Psyllid ID: psy545

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-
MEKKDKEREKERDREEEKGEREKEMRKSSDVLYIFYIVENETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEKSNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFLLGYGMSETCGHLDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQGFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVLQPRSLCFLWCNDHLYVSSIKVTETKDIMARDKRAIETNSKLCSPGYREYADVASRSSAVFLDNSCEEDLLTNF
ccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccEEcccccccccccccccccccccccccccccccccEEEEEccccccccEEEEcccccccccccccccccEEEEEEcccccccccHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEHHHHHHHHHHHcccccccEEEccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccHHHHHHHHHHcccccccEEEEcccHHHHHcccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEEEEccccccccEEEEEEEEEEEEccccEEEEEEccccccccccccEEEEEEEcccccccccEEEEEEEEccccccccEEEEEEccccEEEEEEEEEcccccccccccccccccEEEcccccccccccccccEEEEEccccHHHcccc
cccHHHHHHHHcccHHHHcHHHHHHHccHHHHHHHHHHcccEEcEHHHEEEEcccccccccccccccccccHHHHccEEEEEEccEEEEEEEEccccHHHHHHcccccccEEEEEEcccccccccHHHHHHHHHHHHHccEEEEEEEcHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEcHHHHHHHHHHHccccccEEEEEccEccccccccccccccHHHccEEEEEccccccHcccccEcccccccEEEEEHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHccccccccccccccccccEEccccccccccEEEEEcccccccEEEEEEEEEEEEcccccccccccEEEEEEEEccccccEEEEccccccccccccEEEEEEEEccccccEEEEEEEEEccccEEccccHHHHccccccEEEEEccccccccEEEEEEcccccEEEEEcccccccccccccccEEEEEcccccccccc
MEKKDKEREKERDREEEKGEREKEMRKSSDVLYIFYIVENEtrcydelgclnvtrdwyhliyrpfnifplpravidTRFIlytrknpteghmlkvqnertieksnfdpkkktkfiihgfidtplsSWVKEMRRELlkhsdwnvIVVDwaggslplytqatANTRLVGLELAYFVNYLkdnyglnpadvHMIGHslgahtagyagqaieglgritgldpaepyfqgmppfarldptdadlvdvihtDGSSIFLLgygmsetcghldfypnngkeqpgcdltetplpltLIKEGIEEAGRVLVACNHVRAIKLFTESinskcpyvahrcpsyqhflqgrcfscgengtgcalmgleaqktnhppgskyyittgkevpfcrhhyritldlarppraetwVQGFMRVSLhsdngvirnldltpngyeklehgtsrsfvvthpedvgtinkVEFYWEydmdvlqprslcflwcndhlyvssikvtetkdiMARDKRAIETnsklcspgyreyadvasrssavfldnsceedlltnf
mekkdkerekerdreeekgerekemrkssdvlYIFYIVENETRCYDELGCLNVTRDWYHLIYRpfnifplpraVIDTRFILYTrknpteghmlkvqnertieksnfdpkkktkfiihgfidtplssWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFLLGYGMSETCGHLDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQGFMRVslhsdngviRNLDLTPNGYEKLEHGtsrsfvvthpedvgtINKVEFYWEYDMDVLQPRSLCFLWCNDHLYVSsikvtetkdimaRDKRAietnsklcspgyREYADVASRSSavfldnsceedlltnf
mekkdkerekerdreeekgerekemrkSSDVLYIFYIVENETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEKSNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFLLGYGMSETCGHLDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQGFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVLQPRSLCFLWCNDHLYVSSIKVTETKDIMARDKRAIETNSKLCSPGYREYADVASRSSAVFLDNSCEEDLLTNF
*****************************DVLYIFYIVENETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKN************************KTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFLLGYGMSETCGHLDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQGFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVLQPRSLCFLWCNDHLYVSSIKVTETKDIMARDKRAIETNSKLCSPGYREYADVA****AVFL************
*********************EKEMRKSSDVLYIFYIVENETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEKSNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFLLGYGMSETCGHLDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQGFMRVSLHSDNGVIRN**L**NGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVLQPRSLCFLWCNDHLYVSSIKVTETK******KRAIETNSKLCS**************AVFLDNSCEEDLLTN*
**************************KSSDVLYIFYIVENETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEKSNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFLLGYGMSETCGHLDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQGFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVLQPRSLCFLWCNDHLYVSSIKVTETKDIMARDKRAIETNSKLCSPGYREYADVASRSSAVFLDNSCEEDLLTNF
************************MRKSSDVLYIFYIVENETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEKSNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFLLGYGMSETCGHLDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQGFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVLQPRSLCFLWCNDHLYVSSIKVTETKDIMARDKRAIETNSKLCSPGYREYADVASRSSAVFLDNSCEE******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MExxxxxxxxxxxxxxxxxxxxxxxxxSSDVLYIFYIVENETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEKSNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFLLGYGMSETCGHLDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQGFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVLQPRSLCFLWCNDHLYVSSIKVTETKDIMARDKRAIETNSKLCSPGYREYADVASRSSAVFLDNSCEEDLLTNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query531 2.2.26 [Sep-21-2011]
Q64425457 Pancreatic triacylglycero N/A N/A 0.755 0.877 0.417 5e-86
O88354465 Pancreatic triacylglycero N/A N/A 0.753 0.860 0.416 2e-85
P54316473 Inactive pancreatic lipas yes N/A 0.768 0.862 0.405 3e-85
Q5BKQ4473 Inactive pancreatic lipas yes N/A 0.766 0.860 0.404 5e-84
P06857467 Inactive pancreatic lipas yes N/A 0.783 0.890 0.403 7e-84
Q6P8U6465 Pancreatic triacylglycero no N/A 0.762 0.870 0.408 8e-83
P54318468 Pancreatic lipase-related no N/A 0.772 0.876 0.408 2e-82
P16233465 Pancreatic triacylglycero yes N/A 0.753 0.860 0.414 2e-82
P29183461 Pancreatic triacylglycero no N/A 0.764 0.880 0.411 2e-82
P27657465 Pancreatic triacylglycero no N/A 0.762 0.870 0.411 6e-82
>sp|Q64425|LIPP_MYOCO Pancreatic triacylglycerol lipase (Fragment) OS=Myocastor coypus GN=PNLIP PE=2 SV=1 Back     alignment and function desciption
 Score =  318 bits (816), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 175/419 (41%), Positives = 234/419 (55%), Gaps = 18/419 (4%)

Query: 38  VENETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQN 97
           V     CYD LGC +    W  ++ RP  + P   + I+TRF+LYT ++P   + +   +
Sbjct: 6   VAGSEVCYDRLGCFSDDSPWAGIVERPLKVLPWSPSTINTRFLLYTNESPNN-YQIVTAD 64

Query: 98  ERTIEKSNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYT 157
             TI  SNF   +KT+FIIHG+ID    +W+  M   LL+    N I VDW GGS  LYT
Sbjct: 65  SSTIRSSNFRTDRKTRFIIHGYIDKGEENWLANMCEALLQVESVNCICVDWKGGSRALYT 124

Query: 158 QATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEG-LGRITGL 216
           QAT N R+VG E+AYFV+ L+   G +P++VH+IGHSLG+H AG AG+   G +GRITGL
Sbjct: 125 QATQNIRVVGAEVAYFVDALQSQLGYSPSNVHIIGHSLGSHVAGEAGRRTNGNIGRITGL 184

Query: 217 DPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFL-LGYGMSETCGHLDFYPNNGKEQP 275
           DPAEP FQG P   RLDP+DA  VDVIHTDG+ I   LG+GMS+T GHLDF+PN G E P
Sbjct: 185 DPAEPCFQGTPELVRLDPSDAQFVDVIHTDGAPIIPNLGFGMSQTVGHLDFFPNGGVEMP 244

Query: 276 GCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQ 335
           GC   +  +   +   GI E  R   ACNH+R+ K + +SI +   +    C SY  F  
Sbjct: 245 GCQ--KNIISQIVDINGIWEGTRDFAACNHLRSYKYYIDSILNPTGFAGFSCSSYNTFSS 302

Query: 336 GRCFSCGENGTGCALMGLEAQKTNHPPG---SKYYITTGKEVPFCRHHYRITLDLARPPR 392
             CF C     GC  MG  A + +        ++Y+ TG    F R  Y+I + L+    
Sbjct: 303 NNCFPCASG--GCPQMGHYADRFSGKTNELFQQFYLNTGDASNFSRWRYQIAVTLSGRK- 359

Query: 393 AETWVQGFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYW 451
               V G + VSL+   G  +  ++       L+ GTS    +    DVG I KV+F W
Sbjct: 360 ----VTGHVLVSLYGSGGTSKQYEIYKG---SLQPGTSYVNQIDSDVDVGDIEKVKFIW 411

