecCCCcee---eecCcEEEEee
Q psy5411           1 MNLTLLYTDVTKFSTTQPIASFL-IPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNPQELL---FDSASTLYLGQ   76 (88)
Q Consensus         1 ~~i~l~Ytd~~~~~~s~~~asF~-v~~~d~~Whr~alsV~~~~VtL~~DC~~~~~~~~~R~p~~l~---~~~~~~l~iGq   76 (88)
                      +.+.|+|+..+ .   +..++|. ++++|++|||++|+|++++|+||+||++++++++.+....+.   +++++.++|||
T Consensus       102 ~~l~~~y~~~g-~---~~~~~f~~v~l~dg~WH~l~l~V~~~~v~L~vDC~~~~~~~l~~~~~~~~~~~~~~~~~~~iGq  177 (209)
T 2erf_A          102 GTLDLSLTVQG-K---QHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAK  177 (209)
T ss_dssp             TEEEEEEEETT-E---EEEEEESSCCCCSSSEEEEEEEEETTEEEEEETTTEEEEEECSSCGGGTCCTTHHHHEEEEESC
T ss_pred             CEEEEEEcCCC-C---EEEEEEeccccCCCcEEEEEEEEECCEEEEEEcCeEeEeEEccCCchhccccccCCceEEEEec
Confidence            35889996554 3   2345665 899999999999999999999999999999999998554431   23378999999


Q ss_pred             cCCCCCCcee
Q psy5411          77 AGPIIKGALD   86 (88)
Q Consensus        77 aG~~~~~~f~   86 (88)
                      ++.. .+ |+
T Consensus       178 ~~~~-~~-F~  185 (209)
T 2erf_A          178 GGVN-DN-FQ  185 (209)
T ss_dssp             CTTT-CB-CC
T ss_pred             CCCC-CC-Ce
Confidence            9986 33 76



>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure
>1a8d_A Tetanus neurotoxin; clostridial, ganglioside binding region; 1.57A {Clostridium tetani} SCOP: b.29.1.6 b.42.4.2 PDB: 1af9_A 1fv3_A* 1fv2_A* 3hmy_A* 3hn1_A* 1d0h_A* 1dfq_A* 1dll_A* 1yxw_A* 1yyn_A* 1diw_A* Back     alignment and structure
>4azz_A Levanase; hydrolase; 1.70A {Bacillus subtilis} Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 88
d2erfa1206 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal do 9e-04
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Thrombospondin 1 N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 33.9 bits (77), Expect = 9e-04
 Identities = 13/78 (16%), Positives = 29/78 (37%), Gaps = 5/78 (6%)

Query: 14  STTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNPQELLFDS---AS 70
                ++       TG++    L V  D    +++CE++E+  +    Q +        +
Sbjct: 109 GKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIA 168

Query: 71  TLYLGQAGPI--IKGALD 86
            L + + G     +G L 
Sbjct: 169 RLRIAKGGVNDNFQGVLQ 186


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 99.37
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 97.84
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 97.8
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 97.34
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 97.26
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 97.2
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 97.06
d1a8da1247 Tetanus neurotoxin {Clostridium tetani [TaxId: 151 97.01
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 96.81
d1epwa1218 Botulinum neurotoxin {Clostridium botulinum, serot 96.69
d1saca_204 Serum amyloid P component (SAP) {Human (Homo sapie 96.53
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 96.0
d3btaa1207 Botulinum neurotoxin {Clostridium botulinum, serot 95.52
d2slia1196 Leech intramolecular trans-sialidase, N-terminal d 93.82
d1oq1a_223 Hypothetical protein YesU {Bacillus subtilis [TaxI 91.4
d2ah2a1225 Trypanosoma sialidase, C-terminal domain {Parasiti 80.51
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Thrombospondin 1 N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.37  E-value=7.8e-13  Score=89.23  Aligned_cols=80  Identities=19%  Similarity=0.252  Sum_probs=57.7

Q ss_pred             ceEEEEecCCCCccceeeeEEECCCCCCCceEEEEEEECCeEEEEECCccceeEEEecCCCcee---eecCcEEEEeecC
Q psy5411           2 NLTLLYTDVTKFSTTQPIASFLIPAPTGKYFKFALKVTLDGVTAFVNCEEIESTRVVRNPQELL---FDSASTLYLGQAG   78 (88)
Q Consensus         2 ~i~l~Ytd~~~~~~s~~~asF~v~~~d~~Whr~alsV~~~~VtL~~DC~~~~~~~~~R~p~~l~---~~~~~~l~iGqaG   78 (88)
                      .+.+.|+..+ .  .....++.++.+|++||+++++|++++|+||+||+++.+..+........   ...++.+++|+.+
T Consensus       100 ~l~~~~~~~~-~--~~~~~~~~~~l~d~~Whhva~~~~~~~v~lyvD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~  176 (206)
T d2erfa1         100 TLDLSLTVQG-K--QHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGG  176 (206)
T ss_dssp             EEEEEEEETT-E--EEEEEESSCCCCSSSEEEEEEEEETTEEEEEETTTEEEEEECSSCGGGTCCTTHHHHEEEEESCCT
T ss_pred             EEEEEEeCCC-c--eEEEEeccccccCCCEEEEEEEEeCCEEEEEECCEEEEeEEccCCcccccCCccceeEEEEEccCC
Confidence            3567777554 2  22334445788999999999999999999999999999988887554322   2236689999876


Q ss_pred             CCCCCcee
Q psy5411          79 PIIKGALD   86 (88)
Q Consensus        79 ~~~~~~f~   86 (88)
                      ..  +.|+
T Consensus       177 ~~--~~F~  182 (206)
T d2erfa1         177 VN--DNFQ  182 (206)
T ss_dssp             TT--CBCC
T ss_pred             CC--CCCE
Confidence            43  4453



>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d1oq1a_ b.29.1.17 (A:) Hypothetical protein YesU {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ah2a1 b.29.1.15 (A:409-633) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]} Back     information, alignment and structure