Myocastor coypus (taxid: 10157)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 3
>sp|O88354|LIPP_SPETR Pancreatic triacylglycerol lipase OS=Spermophilus tridecemlineatus GN=PNLIP PE=1 SV=2 Back     alignment and function description
>sp|P54316|LIPR1_RAT Inactive pancreatic lipase-related protein 1 OS=Rattus norvegicus GN=Pnliprp1 PE=2 SV=1 Back     alignment and function description
>sp|Q5BKQ4|LIPR1_MOUSE Inactive pancreatic lipase-related protein 1 OS=Mus musculus GN=Pnliprp1 PE=2 SV=2 Back     alignment and function description
>sp|P06857|LIPR1_CANFA Inactive pancreatic lipase-related protein 1 OS=Canis familiaris GN=PNLIPRP1 PE=1 SV=2 Back     alignment and function description
>sp|Q6P8U6|LIPP_MOUSE Pancreatic triacylglycerol lipase OS=Mus musculus GN=Pnlip PE=1 SV=1 Back     alignment and function description
>sp|P54318|LIPR2_RAT Pancreatic lipase-related protein 2 OS=Rattus norvegicus GN=Pnliprp2 PE=1 SV=1 Back     alignment and function description
>sp|P16233|LIPP_HUMAN Pancreatic triacylglycerol lipase OS=Homo sapiens GN=PNLIP PE=1 SV=1 Back     alignment and function description
>sp|P29183|LIPP_HORSE Pancreatic triacylglycerol lipase (Fragment) OS=Equus caballus GN=PNLIP PE=1 SV=2 Back     alignment and function description
>sp|P27657|LIPP_RAT Pancreatic triacylglycerol lipase OS=Rattus norvegicus GN=Pnlip PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query531
328719064533 PREDICTED: pancreatic triacylglycerol li 0.924 0.921 0.821 0.0
242009162531 triacylglycerol lipase, pancreatic, puta 0.903 0.903 0.754 0.0
357620375580 putative triacylglycerol lipase, pancrea 0.902 0.825 0.674 0.0
380023938554 PREDICTED: pancreatic triacylglycerol li 0.907 0.870 0.672 0.0
307189426601 Pancreatic triacylglycerol lipase [Campo 0.907 0.801 0.638 0.0
383852575 645 PREDICTED: pancreatic triacylglycerol li 0.907 0.747 0.631 0.0
340726558561 PREDICTED: pancreatic triacylglycerol li 0.907 0.859 0.653 0.0
350418401561 PREDICTED: pancreatic triacylglycerol li 0.907 0.859 0.647 0.0
270012898 662 hypothetical protein TcasGA2_TC001672 [T 0.915 0.734 0.616 0.0
189240775543 PREDICTED: similar to pancreatic lipase 0.915 0.895 0.616 0.0
>gi|328719064|ref|XP_001948643.2| PREDICTED: pancreatic triacylglycerol lipase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/492 (82%), Positives = 447/492 (90%), Gaps = 1/492 (0%)

Query: 39  ENETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNE 98
           ENETRCYDELGCLN+TRDWYHLIYRPFN+FPL R VIDTRFILYTRKNP +G MLKVQ+E
Sbjct: 43  ENETRCYDELGCLNITRDWYHLIYRPFNVFPLARQVIDTRFILYTRKNPLQGQMLKVQSE 102

Query: 99  RTIEKSNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQ 158
           +TI+KSNFDPKK TKFIIHGFIDTPLS+WVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQ
Sbjct: 103 KTIQKSNFDPKKPTKFIIHGFIDTPLSNWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQ 162

Query: 159 ATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDP 218
           ATANTRLVGLE+AYF+NYLKDN GLNP  VH+IGHSLGAHTAGYAG+ IEGLGRITGLDP
Sbjct: 163 ATANTRLVGLEIAYFINYLKDNVGLNPKHVHLIGHSLGAHTAGYAGERIEGLGRITGLDP 222

Query: 219 AEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFLLGYGMSETCGHLDFYPNNGKEQPGCD 278
           AEPYFQGMP  +RLDP+DA LVDVIHTDGSSIFLLGYGMSE CGH+DFYPNNGKEQPGCD
Sbjct: 223 AEPYFQGMPSHSRLDPSDAQLVDVIHTDGSSIFLLGYGMSEPCGHIDFYPNNGKEQPGCD 282

Query: 279 LTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRC 338
           LTETPLPLTLIKEGIEEA RVLVACNHVRAIKLF ESINSKCPYVAH+C SYQ+FLQG+C
Sbjct: 283 LTETPLPLTLIKEGIEEASRVLVACNHVRAIKLFIESINSKCPYVAHKCNSYQNFLQGKC 342

Query: 339 FSCGENGTGCALMGLEAQKTNHPPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQ 398
           FSC EN TGCA+MGL   + NH PGSKY+I+TGK+ P+CR  Y++ LDLA+PPRAE+WVQ
Sbjct: 343 FSCKENDTGCAIMGLNTVRPNHAPGSKYFISTGKDTPYCRRQYKVMLDLAKPPRAESWVQ 402

Query: 399 GFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVL 458
           GFM+VSLHSDNGVIRNLDLTPNGYE++EHGTSRSFVVTHP+D+G + +VEFYWEYDMDVL
Sbjct: 403 GFMKVSLHSDNGVIRNLDLTPNGYERMEHGTSRSFVVTHPDDIGQVKRVEFYWEYDMDVL 462

Query: 459 QPRSLCFLWCNDHLYVSSIKVTETKDIMARDKRAIETNSKLCSPGYREYADVASRSSAVF 518
           QPRS+CF WCNDHLYVSSI VTE +D   R KR I+ ++KLCS G REYAD+ASR+SAVF
Sbjct: 463 QPRSICFFWCNDHLYVSSIGVTEAEDDGNRGKRGIQVDTKLCSQGPREYADIASRTSAVF 522

Query: 519 LDNSCEEDLLTN 530
           +D  CE+  L N
Sbjct: 523 ID-KCEDQELLN 533

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242009162|ref|XP_002425361.1| triacylglycerol lipase, pancreatic, putative [Pediculus humanus corporis] gi|212509146|gb|EEB12623.1| triacylglycerol lipase, pancreatic, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357620375|gb|EHJ72590.1| putative triacylglycerol lipase, pancreatic [Danaus plexippus] Back     alignment and taxonomy information
>gi|380023938|ref|XP_003695766.1| PREDICTED: pancreatic triacylglycerol lipase-like [Apis florea] Back     alignment and taxonomy information
>gi|307189426|gb|EFN73836.1| Pancreatic triacylglycerol lipase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383852575|ref|XP_003701802.1| PREDICTED: pancreatic triacylglycerol lipase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340726558|ref|XP_003401623.1| PREDICTED: pancreatic triacylglycerol lipase-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350418401|ref|XP_003491845.1| PREDICTED: pancreatic triacylglycerol lipase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|270012898|gb|EFA09346.1| hypothetical protein TcasGA2_TC001672 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240775|ref|XP_969219.2| PREDICTED: similar to pancreatic lipase [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query531
RGD|620792473 Pnliprp1 "pancreatic lipase-re 0.781 0.877 0.404 1.1e-82
UNIPROTKB|P54316473 Pnliprp1 "Inactive pancreatic 0.781 0.877 0.404 1.1e-82
MGI|MGI:97723473 Pnliprp1 "pancreatic lipase re 0.766 0.860 0.409 3.6e-82
UNIPROTKB|P16233465 PNLIP "Pancreatic triacylglyce 0.755 0.862 0.423 1.5e-81
UNIPROTKB|B8XY18467 PNLIPRP1 "Uncharacterized prot 0.764 0.869 0.421 5.2e-81
UNIPROTKB|E1BJQ9480 PNLIP "Uncharacterized protein 0.768 0.85 0.414 2.9e-80
UNIPROTKB|P54315467 PNLIPRP1 "Inactive pancreatic 0.781 0.888 0.397 5.8e-80
UNIPROTKB|E9PRT6467 PNLIPRP1 "Inactive pancreatic 0.781 0.888 0.397 9.5e-80
UNIPROTKB|P06857467 PNLIPRP1 "Inactive pancreatic 0.781 0.888 0.406 3.3e-79
MGI|MGI:97722465 Pnlip "pancreatic lipase" [Mus 0.757 0.864 0.417 4.2e-79
RGD|620792 Pnliprp1 "pancreatic lipase-related protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 806 (288.8 bits), Expect = 1.1e-82, Sum P(2) = 1.1e-82
 Identities = 175/433 (40%), Positives = 241/433 (55%)

Query:    32 LYIFYIVENETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGH 91
             L++    + +  CYD LGC +    W     RP  + P     I+TRF+LYT +NPT   
Sbjct:     9 LFLLGAAQGKEVCYDNLGCFSDAEPWAGTAIRPLKLLPWSPEKINTRFLLYTNENPTAFQ 68

Query:    92 MLKVQNERTIEKSNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGG 151
              L++ +  TI  SNF   +KT+FIIHGFID    +WV +M + + +  + N I VDW  G
Sbjct:    69 TLQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDMCKNMFQVEEVNCICVDWKKG 128

Query:   152 SLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLG 211
             S   YTQA  N R+VG ++A  ++ L  NY  +P+ VH+IGHSLGAH AG AG    GLG
Sbjct:   129 SQTTYTQAANNVRVVGAQVAQMIDILVKNYSYSPSKVHLIGHSLGAHVAGEAGSRTPGLG 188

Query:   212 RITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIF-LLGYGMSETCGHLDFYPNN 270
             RITGLDP E  F+G P   RLDP+DAD VDVIHTD + +   LG+G ++  GHLDF+PN 
Sbjct:   189 RITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMSGHLDFFPNG 248

Query:   271 GKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSY 330
             G+  PGC   +  L   +  +GI    R  VACNH+R+ K + ESI +   + A+ C SY
Sbjct:   249 GQSMPGCK--KNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAAYPCASY 306

Query:   331 QHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGS---KYYITTGKEVPFCRHHYRITLDL 387
             + F   +CF C + G  C  MG  A K     G    K+++ TG+   F R  YR++L L
Sbjct:   307 KDFESNKCFPCPDQG--CPQMGHYADKFAGKSGDEPQKFFLNTGEAKNFARWRYRVSLIL 364

Query:   388 ARPPRAETWVQGFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKV 447
             +        V G ++V+L    G  R  D+   G   ++ G + S       DVGTI KV
Sbjct:   365 SG-----RMVTGQVKVALFGSKGNTRQYDIF-RGI--IKPGATHSSEFDAKLDVGTIEKV 416

Query:   448 EFYWEYDMDVLQP 460
             +F W  +  V+ P
Sbjct:   417 KFLW--NNQVINP 427
GO:0004806 "triglyceride lipase activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0005576 "extracellular region" evidence=IEA
GO:0005615 "extracellular space" evidence=ISO;IDA
GO:0006629 "lipid metabolic process" evidence=IEA
GO:0016298 "lipase activity" evidence=ISO;IDA
GO:0031016 "pancreas development" evidence=IEP
GO:0043434 "response to peptide hormone stimulus" evidence=IEP
GO:0051384 "response to glucocorticoid stimulus" evidence=IEP
UNIPROTKB|P54316 Pnliprp1 "Inactive pancreatic lipase-related protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97723 Pnliprp1 "pancreatic lipase related protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P16233 PNLIP "Pancreatic triacylglycerol lipase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B8XY18 PNLIPRP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJQ9 PNLIP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P54315 PNLIPRP1 "Inactive pancreatic lipase-related protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PRT6 PNLIPRP1 "Inactive pancreatic lipase-related protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P06857 PNLIPRP1 "Inactive pancreatic lipase-related protein 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:97722 Pnlip "pancreatic lipase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P54316LIPR1_RATNo assigned EC number0.40560.76830.8625yesN/A
P16233LIPP_HUMAN3, ., 1, ., 1, ., 30.41420.75320.8602yesN/A
P06857LIPR1_CANFANo assigned EC number0.40320.78340.8907yesN/A
P50903LIPP_CAVPO3, ., 1, ., 1, ., 30.40520.73630.8408yesN/A
Q5BKQ4LIPR1_MOUSENo assigned EC number0.40470.76640.8604yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.10.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query531
cd00707275 cd00707, Pancreat_lipase_like, Pancreatic lipase-l 1e-129
pfam00151329 pfam00151, Lipase, Lipase 1e-110
TIGR03230442 TIGR03230, lipo_lipase, lipoprotein lipase 3e-62
cd00741153 cd00741, Lipase, Lipase 5e-25
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 2e-04
cd01755120 cd01755, PLAT_lipase, PLAT/ LH2 domain present in 0.003
>gnl|CDD|238363 cd00707, Pancreat_lipase_like, Pancreatic lipase-like enzymes Back     alignment and domain information 
 Score =  378 bits (973), Expect = e-129
 Identities = 141/299 (47%), Positives = 182/299 (60%), Gaps = 25/299 (8%)

Query: 75  IDTRFILYTRKNPTEGHMLKVQNERTIEKSNFDPKKKTKFIIHGFIDTPLSSWVKEMRRE 134
           ID RF+LYTR+NP    +L   +  +++ SNF+P + T+FIIHG+  +   SW+ ++R+ 
Sbjct: 1   IDVRFLLYTRENPNCPQLLFADDPSSLKNSNFNPSRPTRFIIHGWTSSGEESWISDLRKA 60

Query: 135 LLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHS 194
            L   D+NVIVVDW  G+ P Y QA  NTR+VG ELA F+++L DN GL+  +VH+IGHS
Sbjct: 61  YLSRGDYNVIVVDWGRGANPNYPQAVNNTRVVGAELAKFLDFLVDNTGLSLENVHLIGHS 120

Query: 195 LGAHTAGYAGQAIEG-LGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSIFLL 253
           LGAH AG+AG+ + G LGRITGLDPA P F G  P  RLDP+DA  VDVIHTDG      
Sbjct: 121 LGAHVAGFAGKRLNGKLGRITGLDPAGPLFSGADPEDRLDPSDAQFVDVIHTDGG----- 175

Query: 254 GYGMSETCGHLDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFT 313
             G S+  GH DFYPN G++QPGC                +      VAC+H RA+  F 
Sbjct: 176 LLGFSQPIGHADFYPNGGRDQPGC--------------PKDILSSDFVACSHQRAVHYFA 221

Query: 314 ESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGSKYYITTGK 372
           ESI S C +VA+ C SY  FL G+CF CG    GC  MG  A +       K+Y+ T  
Sbjct: 222 ESILSPCGFVAYPCSSYDEFLAGKCFPCGS---GCVRMGYHADRF--RREGKFYLKTNA 275

Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. Length = 275
>gnl|CDD|215752 pfam00151, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|132274 TIGR03230, lipo_lipase, lipoprotein lipase Back     alignment and domain information
>gnl|CDD|238382 cd00741, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|238853 cd01755, PLAT_lipase, PLAT/ LH2 domain present in connection with a lipase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 531
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 100.0
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 100.0
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 100.0
cd01758137 PLAT_LPL PLAT/ LH2 domain present in lipoprotein l 99.82
cd01759113 PLAT_PL PLAT/LH2 domain of pancreatic triglyceride 99.78
cd01755120 PLAT_lipase PLAT/ LH2 domain present in connection 99.73
PRK00870302 haloalkane dehalogenase; Provisional 99.4
PLN02824294 hydrolase, alpha/beta fold family protein 99.39
PRK10673255 acyl-CoA esterase; Provisional 99.37
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.35
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.33
PLN02385349 hydrolase; alpha/beta fold family protein 99.3
PLN02965255 Probable pheophorbidase 99.29
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.29
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.29
PLN02298330 hydrolase, alpha/beta fold family protein 99.29
PRK03592295 haloalkane dehalogenase; Provisional 99.26
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.26
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.25
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.24
PLN02679360 hydrolase, alpha/beta fold family protein 99.23
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.23
PLN02211273 methyl indole-3-acetate methyltransferase 99.22
PRK10349256 carboxylesterase BioH; Provisional 99.22
PRK10749330 lysophospholipase L2; Provisional 99.22
PLN02578354 hydrolase 99.21
PLN02511388 hydrolase 99.19
PRK03204286 haloalkane dehalogenase; Provisional 99.17
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.16
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.16
PRK06489360 hypothetical protein; Provisional 99.14
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.12
PHA02857276 monoglyceride lipase; Provisional 99.12
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.11
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.1
PLN02894402 hydrolase, alpha/beta fold family protein 99.09
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.08
PRK10985324 putative hydrolase; Provisional 99.06
PRK10566249 esterase; Provisional 99.04
KOG4409|consensus365 99.04
PRK08775343 homoserine O-acetyltransferase; Provisional 99.03
PRK11071190 esterase YqiA; Provisional 99.02
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.99
PLN02652395 hydrolase; alpha/beta fold family protein 98.99
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.94
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 98.93
KOG4178|consensus322 98.93
PLN00021313 chlorophyllase 98.9
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.88
KOG2564|consensus343 98.86
PRK07581339 hypothetical protein; Validated 98.86
KOG1454|consensus326 98.85
PRK00175379 metX homoserine O-acetyltransferase; Provisional 98.85
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 98.85
COG2267298 PldB Lysophospholipase [Lipid metabolism] 98.83
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 98.81
PRK05855 582 short chain dehydrogenase; Validated 98.81
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.8
PRK13604307 luxD acyl transferase; Provisional 98.79
PRK05077414 frsA fermentation/respiration switch protein; Revi 98.79
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 98.76
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 98.76
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 98.72
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.71
COG1647243 Esterase/lipase [General function prediction only] 98.69
KOG2382|consensus315 98.68
KOG1455|consensus313 98.67
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 98.64
cd01752120 PLAT_polycystin PLAT/LH2 domain of polycystin-1 li 98.64
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.64
PLN02872395 triacylglycerol lipase 98.64
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 98.63
PRK10162318 acetyl esterase; Provisional 98.57
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 98.56
smart00308105 LH2 Lipoxygenase homology 2 (beta barrel) domain. 98.55
PRK11460232 putative hydrolase; Provisional 98.54
cd00113116 PLAT PLAT (Polycystin-1, Lipoxygenase, Alpha-Toxin 98.52
PLN02442283 S-formylglutathione hydrolase 98.5
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.48
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 98.45
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.41
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.36
KOG1838|consensus409 98.34
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 98.32
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.3
PRK07868 994 acyl-CoA synthetase; Validated 98.29
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.27
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 98.24
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 98.21
COG0657312 Aes Esterase/lipase [Lipid metabolism] 98.19
COG0400207 Predicted esterase [General function prediction on 98.16
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.15
PRK06765389 homoserine O-acetyltransferase; Provisional 98.11
cd01753113 PLAT_LOX PLAT domain of 12/15-lipoxygenase. As a u 98.08
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 98.07
cd01756120 PLAT_repeat PLAT/LH2 domain repeats of family of p 98.05
PF01477113 PLAT: PLAT/LH2 domain; InterPro: IPR001024 Lipoxyg 98.03
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.03
KOG1552|consensus258 98.02
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 97.97
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 97.97
COG4782377 Uncharacterized protein conserved in bacteria [Fun 97.9
KOG4627|consensus270 97.88
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 97.84
KOG4391|consensus300 97.79
PF10503220 Esterase_phd: Esterase PHB depolymerase 97.74
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 97.71
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 97.68
COG0412236 Dienelactone hydrolase and related enzymes [Second 97.65
KOG1515|consensus336 97.64
KOG4667|consensus269 97.63
PRK102521296 entF enterobactin synthase subunit F; Provisional 97.63
cd02899109 PLAT_SR Scavenger receptor protein. A subfamily of 97.59
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 97.55
COG3319257 Thioesterase domains of type I polyketide synthase 97.48
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 97.33
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 97.31
PRK04940180 hypothetical protein; Provisional 97.3
COG1075336 LipA Predicted acetyltransferases and hydrolases w 97.28
cd01754129 PLAT_plant_stress PLAT/LH2 domain of plant-specifi 97.26
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 97.22
COG2272491 PnbA Carboxylesterase type B [Lipid metabolism] 97.21
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.18
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 97.17
cd00312493 Esterase_lipase Esterases and lipases (includes fu 97.16
COG3208244 GrsT Predicted thioesterase involved in non-riboso 97.16
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 97.09
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 96.96
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 96.94
KOG2984|consensus277 96.92
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 96.92
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 96.89
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 96.86
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 96.85
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 96.85
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 96.79
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 96.79
COG4814288 Uncharacterized protein with an alpha/beta hydrola 96.77
KOG2112|consensus206 96.71
KOG2624|consensus403 96.68
PRK10115686 protease 2; Provisional 96.55
PF00135535 COesterase: Carboxylesterase family The prints ent 96.52
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 96.48
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 96.47
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 96.4
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 96.39
COG2945210 Predicted hydrolase of the alpha/beta superfamily 96.33
COG4188365 Predicted dienelactone hydrolase [General function 96.3
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 96.3
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 96.27
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 96.07
cd01757114 PLAT_RAB6IP1 PLAT/LH2 domain present in RAB6 inter 96.03
COG4099387 Predicted peptidase [General function prediction o 96.01
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 95.98
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 95.87
KOG3724|consensus 973 95.82
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 95.8
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 95.77
KOG3101|consensus283 95.71
PLN02606306 palmitoyl-protein thioesterase 95.6
KOG2565|consensus469 95.5
KOG2541|consensus296 95.38
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 95.37
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 95.34
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 95.32
COG3150191 Predicted esterase [General function prediction on 95.29
KOG3847|consensus399 95.21
COG4757281 Predicted alpha/beta hydrolase [General function p 95.2
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 95.18
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 95.0
PLN02633314 palmitoyl protein thioesterase family protein 95.0
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 94.94
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 94.94
KOG1516|consensus545 94.94
KOG4372|consensus405 94.72
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 94.61
KOG2281|consensus867 93.85
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 93.68
COG0627316 Predicted esterase [General function prediction on 93.12
KOG3975|consensus301 92.74
PLN02408365 phospholipase A1 92.63
PLN02454414 triacylglycerol lipase 92.44
PRK05371767 x-prolyl-dipeptidyl aminopeptidase; Provisional 92.23
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 92.02
KOG3967|consensus297 92.0
KOG1553|consensus517 91.9
COG1770682 PtrB Protease II [Amino acid transport and metabol 91.61
KOG2100|consensus755 91.04
PLN02324415 triacylglycerol lipase 90.97
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 90.94
PLN02802509 triacylglycerol lipase 90.66
PLN02571413 triacylglycerol lipase 90.53
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 90.36
PF05577434 Peptidase_S28: Serine carboxypeptidase S28; InterP 89.63
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 89.37
PLN02761527 lipase class 3 family protein 88.93
PLN02310405 triacylglycerol lipase 88.81
PLN02753531 triacylglycerol lipase 88.39
PLN02847633 triacylglycerol lipase 87.84
KOG4840|consensus299 87.71
PLN00413479 triacylglycerol lipase 87.69
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 87.68
KOG2931|consensus326 87.66
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 87.54
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 86.57
PLN02162475 triacylglycerol lipase 86.36
PLN02517642 phosphatidylcholine-sterol O-acyltransferase 86.31
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 86.07
PLN02719518 triacylglycerol lipase 85.89
COG2819264 Predicted hydrolase of the alpha/beta superfamily 85.71
PLN03037525 lipase class 3 family protein; Provisional 85.13
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 84.54
KOG2183|consensus492 84.16
PLN02934515 triacylglycerol lipase 83.88
KOG3043|consensus242 83.43
KOG2237|consensus712 83.35
KOG2369|consensus473 82.37
KOG4389|consensus601 81.29
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information 
Probab=100.00  E-value=6.4e-105  Score=848.90  Aligned_cols=432  Identities=32%  Similarity=0.575  Sum_probs=377.9

Q ss_pred             cccccEEEEeecCCCCC-CceeecCCcccccccCCCCCCceEEEEccCCCCCC-chhHHHHHHHHhcCC-CeEEEEEeCC
Q psy545           73 AVIDTRFILYTRKNPTE-GHMLKVQNERTIEKSNFDPKKKTKFIIHGFIDTPL-SSWVKEMRRELLKHS-DWNVIVVDWA  149 (531)
Q Consensus        73 ~~i~~~f~LyTr~n~~~-~~~l~~~~~~~i~~s~fn~~~ptvviIHGw~~s~~-~~w~~~l~~aLL~~~-d~NVI~VDw~  149 (531)
                      ++|+|+|+||||+||+. .|.|.+.++++|..++||+++||+|+||||.+++. ..|+..|+++|+.++ ++|||+|||+
T Consensus         3 ~~i~~~F~L~Tr~n~~~~~~~l~~~~~~si~~s~Fn~~~ptvIlIHG~~~s~~~~~w~~~l~~al~~~~~d~nVI~VDw~   82 (442)
T TIGR03230         3 TDIESKFSLRTPEEPDDDTCYIVPGQPDSIADCNFNHETKTFIVIHGWTVTGMFESWVPKLVAALYEREPSANVIVVDWL   82 (442)
T ss_pred             cccccEEEEEecCCCCCCceEEecCChhhhhhcCcCCCCCeEEEECCCCcCCcchhhHHHHHHHHHhccCCCEEEEEECC
Confidence            57999999999999998 46899999999999999999999999999998763 579998998887543 7999999999


Q ss_pred             CCCCCchhhhcccHHHHHHHHHHHHHHHHHhcCCCCCcEEEEEechhhhhhhhhhhccCC-cceeeecCCCCCccCCCCC
Q psy545          150 GGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEG-LGRITGLDPAEPYFQGMPP  228 (531)
Q Consensus       150 g~~~~~Y~~a~~n~r~Vg~~la~~I~~L~~~~g~~~~~vhLIGHSLGAhVAg~ag~~~~~-V~RItgLDPAgP~F~~~~~  228 (531)
                      +++.+.|++++.+++.||++++++|++|.+..+++++++||||||||||||+++|++.++ |+||||||||+|+|+..++
T Consensus        83 g~g~s~y~~a~~~t~~vg~~la~lI~~L~~~~gl~l~~VhLIGHSLGAhIAg~ag~~~p~rV~rItgLDPAgP~F~~~~~  162 (442)
T TIGR03230        83 SRAQQHYPTSAAYTKLVGKDVAKFVNWMQEEFNYPWDNVHLLGYSLGAHVAGIAGSLTKHKVNRITGLDPAGPTFEYADA  162 (442)
T ss_pred             CcCCCCCccccccHHHHHHHHHHHHHHHHHhhCCCCCcEEEEEECHHHHHHHHHHHhCCcceeEEEEEcCCCCccccccc
Confidence            999999999899999999999999999987778889999999999999999999998887 9999999999999999999


Q ss_pred             CCCCCccchhhhHHhhhcCCcccccccccccccccccccCCCCCCCCCCCCCCCCCcchhhhhhhhhcccccccCChhhh
Q psy545          229 FARLDPTDADLVDVIHTDGSSIFLLGYGMSETCGHLDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEAGRVLVACNHVRA  308 (531)
Q Consensus       229 ~~rLd~sDA~fVDvIHTd~~~~~~~g~G~~~p~GHvDFYPNGG~~QPGC~~~~~~~~~~~~~~g~~~~~~~~~~CsH~Ra  308 (531)
                      ..|||++||+||||||||+..++.+++|+.+|+||+|||||||..||||+.....  ..+...++ ++..++++|||.||
T Consensus       163 ~~rLd~~DA~fVdVIHTd~~~~~~~~lG~~~piGh~DFYPNGG~~QPGC~~~~~~--~~~~~~~~-~~~~~~~~CsH~Ra  239 (442)
T TIGR03230       163 PSTLSPDDADFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDIQETL--LVIAEKGL-GNMDQLVKCSHERS  239 (442)
T ss_pred             ccccCCCCCCeEEEEEecCCccccccccccccccceEeccCCCCCCCCCCccccc--cccccccc-cccCcCccchhHHH
Confidence            9999999999999999999876677899999999999999999999999754211  00111232 33456789999999


Q ss_pred             HHHHHhccC-CCCCceeecCCChhhhccCcccccCCCCCccccccccccCCCCCCCcEEEEecCCCCCcccceeEEEEEE
Q psy545          309 IKLFTESIN-SKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTNHPPGSKYYITTGKEVPFCRHHYRITLDL  387 (531)
Q Consensus       309 ~~~f~eSi~-~~~~f~a~~C~s~~~f~~g~C~~c~~~~~~c~~mGy~a~~~~~~~~~~~yl~T~~~~Pf~~~~y~v~i~~  387 (531)
                      ++||+|||. ++|+|+|++|+||++|+.|.|++|+.+  +|+.|||++++.+...+++|||+|++.+|||++||+|+|++
T Consensus       240 ~~~f~eSi~~~~~~f~a~~C~s~~~f~~g~C~~c~~~--~c~~mG~~~~~~~~~~~g~~yl~T~~~~Pf~~~~y~v~v~~  317 (442)
T TIGR03230       240 IHLFIDSLLNEENPSMAYRCSSKEAFNKGLCLSCRKN--RCNKLGYEINKVRTKRSSKMYLKTREMMPYKVFHYQVKVHF  317 (442)
T ss_pred             HHHHHHHhcccCCCeeeEECCCHHHHhcCCCCCCCCC--CCceeCccccccccCCceEEEEEeCCCCCceEEEEEEEEEE
Confidence            999999995 459999999999999999999999876  79999999998754446799999999999999999999999


Q ss_pred             cCCCCCccceeeeEEEEEEeCCCceeeeecCCCCcccccCCceEEEEEeccCCCCceeEEEEEEEecCCccCCceecccc
Q psy545          388 ARPPRAETWVQGFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVLQPRSLCFLW  467 (531)
Q Consensus       388 ~~~~~~~~~~~g~~~i~L~g~~g~~~~~~~~~~~~~~~~~~~~~s~l~~~~~dig~~~~v~l~w~~~~~~~~p~~w~~~w  467 (531)
                      +++.. ...++|+|+|+|+|++|++++++|+ .+  .++||+|||+||+++.|||++++|+|+|+++  ++++  |.+||
T Consensus       318 ~~~~~-~~~~~~~~~~~l~g~~~~~~~~~~~-~~--~~~~~~t~~~~i~~~~~~g~~~~v~~~w~~~--~~~~--~~~~~  389 (442)
T TIGR03230       318 FGKTS-LSHTDQPMKISLYGTHGEKENIPFT-LP--EVSTNKTYSFLITTDVDIGELLMVKLKWEKD--TYIS--WSDWW  389 (442)
T ss_pred             ecccc-ccccCCcEEEEEEcCCCCccceEEe-ee--eecCCCeEEEEEecccCCCceEEEEEEEeCC--Cccc--chhhh
Confidence            98642 2247899999999999999999998 32  5999999999999999999999999999865  4444  44489


Q ss_pred             cCCcEEEEEEEEeeccccccccccceeeccccCCCCCccchhhccCcc-EEEecCcchhhhhc
Q psy545          468 CNDHLYVSSIKVTETKDIMARDKRAIETNSKLCSPGYREYADVASRSS-AVFLDNSCEEDLLT  529 (531)
Q Consensus       468 ~~~~~~i~~i~v~~~e~~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~~-~~f~~~~~~~~~~~  529 (531)
                      ..|+++|++|+||++|+     |++    .++|+. +.+++.+.++++ +|||+  |++++.+
T Consensus       390 ~~~~~~~~~i~v~~ge~-----~~~----~~fc~~-~~~~~~~~~~~~~~~~~~--~~~~~~~  440 (442)
T TIGR03230       390 SSPGFHIRKLRIKSGET-----QSK----VIFSAK-EGEFSYLQRGGEAAVFVK--CKEKSLS  440 (442)
T ss_pred             cCCceeEEEEEEEeCCC-----ccE----EEECCC-CCCcceeccCCcceeEEe--ecccccc
Confidence            99999999999999974     444    457886 667787777777 99999  9999874

Members of this protein family are lipoprotein lipase (EC 3.1.1.34), a eukaryotic triacylglycerol lipase active in plasma and similar to pancreatic and hepatic triacylglycerol lipases (EC 3.1.1.3). It is also called clearing factor. It cleaves chylomicron and VLDL triacylglycerols; it also has phospholipase A-1 activity.
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>cd01758 PLAT_LPL PLAT/ LH2 domain present in lipoprotein lipase (LPL) Back     alignment and domain information
>cd01759 PLAT_PL PLAT/LH2 domain of pancreatic triglyceride lipase Back     alignment and domain information
>cd01755 PLAT_lipase PLAT/ LH2 domain present in connection with a lipase domain Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>cd01752 PLAT_polycystin PLAT/LH2 domain of polycystin-1 like proteins Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>smart00308 LH2 Lipoxygenase homology 2 (beta barrel) domain Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>cd00113 PLAT PLAT (Polycystin-1, Lipoxygenase, Alpha-Toxin) domain or LH2 (Lipoxygenase homology 2) domain Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>cd01753 PLAT_LOX PLAT domain of 12/15-lipoxygenase Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>cd01756 PLAT_repeat PLAT/LH2 domain repeats of family of proteins with unknown function Back     alignment and domain information
>PF01477 PLAT: PLAT/LH2 domain; InterPro: IPR001024 Lipoxygenases (1 Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>KOG4667|consensus Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>cd02899 PLAT_SR Scavenger receptor protein Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>cd01754 PLAT_plant_stress PLAT/LH2 domain of plant-specific single domain protein family with unknown function Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>KOG2984|consensus Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>KOG2624|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>cd01757 PLAT_RAB6IP1 PLAT/LH2 domain present in RAB6 interacting protein 1 (Rab6IP1)_like family Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG3724|consensus Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>KOG2565|consensus Back     alignment and domain information
>KOG2541|consensus Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>KOG4372|consensus Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG3975|consensus Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>KOG3967|consensus Back     alignment and domain information
>KOG1553|consensus Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>KOG4840|consensus Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>KOG2931|consensus Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2183|consensus Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>KOG3043|consensus Back     alignment and domain information
>KOG2237|consensus Back     alignment and domain information
>KOG2369|consensus Back     alignment and domain information
>KOG4389|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query531
1rp1_A450 Dog Pancreatic Lipase Related Protein 1 Length = 45 1e-83
1bu8_A452 Rat Pancreatic Lipase Related Protein 2 Length = 45 1e-83
1lpa_B449 Interfacial Activation Of The Lipase-Procolipase Co 2e-83
1hpl_A449 Horse Pancreatic Lipase. The Crystal Structure At 2 5e-83
2ppl_A485 Human Pancreatic Lipase-Related Protein 1 Length = 4e-82
1eth_A448 Triacylglycerol LipaseCOLIPASE COMPLEX Length = 448 3e-81
1w52_X452 Crystal Structure Of A Proteolyzed Form Of Pancreat 3e-78
1gpl_A432 Rp2 Lipase Length = 432 7e-75
2pvs_A452 Structure Of Human Pancreatic Lipase Related Protei 2e-74
2oxe_A466 Structure Of The Human Pancreatic Lipase-Related Pr 2e-74
>pdb|1RP1|A Chain A, Dog Pancreatic Lipase Related Protein 1 Length = 450 Back     alignment and structure 
Iteration: 1

 Score =  307 bits (786), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 173/421 (41%), Positives = 232/421 (55%), Gaps = 18/421 (4%)
Query: 44  CYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEK 103
           CY+++GC +    W     RP  + P     I TRF+LYT KNP     L   +  TI  
Sbjct: 4   CYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIGA 63
Query: 104 SNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANT 163
           SNF   KKT+FIIHGFID    +W+ +M + + K  + N I VDW  GS   YTQA  N 
Sbjct: 64  SNFQTDKKTRFIIHGFIDKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNV 123
Query: 164 RLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDPAEPYF 223
           R+VG ++A  ++ L  NY  +P+ V +IGHSLGAH AG AG    GLGRITGLDP E  F
Sbjct: 124 RVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEASF 183
Query: 224 QGMPPFARLDPTDADLVDVIHTDGSSIF-LLGYGMSETCGHLDFYPNNGKEQPGCDLTET 282
           QG P   RLDPTDAD VDVIHTD + +   LG+G S+  GHLDF+PN G+E PGC   + 
Sbjct: 184 QGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCK--KN 241
Query: 283 PLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCG 342
            L   +  +GI E  R  VACNH+R+ K ++ESI +   + ++ C SY+ F   +CF C 
Sbjct: 242 ALSQIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFASYPCASYRAFESNKCFPCP 301
Query: 343 ENGTGCALMGLEAQK---TNHPPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQG 399
           +   GC  MG  A K          KY++ TG    F R  Y +++ L+   RA     G
Sbjct: 302 DQ--GCPQMGHYADKFAVKTSDETQKYFLNTGDSSNFARWRYGVSITLSG-KRA----TG 354
Query: 400 FMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVLQ 459
             +V+L    G     ++       L+ G++ S       DVGTI KV+F W  + +V+ 
Sbjct: 355 QAKVALFGSKGNTHQFNIFKG---ILKPGSTHSNEFDAKLDVGTIEKVKFLW--NNNVVN 409
Query: 460 P 460
           P
Sbjct: 410 P 410
>pdb|1BU8|A Chain A, Rat Pancreatic Lipase Related Protein 2 Length = 452 Back     alignment and structure
>pdb|1LPA|B Chain B, Interfacial Activation Of The Lipase-Procolipase Complex By Mixed Micelles Revealed By X-Ray Crystallography Length = 449 Back     alignment and structure
>pdb|1HPL|A Chain A, Horse Pancreatic Lipase. The Crystal Structure At 2.3 Angstroms Resolution Length = 449 Back     alignment and structure
>pdb|2PPL|A Chain A, Human Pancreatic Lipase-Related Protein 1 Length = 485 Back     alignment and structure
>pdb|1ETH|A Chain A, Triacylglycerol LipaseCOLIPASE COMPLEX Length = 448 Back     alignment and structure
>pdb|1W52|X Chain X, Crystal Structure Of A Proteolyzed Form Of Pancreatic Lipase Related Protein 2 From Horse Length = 452 Back     alignment and structure
>pdb|1GPL|A Chain A, Rp2 Lipase Length = 432 Back     alignment and structure
>pdb|2PVS|A Chain A, Structure Of Human Pancreatic Lipase Related Protein 2 Mutant N336q Length = 452 Back     alignment and structure
>pdb|2OXE|A Chain A, Structure Of The Human Pancreatic Lipase-Related Protein 2 Length = 466 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query531
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 1e-161
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 1e-157
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 1e-157
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 1e-155
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 1e-154
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 6e-11
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 2e-06
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 5e-06
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 5e-06
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1r3d_A264 Conserved hypothetical protein VC1974; structural 1e-04
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Length = 452 Back     alignment and structure
 Score =  465 bits (1197), Expect = e-161
 Identities = 158/442 (35%), Positives = 234/442 (52%), Gaps = 25/442 (5%)

Query: 44  CYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEK 103
           CY  LGC +  + W   + RP    P     ++TRF+LYT KNP    ++  ++  TI+ 
Sbjct: 4   CYTPLGCFSDDKPWAGTLQRPLKSLPWSPEEVNTRFLLYTNKNPDSYQLITARDVATIKS 63

Query: 104 SNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANT 163
           SNF   +KT F+IHGF D    SW  +M +++L+    N I VDW+ G+   YTQA  N 
Sbjct: 64  SNFQSSRKTHFVIHGFRDRGEDSWPSDMCKKILQVETTNCISVDWSSGAKAEYTQAVQNI 123

Query: 164 RLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEG-LGRITGLDPAEPY 222
           R+VG E AY +  L      NP +VH+IGHSLGAHTAG AG+ +EG +GR+TGLDPAEP 
Sbjct: 124 RIVGAETAYLIQQLLTELSYNPENVHIIGHSLGAHTAGEAGRRLEGRVGRVTGLDPAEPC 183

Query: 223 FQGMPPFARLDPTDADLVDVIHTDGSSIFL-LGYGMSETCGHLDFYPNNGKEQPGCDLTE 281
           FQ      RLDP+DA  VDVIHTD S +   LG+GMS+  GH+DF+PN GK+ PGC    
Sbjct: 184 FQDASEEVRLDPSDAQFVDVIHTDASPMLPSLGFGMSQKVGHMDFFPNGGKQMPGCK--R 241

Query: 282 TPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSC 341
           +     +   GI +  +  +ACNH+++ + ++ SI +   ++A+ C SY  F +  CF C
Sbjct: 242 SSFSTFIDINGIWQGAQDYLACNHLKSFEYYSSSILNPDGFLAYPCDSYDKFQENGCFPC 301

Query: 342 GENGTGCALMGLEAQKTNHPPGS---KYYITTGKEVPFCRHHYRITLDLARPPRAETWVQ 398
                GC  MG  A +      +    +++ TG+   +    YR+++ LA   +      
Sbjct: 302 PAG--GCPKMGHYADQYKEKTSAVEQTFFLNTGESGDYTSWRYRVSITLAGSGK----AN 355

Query: 399 GFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVTHPEDVGTINKVEFYWEYDMDVL 458
           G+++V+L   NG  +  ++       L+  +S +  V     +G I +V+F W   +   
Sbjct: 356 GYLKVTLRGSNGNSKQYEIFK---GSLQPDSSYTLDVDVNFIIGKIQEVKFVWNKTV--- 409

Query: 459 QPRSLCFLWCNDHLYVSSIKVT 480
                        L  S I V 
Sbjct: 410 ------LNLSKPQLGASRITVQ 425
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Length = 450 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Length = 452 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Length = 449 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Length = 432 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Length = 192 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Length = 316 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Length = 317 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Length = 264 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query531
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 100.0
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 100.0
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 100.0
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 100.0
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 100.0
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.52
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.51
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.5
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.5
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.49
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.49
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.49
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.48
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.48
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.48
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.47
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.47
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.46
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.46
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.45
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.45
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.44
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.44
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.44
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.44
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.44
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.43
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.43
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.43
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.43
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.42
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.41
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.41
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.41
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.41
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.41
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.4
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.4
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.4
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.4
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.4
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.4
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.39
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.39
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.39
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.38
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.37
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.37
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.36
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.36
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.36
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.36
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.36
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.36
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.36
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.35
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.34
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.34
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.34
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.34
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.34
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.34
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.34
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.33
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.32
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.32
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.31
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.31
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.3
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.3
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.3
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.3
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.29
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.29
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.28
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.27
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.27
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.27
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.27
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.27
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.26
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.25
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.24
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.24
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.23
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.22
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.21
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.21
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.21
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.21
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.21
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.2
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 98.83
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.2
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.19
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.19
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.19
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.18
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.18
3vdx_A456 Designed 16NM tetrahedral protein CAGE containing 99.18
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.18
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.17
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.17
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.16
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.16
3h04_A275 Uncharacterized protein; protein with unknown func 99.16
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.16
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.15
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.15
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.14
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.13
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.13
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.13
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.13
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.13
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.13
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.13
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.13
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.11
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.11
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 99.11
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.1
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.1
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.09
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 99.09
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.08
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.07
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.07
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.07
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.06
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 99.05
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.03
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.02
3lp5_A250 Putative cell surface hydrolase; structural genom 99.02
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.01
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.0
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.0
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.0
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.99
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.98
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.98
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.97
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.96
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 98.96
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.94
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.93
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 98.92
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.92
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.92
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 98.92
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.92
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.92
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.9
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 98.9
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.9
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.89
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.89
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.89
3d59_A383 Platelet-activating factor acetylhydrolase; secret 98.89
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.88
1kez_A300 Erythronolide synthase; polyketide synthase, modul 98.88
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 98.88
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.87
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.85
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 98.84
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.84
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.84
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 98.83
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.82
3ain_A323 303AA long hypothetical esterase; carboxylesterase 98.81
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 98.8
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.8
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 98.8
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.79
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.79
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 98.78
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 98.77
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 98.76
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.76
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.73
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.72
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.72
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.71
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 98.71
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 98.7
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.7
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 98.69
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 98.69
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.69
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 98.68
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.66
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.65
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 98.65
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.64
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.62
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 98.61
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.6
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.59
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.58
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.56
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.54
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 98.54
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.53
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.52
3nuz_A398 Putative acetyl xylan esterase; structural genomic 98.51
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.51
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 98.5
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.48
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.47
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.42
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.4
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.39
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.31
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 98.29
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 98.25
4f21_A246 Carboxylesterase/phospholipase family protein; str 98.21
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.14
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.06
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 98.0
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 97.94
3iii_A560 COCE/NOND family hydrolase; structural genomics, c 97.9
1lns_A763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 97.8
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 97.79
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 97.7
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 97.7
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 97.67
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 97.65
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 97.54
2h7c_A542 Liver carboxylesterase 1; enzyme, cholesteryl este 97.49
2fj0_A551 JuvenIle hormone esterase; manduca sexta, alpha-be 97.35
1p0i_A529 Cholinesterase; serine hydrolase, butyrate, hydrol 97.34
2ha2_A543 ACHE, acetylcholinesterase; hydrolase fold, serine 97.29
1thg_A544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 97.22
1ukc_A522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 97.2
1ea5_A537 ACHE, acetylcholinesterase; hydrolase, serine hydr 97.09
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 97.05
1llf_A534 Lipase 3; candida cylindracea cholesterol esterase 97.05
1dx4_A585 ACHE, acetylcholinesterase; hydrolase, serine este 97.01
3bix_A574 Neuroligin-1, neuroligin I; esterase domain, alpha 96.91
2bce_A579 Cholesterol esterase; hydrolase, serine esterase, 96.7
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 96.43
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 96.42
3v98_A 691 Arachidonate 5-lipoxygenase; dioxygenase, oxidored 96.34
3vf1_A 698 11R-lipoxygenase; LOX, PLAT, beta sandwich, C2-lik 96.33
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 96.18
1lox_A 662 15-lipoxygenase, 15LOX; oxidoreductase, 15LO_depot 96.16
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 96.12
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 96.12
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 96.07
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 95.89
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 95.85
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 95.81
3dy5_A 1066 Allene oxide synthase-lipoxygenase protein; fusion 95.68
3fg1_A 696 Allene oxide synthase-lipoxygenase protein; arichi 95.65
1ivy_A452 Human protective protein; carboxypeptidase, serine 95.46
3cwz_B384 RAB6IP1, RAB6-interacting protein 1; RAB small GTP 95.28
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 94.82
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 94.43
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 93.95
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 93.68
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 93.4
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 93.22
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 93.17
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 93.03
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 92.69
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 92.25
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 92.2
4ebb_A472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 91.91
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 91.48
1olp_A370 Alpha-toxin; zinc phospholipase C, GAS gangrene de 90.99
2wxu_A370 Phospholipase C; cytolysis, hydrolase, hemolysis, 90.78
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 90.68
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 90.6
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 90.13
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 90.02
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 89.49
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 86.91
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 83.84
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 83.91
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 81.58
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
Probab=100.00  E-value=1.5e-96  Score=791.79  Aligned_cols=423  Identities=41%  Similarity=0.738  Sum_probs=376.6

Q ss_pred             cceecCCCCccccCCcccccccCCcccCCCCCcccccEEEEeecCCCCCCceeecCCcccccccCCCCCCceEEEEccCC
Q psy545           41 ETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEKSNFDPKKKTKFIIHGFI  120 (531)
Q Consensus        41 ~~vCY~~~gCf~~~~~~~~~~~rp~~~~P~~~~~i~~~f~LyTr~n~~~~~~l~~~~~~~i~~s~fn~~~ptvviIHGw~  120 (531)
                      ++|||+++|||+++.||.++..||++.+|++|++++|+|+||||+||+.+|.|.+.+++++..++|++++|++|+||||.
T Consensus         1 ~~~cy~~~gcf~~~~~~~~~~~r~~~~~p~~~~~~~~~f~l~t~~n~~~~~~l~~~~~~~~~~s~f~~~~p~vvliHG~~   80 (450)
T 1rp1_A            1 KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIGASNFQTDKKTRFIIHGFI   80 (450)
T ss_dssp             CEEEETTTEEEECCTTTSSSSSSCSCCCCCCHHHHTCEEEEECSSSSSSCEEECTTCTHHHHTSCCCTTSEEEEEECCCC
T ss_pred             CcccCCCCCccCCCCCCcccccCccccCCCCccccccEEEEECCCCCCCceEeccCChhhhhccCcCCCCCeEEEEccCC
Confidence            47999999999999999999999999999999999999999999999999999998888999999999999999999999


Q ss_pred             CCCCchhHHHHHHHHhcCCCeEEEEEeCCCCCCCchhhhcccHHHHHHHHHHHHHHHHHhcCCCCCcEEEEEechhhhhh
Q psy545          121 DTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTA  200 (531)
Q Consensus       121 ~s~~~~w~~~l~~aLL~~~d~NVI~VDw~g~~~~~Y~~a~~n~r~Vg~~la~~I~~L~~~~g~~~~~vhLIGHSLGAhVA  200 (531)
                      ++....|...++++|++++++|||++||++++.+.|+.+..+++.+|++++++|+.|.++.|++++++||||||||||||
T Consensus        81 ~s~~~~w~~~l~~~ll~~~~~~VI~vD~~g~g~s~y~~~~~~~~~~a~~l~~ll~~L~~~~g~~~~~v~LVGhSlGg~vA  160 (450)
T 1rp1_A           81 DKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVA  160 (450)
T ss_dssp             CTTCTTHHHHHHHHHTTTCCEEEEEEECHHHHSSCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCGGGEEEEEETHHHHHH
T ss_pred             CCCCcchHHHHHHHHHhcCCeEEEEEeCccccCCcchHHHHHHHHHHHHHHHHHHHHHHhcCCChhhEEEEEECHhHHHH
Confidence            98866898888888987778999999999998888988888999999999999999976778889999999999999999


Q ss_pred             hhhhhccCCcceeeecCCCCCccCCCCCCCCCCccchhhhHHhhhcCCcc-cccccccccccccccccCCCCCCCCCCCC
Q psy545          201 GYAGQAIEGLGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSI-FLLGYGMSETCGHLDFYPNNGKEQPGCDL  279 (531)
Q Consensus       201 g~ag~~~~~V~RItgLDPAgP~F~~~~~~~rLd~sDA~fVDvIHTd~~~~-~~~g~G~~~p~GHvDFYPNGG~~QPGC~~  279 (531)
                      +++|.+.++|+||++||||+|+|...+...||+++||+|||+||||+..+ +.+|+|+.+|+||+|||||||..||||..
T Consensus       161 ~~~a~~~p~v~~iv~Ldpa~p~f~~~~~~~rl~~~DA~~Vd~Iht~~~~~~~~~~~G~~~~~Gh~dfypNgG~~QPgC~~  240 (450)
T 1rp1_A          161 GEAGSRTPGLGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKK  240 (450)
T ss_dssp             HHHHHTSTTCCEEEEESCCCTTTTTSCTTTSCCGGGSSEEEEECSCCSCHHHHCCCSCCSCCSSEEEEETTTTCCTTCCC
T ss_pred             HHHHHhcCCcccccccCcccccccCCCchhccChhhcchhheeeccccccccccccCcCCcccceEeccCCCCCCCCCCc
Confidence            99888877799999999999999988888999999999999999999853 44589999999999999999999999975


Q ss_pred             CCCCCcchhhhhhhhhcccccccCChhhhHHHHHhccCCCCCceeecCCChhhhccCcccccCCCCCccccccccccCCC
Q psy545          280 TETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTN  359 (531)
Q Consensus       280 ~~~~~~~~~~~~g~~~~~~~~~~CsH~Ra~~~f~eSi~~~~~f~a~~C~s~~~f~~g~C~~c~~~~~~c~~mGy~a~~~~  359 (531)
                      ....  ......|++++..++++|||.||++||+|||.++|+|+|++|+||++|++|.|.+|..+  .|+.|||++++..
T Consensus       241 ~~~~--~~~d~~~~~~~~~~~~~CsH~ra~~~f~eSi~~~~~f~a~~C~s~~~~~~~~C~~~~~~--~~~~mG~~~~~~~  316 (450)
T 1rp1_A          241 NALS--QIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFASYPCASYRAFESNKCFPCPDQ--GCPQMGHYADKFA  316 (450)
T ss_dssp             CCCC--SCCCHHHHHTTCSCCCCHHHHHHHHHHHHHHHCTTTTBCEECSCHHHHHTTCSCSCCTT--CCCBSSGGGGGCC
T ss_pred             cccc--ccccccccccccccccccCchhHHHHHHHHhccCCCceeeeCCCHHHHhCCCccCCCCC--cccccCccCcccc
Confidence            4211  00112356666667899999999999999999999999999999999999999999865  6999999999764


Q ss_pred             C---CCCcEEEEecCCCCCcccceeEEEEEEcCCCCCccceeeeEEEEEEeCCCceeeeecCCCCcccccCCceEEEEEe
Q psy545          360 H---PPGSKYYITTGKEVPFCRHHYRITLDLARPPRAETWVQGFMRVSLHSDNGVIRNLDLTPNGYEKLEHGTSRSFVVT  436 (531)
Q Consensus       360 ~---~~~~~~yl~T~~~~Pf~~~~y~v~i~~~~~~~~~~~~~g~~~i~L~g~~g~~~~~~~~~~~~~~~~~~~~~s~l~~  436 (531)
                      .   ...|+|||.|++++|||++||+|+|++++ .    .+.|.|+|+|+|++|++++++|+..   .+++|++|++||+
T Consensus       317 ~~~~~~~g~~yl~T~~~~Pf~~~~Y~VtV~~~~-~----~t~g~i~v~L~G~~g~s~~~~l~~~---~~~~g~t~s~li~  388 (450)
T 1rp1_A          317 VKTSDETQKYFLNTGDSSNFARWRYGVSITLSG-K----RATGQAKVALFGSKGNTHQFNIFKG---ILKPGSTHSNEFD  388 (450)
T ss_dssp             -------CEEEECCCSSSCCCCEEEEEEEEEEE-S----CEEEEEEEEEEETTEECCCEEEEEE---EECTTCEEEEEEE
T ss_pred             ccccccceeEEecccccCCcccceeEEEEEEcC-C----ceeEEEEEEEEcCCCCcceEEeccc---ccCCCCEEEEEEE
Confidence            2   12568999999999999999999999987 2    5789999999999999999999733   5999999999999


Q ss_pred             ccCCCCceeEEEEEEEecCCccCCceecccccCCcEEEEEEEEeeccc
Q psy545          437 HPEDVGTINKVEFYWEYDMDVLQPRSLCFLWCNDHLYVSSIKVTETKD  484 (531)
Q Consensus       437 ~~~dig~~~~v~l~w~~~~~~~~p~~w~~~w~~~~~~i~~i~v~~~e~  484 (531)
                      ++.|||+|++|+|.|+++  +++|       ..|+++|++|+|+++|+
T Consensus       389 ~~~dlG~l~~v~~~W~~~--~~~~-------~~p~~~i~~I~V~~~e~  427 (450)
T 1rp1_A          389 AKLDVGTIEKVKFLWNNN--VVNP-------TFPKVGAAKITVQKGEE  427 (450)
T ss_dssp             ESSCCSSEEEEEEEEEEC----CT-------TCCCEEEEEEEEEETTC
T ss_pred             CCCCCCCceEEEEEEECC--CCCC-------CCCeEEEEEEEEEeCCC
Confidence            999999999999999965  4443       15799999999999964
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>3v98_A Arachidonate 5-lipoxygenase; dioxygenase, oxidoreductase; 2.07A {Homo sapiens} PDB: 3v99_A* 3o8y_A 3v92_B Back     alignment and structure
>3vf1_A 11R-lipoxygenase; LOX, PLAT, beta sandwich, C2-like domain, non-heme iron, conformational change, dioxygenase, oxidoreductase; HET: SUC; 2.47A {Gersemia fruticosa} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1lox_A 15-lipoxygenase, 15LOX; oxidoreductase, 15LO_depot2; HET: RS7; 2.40A {Oryctolagus cuniculus} SCOP: a.119.1.2 b.12.1.1 PDB: 2p0m_A* Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>3dy5_A Allene oxide synthase-lipoxygenase protein; fusion protein, BI-functional enzyme, dioxygenase, fatty ACI biosynthesis, heme, iron; HET: HEM; 3.51A {Plexaura homomalla} Back     alignment and structure
>3fg1_A Allene oxide synthase-lipoxygenase protein; arichidonic metabolism, dioxygenase, fatty ACI biosynthesis, heme, iron, lipid synthesis, lyase; HET: GOL; 1.85A {Plexaura homomalla} PDB: 3fg4_A* 3fg3_A* 2fnq_A Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>3cwz_B RAB6IP1, RAB6-interacting protein 1; RAB small GTPase, RAB-binding domain, guanosine 5' triphosphate, RUN, RPIP8, UNC-14, nesca PLAT; HET: GTP; 3.20A {Mus musculus} Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>1olp_A Alpha-toxin; zinc phospholipase C, GAS gangrene determinant, membrane binding, calcium binding, hydrolase; 2.5A {Clostridium absonum} SCOP: a.124.1.1 b.12.1.3 Back     alignment and structure
>2wxu_A Phospholipase C; cytolysis, hydrolase, hemolysis, membrane binding, virulence gangrene determinant, C2 domain; 1.80A {Clostridium perfringens} PDB: 2wy6_A 2wxt_A 1qm6_A 1qmd_A 1ca1_A 1gyg_A 1kho_A Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 531
d1rp1a2337 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal 1e-122
d1bu8a2338 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal 1e-121
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 1e-06
d1gpla1112 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal 2e-05
d1tcaa_317 c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand 2e-05
d1uxoa_186 c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus 4e-05
d1rp1a1113 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal 1e-04
d1bu8a1114 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal 9e-04
d1ex9a_285 c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [Tax 0.002
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Length = 337 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Pancreatic lipase, N-terminal domain
domain: Pancreatic lipase, N-terminal domain
species: Dog (Canis familiaris) [TaxId: 9615]

 Score =  361 bits (926), Expect = e-122
 Identities = 151/337 (44%), Positives = 193/337 (57%), Gaps = 8/337 (2%)

Query: 44  CYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEK 103
           CY+++GC +    W     RP  + P     I TRF+LYT KNP     L   +  TI  
Sbjct: 4   CYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIGA 63

Query: 104 SNFDPKKKTKFIIHGFIDTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANT 163
           SNF   KKT+FIIHGFID    +W+ +M + + K  + N I VDW  GS   YTQA  N 
Sbjct: 64  SNFQTDKKTRFIIHGFIDKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNV 123

Query: 164 RLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTAGYAGQAIEGLGRITGLDPAEPYF 223
           R+VG ++A  ++ L  NY  +P+ V +IGHSLGAH AG AG    GLGRITGLDP E  F
Sbjct: 124 RVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEASF 183

Query: 224 QGMPPFARLDPTDADLVDVIHTD-GSSIFLLGYGMSETCGHLDFYPNNGKEQPGCDLTET 282
           QG P   RLDPTDAD VDVIHTD    I  LG+G S+  GHLDF+PN G+E PGC   + 
Sbjct: 184 QGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCK--KN 241

Query: 283 PLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCG 342
            L   +  +GI E  R  VACNH+R+ K ++ESI +   + ++ C SY+ F   +CF C 
Sbjct: 242 ALSQIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFASYPCASYRAFESNKCFPCP 301

Query: 343 ENGTGCALMGLEAQK---TNHPPGSKYYITTGKEVPF 376
           +   GC  MG  A K          KY++ TG    F
Sbjct: 302 DQ--GCPQMGHYADKFAVKTSDETQKYFLNTGDSSNF 336
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 338 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1gpla1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 112 Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317 Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Length = 186 Back     information, alignment and structure
>d1rp1a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Length = 113 Back     information, alignment and structure
>d1bu8a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 114 Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Length = 285 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query531
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 100.0
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 100.0
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.51
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.49
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.48
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.46
d1gpla1112 Pancreatic lipase, C-terminal domain {Guinea pig ( 99.45
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.44
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.44
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.44
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.43
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.43
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.42
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.41
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.41
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.39
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.39
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.38
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.37
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.36
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.36
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.35
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.35
d1rp1a1113 Pancreatic lipase, C-terminal domain {Dog (Canis f 99.33
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.31
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.3
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.3
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.3
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.29
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.26
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.23
d1bu8a1114 Pancreatic lipase, C-terminal domain {Rat (Rattus 99.21
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.19
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.17
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.11
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.11
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.1
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.07
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.07
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.96
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 98.94
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 98.93
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.85
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.79
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.75
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 98.74
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.71
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.7
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 98.67
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 98.65
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 98.63
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 98.63
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.62
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 98.6
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.58
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.53
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.46
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 98.45
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 98.38
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 98.3
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 98.25
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 98.23
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 98.22
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.19
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.19
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 98.12
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 98.12
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 98.06
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 98.04
d2p0ma2111 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [T 98.0
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 97.97
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 97.9
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 97.89
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 97.83
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 97.79
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 97.75
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 97.68
d1olpa2121 Alpha-toxin, C-terminal domain {Clostridium absonu 97.59
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 97.5
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 97.39
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 97.36
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 97.17
d1ca1a2121 Alpha-toxin, C-terminal domain {Clostridium perfri 97.15
d1qe3a_483 Thermophilic para-nitrobenzyl esterase (PNB estera 97.08
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 96.95
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 96.93
d2h7ca1532 Mammalian carboxylesterase (liver carboxylesterase 96.83
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 96.8
d1p0ia_526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 96.65
d2ha2a1542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 96.5
d1ea5a_532 Acetylcholinesterase {Pacific electric ray (Torped 96.5
d1llfa_534 Type-B carboxylesterase/lipase {Candida cylindrace 96.48
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 96.48
d1dx4a_571 Acetylcholinesterase {Fruit fly (Drosophila melano 96.42
d1thga_544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 96.39
d1ukca_517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 96.24
d2bcea_579 Bile-salt activated lipase (cholesterol esterase) 96.15
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 93.95
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 93.82
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 93.6
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 93.37
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 93.35
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 93.3
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 93.15
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 93.06
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 93.06
d2d81a1318 Polyhydroxybutyrate depolymerase {Penicillium funi 86.26
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 84.24
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 80.82
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Pancreatic lipase, N-terminal domain
domain: Pancreatic lipase, N-terminal domain
species: Dog (Canis familiaris) [TaxId: 9615]

Probab=100.00  E-value=5.6e-94  Score=740.58  Aligned_cols=333  Identities=45%  Similarity=0.812  Sum_probs=302.6

Q ss_pred             cceecCCCCccccCCcccccccCCcccCCCCCcccccEEEEeecCCCCCCceeecCCcccccccCCCCCCceEEEEccCC
Q psy545           41 ETRCYDELGCLNVTRDWYHLIYRPFNIFPLPRAVIDTRFILYTRKNPTEGHMLKVQNERTIEKSNFDPKKKTKFIIHGFI  120 (531)
Q Consensus        41 ~~vCY~~~gCf~~~~~~~~~~~rp~~~~P~~~~~i~~~f~LyTr~n~~~~~~l~~~~~~~i~~s~fn~~~ptvviIHGw~  120 (531)
                      ++|||+++|||+++.||.+...||++.+|++|++|+|+|+||||+||+.+|.|..++++++.+++||+++||+||||||+
T Consensus         1 ~~vCy~~lGCF~~~~Pf~~~~~rp~~~~P~~P~~i~~~F~LyTr~n~~~~q~l~~~~~~~l~~s~f~~~~pt~iiiHGw~   80 (337)
T d1rp1a2           1 KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIGASNFQTDKKTRFIIHGFI   80 (337)
T ss_dssp             CEEEETTTEEEECCTTTSSSSSSCSCCCCCCHHHHTCEEEEECSSSSSSCEEECT-CTHHHHTSCCCTTSEEEEEECCCC
T ss_pred             CcccCCCCCCcCCCCCCcCcccCccCCCCCCccccCCEEEEEcCCCCCCCeEecCCCcchHhhcCCCCCCCEEEEeCCCc
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCchhHHHHHHHHhcCCCeEEEEEeCCCCCCCchhhhcccHHHHHHHHHHHHHHHHHhcCCCCCcEEEEEechhhhhh
Q psy545          121 DTPLSSWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLELAYFVNYLKDNYGLNPADVHMIGHSLGAHTA  200 (531)
Q Consensus       121 ~s~~~~w~~~l~~aLL~~~d~NVI~VDw~g~~~~~Y~~a~~n~r~Vg~~la~~I~~L~~~~g~~~~~vhLIGHSLGAhVA  200 (531)
                      ++....|+..|+++||.++|+|||+|||+.++...|.+++.|++.||+.||+||++|.+..|++++++||||||||||||
T Consensus        81 ~~~~~~~~~~~~~a~l~~~d~NVI~VDW~~~a~~~Y~~a~~n~~~Vg~~ia~~i~~l~~~~g~~~~~vhlIGhSLGAhvA  160 (337)
T d1rp1a2          81 DKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVA  160 (337)
T ss_dssp             CTTCTTHHHHHHHHHTTTCCEEEEEEECHHHHSSCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCGGGEEEEEETHHHHHH
T ss_pred             CCCCcchHHHHHHHHHhcCCceEEEEeeccccCcchHHHHHHHHHHHHHHHHHHHHHHHhcCCChhheEEEeecHHHhhh
Confidence            99988999999999999999999999999988889999999999999999999999988889999999999999999999


Q ss_pred             hhhhhccCCcceeeecCCCCCccCCCCCCCCCCccchhhhHHhhhcCCcc-cccccccccccccccccCCCCCCCCCCCC
Q psy545          201 GYAGQAIEGLGRITGLDPAEPYFQGMPPFARLDPTDADLVDVIHTDGSSI-FLLGYGMSETCGHLDFYPNNGKEQPGCDL  279 (531)
Q Consensus       201 g~ag~~~~~V~RItgLDPAgP~F~~~~~~~rLd~sDA~fVDvIHTd~~~~-~~~g~G~~~p~GHvDFYPNGG~~QPGC~~  279 (531)
                      |+||+++.+|+||||||||+|+|+..++..|||++||+||||||||++.+ ..+|+|+.+|+||+|||||||..||||..
T Consensus       161 G~aG~~~~~l~rItgLDPA~P~F~~~~~~~rLd~~DA~fVdvIHT~~~~l~~~~~~G~~~~~Gh~DFYpNGG~~QPgC~~  240 (337)
T d1rp1a2         161 GEAGSRTPGLGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKK  240 (337)
T ss_dssp             HHHHHTSTTCCEEEEESCCCTTTTTSCTTTSCCGGGSSEEEEECSCCSCHHHHCCCSCCSCCSSEEEEETTTTCCTTCCC
T ss_pred             HHHHHhhccccceeccCCCccccCCCChhhCcCcccCceEEEEEecCccccccccCCccCCcCCEeccCCCCCcCCCCCc
Confidence            99999998899999999999999999999999999999999999999864 24689999999999999999999999975


Q ss_pred             CCCCCcchhhhhhhhhcccccccCChhhhHHHHHhccCCCCCceeecCCChhhhccCcccccCCCCCccccccccccCCC
Q psy545          280 TETPLPLTLIKEGIEEAGRVLVACNHVRAIKLFTESINSKCPYVAHRCPSYQHFLQGRCFSCGENGTGCALMGLEAQKTN  359 (531)
Q Consensus       280 ~~~~~~~~~~~~g~~~~~~~~~~CsH~Ra~~~f~eSi~~~~~f~a~~C~s~~~f~~g~C~~c~~~~~~c~~mGy~a~~~~  359 (531)
                      ....  .....+++.......+.|||.||++||+|||+++|+|+|++|+||++|++|.|.+|..+  +|+.|||++++..
T Consensus       241 ~~~~--~~~~~~~~~~~~~~~~~CsH~ra~~yf~eSi~~~~~f~a~~C~s~~~~~~g~C~~c~~~--~~~~MG~~a~~~~  316 (337)
T d1rp1a2         241 NALS--QIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFASYPCASYRAFESNKCFPCPDQ--GCPQMGHYADKFA  316 (337)
T ss_dssp             CCCC--SCCCHHHHHTTCSCCCCHHHHHHHHHHHHHHHCTTTTBCEECSCHHHHHTTCSCSCCTT--CCCBSSGGGGGCC
T ss_pred             cccc--cccccccccccccccccccchhHHHHHHHHhCCCCCcceeecCCHHHHHcCCCCCCCCC--CCcccCccccccc
Confidence            5211  11112344455566789999999999999999899999999999999999999999876  8999999998643


Q ss_pred             C---CCCcEEEEecCCCCCcc
Q psy545          360 H---PPGSKYYITTGKEVPFC  377 (531)
Q Consensus       360 ~---~~~~~~yl~T~~~~Pf~  377 (531)
                      .   ...|+|||.|++++||+
T Consensus       317 ~~~~~~~G~yyl~T~~~~Pfa  337 (337)
T d1rp1a2         317 VKTSDETQKYFLNTGDSSNFA  337 (337)
T ss_dssp             -------CEEEECCCSSSCCC
T ss_pred             ccCCCCceEEEEeCCCCCCCC
Confidence            2   23568999999999995
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1gpla1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1rp1a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1bu8a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p0ma2 b.12.1.1 (A:2-112) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1olpa2 b.12.1.3 (A:250-370) Alpha-toxin, C-terminal domain {Clostridium absonum [TaxId: 29369]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1ca1a2 b.12.1.3 (A:250-370) Alpha-toxin, C-terminal domain {Clostridium perfringens, different strains [TaxId: 1502]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure