Psyllid ID: psy5490


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MPTDSFESPLTLAACGGHVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQEMQTKHIDILEFKKRKQEESKAAFCRGSESTPTVSSKQAVKTTFPPVSTEPSGKPSDPPNSGKTKEPPNSGDDQSSVVNVATDSTLSHVTSTPSTSAATTTQTTSPPVVSAASQNTSSATQSSTAATQNASPATQSSNVATQNTPVTNLNNAVATLKTAVATLNRHCR
ccccccHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHccccccccccccccHHHHHHHHccccEEEEEccccccccccccccccccccHHHHHcccHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccccHHHHccccccccccccccHHHHHHHHHcccHHHcccc
ccccccHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccccEEEEEHccccccHcHcccccccHHHHHcccccHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHccccc
mptdsfespltlaacgghvnmptdsfespltlaacggHVDLALLLIERganieevnmptdsfespltlaacggHVDLALLLIERganieevndegytpLMEAAREGHEEMVCVLLQKGakinahteETQETALTLACCGGFLDVADFLLknganielgastplmEAAQEGHLELVRYLLDSGAQEMQTKHIDILEFKKRKQEESKAafcrgsestptvsskqavkttfppvstepsgkpsdppnsgktkeppnsgddqssvvnvatdstlshvtstpstsaatttqttsppvvsaasqntssatqsstaatqnaspatqssnvatqntpvtnlNNAVATLKTAVATLNRHCR
mptdsfesPLTLAACGGHVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQEMQTKHIDILEFKKRKQEESKAafcrgsestptvsskqavkttfppvstepsgkpsdppnsgktkeppnsgddqsSVVNVATDSTLshvtstpstsaatttqttsppvVSAASQNTSSATQSSTAATQNASPATQSSNVATQNTPVTNLNNAVATLKTAVATLNRHCR
MPTDSFESPLTLAACGGHVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKINAHteetqetaltlaCCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQEMQTKHIDILEFKKRKQEESKAAFCRGSESTPTVSSKQAVKTTFPPVSTEPSGKPSDPPNSGKTKEPPNSGDDQSSVVNVATDSTLSHvtstpstsaatttqttsppvvsaasqntssatqsstaatqnaspatqssNVATQNTPVTNLnnavatlktavatlnRHCR
***********LAACGGHVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQEMQTKHIDIL*********************************************************************************************************************************************AVATLKTAV********
MPTDSFESPLTLAACGGHVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQEMQTKHIDILEFKKRKQEESKAAFCRGSESTPTVSSKQAVKTTFPPVSTEPSGKPSDPPNSGKTKEPPNSGDDQSSVVNVATDSTLSHVTSTPSTSAATTTQTTSPPVVSAASQNTS*******AATQNASPATQSSNVATQNTPVTNLNNAVATLKTAVA*******
********PLTLAACGGHVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQEMQTKHIDILEFKK**************************************************************VVNVATD********************************************************ATQNTPVTNLNNAVATLKTAVATLNRHCR
***DSFESPLTLAACGGHVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQEMQTKHIDILEFKKRKQEESKAAFCRGSESTPTVSSKQAVKTTFPPVSTEPSGKPSDPPNSGKTKEPPNSGDDQSSVVNVATDSTLSHVTSTPSTSAATTTQTTSPPVVSAASQNTSSATQSSTAATQNAS*********T*NTPVTNLNNAVATLKTAVATLNRHCR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTDSFESPLTLAACGGHVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGAQEMQTKHIDILEFKKRKQEESKAAFCRGSESTPTVSSKQAVKTTFPPVSTEPSGKPSDPPNSGKTKEPPNSGDDQSSVVNVATDSTLSHVTSTPSTSAATTTQTTSPPVVSAASQNTSSATQSSTAATQNASPATQSSNVATQNTPVTNLNNAVATLKTAVATLNRHCR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query352 2.2.26 [Sep-21-2011]
Q99NH0 2603 Ankyrin repeat domain-con yes N/A 0.494 0.066 0.689 9e-68
O75179 2603 Ankyrin repeat domain-con yes N/A 0.494 0.066 0.689 9e-68
Q8IWZ3 2542 Ankyrin repeat and KH dom no N/A 0.494 0.068 0.689 1e-67
Q9VCA8 4001 Ankyrin repeat and KH dom yes N/A 0.494 0.043 0.678 2e-66
Q21920 2620 Ankyrin repeat and KH dom no N/A 0.491 0.066 0.369 1e-21
Q60J38 2636 Ankyrin repeat and KH dom N/A N/A 0.369 0.049 0.425 4e-21
Q7T163 1672 Kinase D-interacting subs no N/A 0.488 0.102 0.350 3e-19
Q9ULJ7 1429 Ankyrin repeat domain-con no N/A 0.494 0.121 0.375 1e-18
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.434 0.038 0.375 1e-18
Q5UPA0326 Putative ankyrin repeat p N/A N/A 0.406 0.438 0.337 2e-18
>sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 Back     alignment and function desciption
 Score =  257 bits (657), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 131/190 (68%), Positives = 148/190 (77%), Gaps = 16/190 (8%)

Query: 7   ESPLTLAACGGHVNM-------------PTDSFESPLTLAACGGHVDLALLLIERGANIE 53
           ES LTLA   GH+ M              TD   + L  A   GHV++A LL++ GA   
Sbjct: 398 ESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGA--- 454

Query: 54  EVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCV 113
           +VNMP DSFESPLTLAACGGHV+LA LLIERGA++EEVNDEGYTPLMEAAREGHEEMV +
Sbjct: 455 QVNMPADSFESPLTLAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVAL 514

Query: 114 LLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLE 173
           LL +GA INA TEETQETALTLACCGGFL+VADFL+K GA+IELG STPLMEAAQEGHLE
Sbjct: 515 LLGQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLE 574

Query: 174 LVRYLLDSGA 183
           LV+YLL +GA
Sbjct: 575 LVKYLLAAGA 584




Earliest specific in situ marker of hepatic differentiation during embryogenesis, useful for characterization of inductive events involved in hepatic specification.
Mus musculus (taxid: 10090)
>sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 Back     alignment and function description
>sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 Back     alignment and function description
>sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 Back     alignment and function description
>sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=2 SV=3 Back     alignment and function description
>sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 Back     alignment and function description
>sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 Back     alignment and function description
>sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q5UPA0|YL025_MIMIV Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
350419534 3091 PREDICTED: hypothetical protein LOC10074 0.494 0.056 0.721 1e-70
328790111 3136 PREDICTED: hypothetical protein LOC40998 0.494 0.055 0.721 1e-70
328698338 2652 PREDICTED: hypothetical protein LOC10016 0.494 0.065 0.715 2e-70
312385378 4867 hypothetical protein AND_00832 [Anophele 0.494 0.035 0.7 2e-70
332022374 3049 Ankyrin repeat and KH domain-containing 0.494 0.057 0.715 3e-70
307186886 2898 Ankyrin repeat domain-containing protein 0.494 0.060 0.710 3e-70
307212336 2982 Ankyrin repeat domain-containing protein 0.488 0.057 0.712 2e-69
242019742 2803 multiple ankyrin repeats single kh domai 0.485 0.061 0.716 3e-69
347970044 4403 AGAP003519-PA [Anopheles gambiae str. PE 0.494 0.039 0.689 8e-69
427796951 2096 Putative rtk signaling protein mask/unc- 0.494 0.083 0.7 1e-68
>gi|350419534|ref|XP_003492217.1| PREDICTED: hypothetical protein LOC100740063 [Bombus impatiens] Back     alignment and taxonomy information
 Score =  273 bits (698), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 152/190 (80%), Gaps = 16/190 (8%)

Query: 7   ESPLTLAACGGHVNM-------------PTDSFESPLTLAACGGHVDLALLLIERGANIE 53
           ES LTLA   GH+ M              TD   + L  A+  GHV++A LL++ GA   
Sbjct: 334 ESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEASMDGHVEVARLLLDSGA--- 390

Query: 54  EVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCV 113
           +VNMPTDSFESPLTLAACGGHVDLA+LLIERGANIEEVNDEGYTPLMEAAREGHEEMV +
Sbjct: 391 QVNMPTDSFESPLTLAACGGHVDLAMLLIERGANIEEVNDEGYTPLMEAAREGHEEMVAL 450

Query: 114 LLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLE 173
           LL +GA INA TEETQETALTLACCGGFL+VADFL+K GA+IELGASTPLMEAAQEGHLE
Sbjct: 451 LLSQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADIELGASTPLMEAAQEGHLE 510

Query: 174 LVRYLLDSGA 183
           LVRYLL+S A
Sbjct: 511 LVRYLLESAA 520




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328790111|ref|XP_393472.4| PREDICTED: hypothetical protein LOC409983 [Apis mellifera] Back     alignment and taxonomy information
>gi|328698338|ref|XP_001946819.2| PREDICTED: hypothetical protein LOC100167340 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312385378|gb|EFR29898.1| hypothetical protein AND_00832 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|332022374|gb|EGI62686.1| Ankyrin repeat and KH domain-containing protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307186886|gb|EFN72287.1| Ankyrin repeat domain-containing protein 17 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307212336|gb|EFN88140.1| Ankyrin repeat domain-containing protein 17 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242019742|ref|XP_002430318.1| multiple ankyrin repeats single kh domain protein, putative [Pediculus humanus corporis] gi|212515433|gb|EEB17580.1| multiple ankyrin repeats single kh domain protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|347970044|ref|XP_562353.4| AGAP003519-PA [Anopheles gambiae str. PEST] gi|333468757|gb|EAL40577.4| AGAP003519-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|427796951|gb|JAA63927.1| Putative rtk signaling protein mask/unc-44, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
ZFIN|ZDB-GENE-090421-1 2607 ankhd1 "ankyrin repeat and KH 0.494 0.066 0.631 3.2e-57
UNIPROTKB|F1RGE8 2540 ANKHD1 "Uncharacterized protei 0.494 0.068 0.621 8e-57
UNIPROTKB|F6XJV3 2539 ANKHD1 "Uncharacterized protei 0.494 0.068 0.621 2.1e-56
UNIPROTKB|E2QVL1 2616 ANKHD1 "Uncharacterized protei 0.494 0.066 0.621 2.3e-56
UNIPROTKB|F6XSE4 2650 ANKHD1 "Uncharacterized protei 0.494 0.065 0.621 2.4e-56
UNIPROTKB|G3MZJ0 2540 EIF4EBP3 "Uncharacterized prot 0.494 0.068 0.621 7.1e-56
UNIPROTKB|E1B719 2616 EIF4EBP3 "Uncharacterized prot 0.494 0.066 0.621 7.7e-56
UNIPROTKB|Q8IWZ3 2542 ANKHD1 "Ankyrin repeat and KH 0.494 0.068 0.626 3.9e-55
UNIPROTKB|E1BXT7 2531 ANKHD1 "Uncharacterized protei 0.494 0.068 0.626 2.7e-54
UNIPROTKB|E9PTK9 2540 Ankhd1 "Protein Ankhd1" [Rattu 0.494 0.068 0.621 5.6e-54
ZFIN|ZDB-GENE-090421-1 ankhd1 "ankyrin repeat and KH domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 565 (203.9 bits), Expect = 3.2e-57, Sum P(2) = 3.2e-57
 Identities = 120/190 (63%), Positives = 137/190 (72%)

Query:     7 ESPLTLAACGGHVNM-------------PTDSFESPLTLAACGGHVDLALLLIERGANIE 53
             ES LTLA   GH++M              TD   + L  A   GHV++A LL++ GA   
Sbjct:   368 ESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGA--- 424

Query:    54 EVNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCV 113
             +VNMP DSFESPLTLAACGGHV+LA LLIERGAN+EEVNDEGYTPLMEAAREGHEEMV +
Sbjct:   425 QVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVAL 484

Query:   114 LLQKGAKINAHXXXXXXXXXXXXCCGGFLDVADFLLKNGANIELGASTPLMEAAQEGHLE 173
             LL +GA INA             CCGGFL+VADFL+K GA+IELG STPLMEAAQEGHLE
Sbjct:   485 LLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLE 544

Query:   174 LVRYLLDSGA 183
             LV+YLL +GA
Sbjct:   545 LVKYLLAAGA 554


GO:0003723 "RNA binding" evidence=IEA
GO:0060047 "heart contraction" evidence=IMP
UNIPROTKB|F1RGE8 ANKHD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6XJV3 ANKHD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVL1 ANKHD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XSE4 ANKHD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZJ0 EIF4EBP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1B719 EIF4EBP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IWZ3 ANKHD1 "Ankyrin repeat and KH domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXT7 ANKHD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTK9 Ankhd1 "Protein Ankhd1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q99NH0ANR17_MOUSENo assigned EC number0.68940.49430.0668yesN/A
Q9VCA8ANKHM_DROMENo assigned EC number0.67890.49430.0434yesN/A
O75179ANR17_HUMANNo assigned EC number0.68940.49430.0668yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-35
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-32
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-24
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-23
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-23
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-21
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-18
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-15
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-12
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-11
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-10
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-10
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 8e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-09
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-09
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-08
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 7e-08
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-07
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 1e-07
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 8e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-06
smart0024830 smart00248, ANK, ankyrin repeats 2e-06
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-06
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 3e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-06
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-06
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 9e-06
PRK10856331 PRK10856, PRK10856, cytoskeletal protein RodZ; Pro 9e-06
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-04
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
smart0024830 smart00248, ANK, ankyrin repeats 3e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-04
pfam05539408 pfam05539, Pneumo_att_G, Pneumovirinae attachment 4e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 5e-04
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 5e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
PLN02217670 PLN02217, PLN02217, probable pectinesterase/pectin 0.001
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.003
smart0024830 smart00248, ANK, ankyrin repeats 0.003
smart0024830 smart00248, ANK, ankyrin repeats 0.003
smart0024830 smart00248, ANK, ankyrin repeats 0.003
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 0.004
pfam05539408 pfam05539, Pneumo_att_G, Pneumovirinae attachment 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  124 bits (313), Expect = 4e-35
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 4/120 (3%)

Query: 63  ESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKIN 122
            +PL LAA  GH+++  LL+E GA++   +++G TPL  AA+ GH E+V +LL+KGA +N
Sbjct: 8   RTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVN 67

Query: 123 AHTEETQETALTLACCGGFLDVADFLLKNGANIELGAS---TPLMEAAQEGHLELVRYLL 179
           A  ++   T L LA   G LDV   LLK+GA++        TPL  AA+ GHLE+V+ LL
Sbjct: 68  A-RDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|215130 PLN02217, PLN02217, probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 352
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
KOG4412|consensus226 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 99.98
PHA03100480 ankyrin repeat protein; Provisional 99.97
PHA03100480 ankyrin repeat protein; Provisional 99.97
KOG0508|consensus 615 99.97
PHA02875413 ankyrin repeat protein; Provisional 99.97
KOG0509|consensus 600 99.97
PHA02874434 ankyrin repeat protein; Provisional 99.97
PHA03095471 ankyrin-like protein; Provisional 99.97
PHA02946446 ankyin-like protein; Provisional 99.97
KOG0510|consensus 929 99.97
PHA02876682 ankyrin repeat protein; Provisional 99.97
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.96
PHA02878477 ankyrin repeat protein; Provisional 99.96
PHA02946446 ankyin-like protein; Provisional 99.96
PHA02798489 ankyrin-like protein; Provisional 99.96
PHA02798489 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA03095471 ankyrin-like protein; Provisional 99.96
PHA02989494 ankyrin repeat protein; Provisional 99.96
PHA02989494 ankyrin repeat protein; Provisional 99.96
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02876 682 ankyrin repeat protein; Provisional 99.96
KOG0509|consensus 600 99.96
KOG0508|consensus 615 99.95
PHA02795437 ankyrin-like protein; Provisional 99.95
PHA02917 661 ankyrin-like protein; Provisional 99.95
PLN03192823 Voltage-dependent potassium channel; Provisional 99.94
KOG4177|consensus 1143 99.94
KOG0510|consensus 929 99.94
KOG0502|consensus296 99.94
PHA02917 661 ankyrin-like protein; Provisional 99.93
KOG4177|consensus 1143 99.93
PHA02730 672 ankyrin-like protein; Provisional 99.92
KOG0502|consensus296 99.92
KOG0514|consensus452 99.92
PHA02795437 ankyrin-like protein; Provisional 99.92
KOG0507|consensus 854 99.92
PHA02743166 Viral ankyrin protein; Provisional 99.92
PHA02792631 ankyrin-like protein; Provisional 99.91
PLN03192823 Voltage-dependent potassium channel; Provisional 99.91
PHA02741169 hypothetical protein; Provisional 99.91
PHA02884300 ankyrin repeat protein; Provisional 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.91
PHA02730 672 ankyrin-like protein; Provisional 99.91
PHA02741169 hypothetical protein; Provisional 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.9
PHA02736154 Viral ankyrin protein; Provisional 99.89
KOG0505|consensus 527 99.89
PHA02736154 Viral ankyrin protein; Provisional 99.88
KOG0512|consensus228 99.87
PHA02792631 ankyrin-like protein; Provisional 99.86
KOG0514|consensus452 99.86
KOG0507|consensus 854 99.86
PHA02884300 ankyrin repeat protein; Provisional 99.86
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.83
KOG0505|consensus527 99.82
KOG0195|consensus448 99.82
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.82
KOG0512|consensus228 99.81
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.8
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.79
KOG3676|consensus 782 99.79
KOG0195|consensus 448 99.78
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.77
KOG4369|consensus 2131 99.77
KOG3676|consensus 782 99.77
KOG4369|consensus 2131 99.74
KOG4214|consensus117 99.69
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.67
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.67
KOG4214|consensus117 99.65
KOG0515|consensus752 99.62
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.55
KOG1710|consensus396 99.55
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.55
KOG1710|consensus396 99.54
KOG0515|consensus752 99.52
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.5
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.49
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.47
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.44
KOG0506|consensus622 99.03
KOG0783|consensus 1267 98.98
KOG0506|consensus622 98.97
KOG0783|consensus 1267 98.97
KOG0818|consensus 669 98.95
KOG0782|consensus1004 98.91
KOG0818|consensus 669 98.87
PF1360630 Ank_3: Ankyrin repeat 98.85
KOG0782|consensus1004 98.84
PF1360630 Ank_3: Ankyrin repeat 98.83
KOG0705|consensus749 98.8
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.76
KOG0705|consensus749 98.74
KOG3609|consensus 822 98.7
KOG3609|consensus 822 98.7
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.69
KOG0522|consensus 560 98.65
KOG0522|consensus 560 98.59
KOG0511|consensus 516 98.5
KOG0521|consensus785 98.38
KOG0511|consensus 516 98.38
KOG2384|consensus223 98.36
KOG2384|consensus223 98.32
KOG0521|consensus785 98.25
KOG0520|consensus 975 98.23
KOG0520|consensus975 98.22
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.68
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 97.36
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.16
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.03
KOG2505|consensus591 97.01
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.17
KOG2505|consensus591 96.15
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.06
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.91
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.3
KOG0260|consensus1605 92.59
KOG0260|consensus1605 90.98
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.6e-35  Score=264.26  Aligned_cols=186  Identities=16%  Similarity=0.135  Sum_probs=164.2

Q ss_pred             CCCCCccHHHHHHcCCCCCCC-----------CCCCChHHHHHHHcCCHHHHHHHHHcCCCCCCcCCCCCCCChHHHHHH
Q psy5490           2 PTDSFESPLTLAACGGHVNMP-----------TDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAA   70 (352)
Q Consensus         2 ~~~~g~t~L~lA~~~~~~n~~-----------d~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~n~~~~~g~t~Lh~A~   70 (352)
                      +|.+|+||||+|+..|+.+++           ..+|+||||+|+..|+.+++++|+++|+++   +.+|..|+||||+|+
T Consensus        26 ~D~~G~TpLh~Aa~~g~~eiv~~Ll~~ga~~n~~d~~TpLh~Aa~~g~~eiV~lLL~~Gadv---n~~d~~G~TpLh~Aa  102 (284)
T PHA02791         26 ADVHGHSALYYAIADNNVRLVCTLLNAGALKNLLENEFPLHQAATLEDTKIVKILLFSGMDD---SQFDDKGNTALYYAV  102 (284)
T ss_pred             CCCCCCcHHHHHHHcCCHHHHHHHHHCcCCCcCCCCCCHHHHHHHCCCHHHHHHHHHCCCCC---CCCCCCCCCHHHHHH
Confidence            588999999999987765432           235789999999999999999999999985   667799999999999


Q ss_pred             HcCCHHHHHHHHHcCCCCCCcCCCCC-hHHHHHHHcCcHHHHHHHHhcCCCcccccccccCcHHHHHHHcCCHHHHHHHH
Q psy5490          71 CGGHVDLALLLIERGANIEEVNDEGY-TPLMEAAREGHEEMVCVLLQKGAKINAHTEETQETALTLACCGGFLDVADFLL  149 (352)
Q Consensus        71 ~~g~~~~v~~Ll~~g~~~~~~d~~G~-t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll  149 (352)
                      ..|+.+++++|+++|++++.++..|+ ||||+|+..|+.+++++|++++.+..  ....|.||||+|+..|+.+++++|+
T Consensus       103 ~~g~~eivk~Ll~~gadin~~~~~g~~TpL~~Aa~~g~~eivk~LL~~~~~~~--d~~~g~TpLh~Aa~~g~~eiv~lLL  180 (284)
T PHA02791        103 DSGNMQTVKLFVKKNWRLMFYGKTGWKTSFYHAVMLNDVSIVSYFLSEIPSTF--DLAILLSCIHITIKNGHVDMMILLL  180 (284)
T ss_pred             HcCCHHHHHHHHHCCCCcCccCCCCCcHHHHHHHHcCCHHHHHHHHhcCCccc--ccccCccHHHHHHHcCCHHHHHHHH
Confidence            99999999999999999999999885 89999999999999999999976542  1234789999999999999999999


Q ss_pred             HcCCCCCC---CCCCH-HHHHHHcCCHHHHHHHHHcCCCcccccccc
Q psy5490         150 KNGANIEL---GASTP-LMEAAQEGHLELVRYLLDSGAQEMQTKHID  192 (352)
Q Consensus       150 ~~g~~~~~---~g~t~-L~~A~~~~~~~~v~~Ll~~ga~~~~~~~~~  192 (352)
                      ++|+++|.   .|.|| ||+|+..|+.++|++|+++|++.+..+...
T Consensus       181 ~~gAd~n~~d~~g~t~~L~~Aa~~~~~e~v~lLl~~Ga~in~~~~~~  227 (284)
T PHA02791        181 DYMTSTNTNNSLLFIPDIKLAIDNKDLEMLQALFKYDINIYSVNLEN  227 (284)
T ss_pred             HCCCCCCcccCCCCChHHHHHHHcCCHHHHHHHHHCCCCCccCcccC
Confidence            99999876   45665 999999999999999999999998776543



>KOG4412|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0260|consensus Back     alignment and domain information
>KOG0260|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-17
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-09
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-15
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-11
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-06
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-15
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-14
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-15
2xeh_A157 Structural Determinants For Improved Thermal Stabil 4e-14
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-15
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-14
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 6e-15
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-14
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-14
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-12
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-14
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-10
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 7e-14
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-11
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-13
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-13
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-11
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-13
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-13
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-13
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 8e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-13
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 9e-12
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-13
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-10
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-13
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-11
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-13
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-11
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-07
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-13
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-10
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-07
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 4e-13
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 8e-12
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-12
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 8e-10
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-12
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-10
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 5e-12
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 7e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-08
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-11
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 8e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 5e-07
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-11
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 6e-11
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-10
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 6e-11
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 5e-05
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 2e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-10
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 1e-09
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-09
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 5e-09
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 5e-09
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 2e-08
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-08
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 1e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 6e-06
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-08
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 5e-08
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 6e-08
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-06
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 6e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 6e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-05
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 8e-08
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 7e-06
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-07
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 4e-07
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 4e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 4e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-05
1uoh_A226 Human Gankyrin Length = 226 4e-07
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 5e-07
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 5e-07
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 5e-06
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 7e-07
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 4e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 7e-07
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 8e-07
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-06
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 8e-06
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 4e-06
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 5e-06
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 6e-06
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 1e-05
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 1e-05
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-05
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 9e-05
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-05
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-04
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 4e-05
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 4e-05
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 5e-05
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 7e-05
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 1e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-04
1ycs_B239 P53-53bp2 Complex Length = 239 2e-04
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-04
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 3e-04
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 3e-04
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 4e-04
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 5e-04
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 5e-04
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 5e-04
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 5e-04
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 5e-04
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 5e-04
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 5e-04
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 6e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure

Iteration: 1

Score = 86.7 bits (213), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 60/157 (38%), Positives = 84/157 (53%), Gaps = 34/157 (21%) Query: 27 ESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAACGGHVDLALLLIERGA 86 +PL LAA GH+++ LL+E GA +VN + +PL LAA GH+++ LL+E GA Sbjct: 3 RTPLHLAARNGHLEVVKLLLEAGA---DVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGA 59 Query: 87 NIEEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKINAHXXXXXXXXXXXXCCGGFLDVAD 146 ++ + G TPL AAR GH E+V +LL+ GA +NA Sbjct: 60 DVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVNAKD--------------------- 98 Query: 147 FLLKNGANIELGASTPLMEAAQEGHLELVRYLLDSGA 183 KNG TPL AA+ GHLE+V+ LL++GA Sbjct: 99 ---KNG-------RTPLHLAARNGHLEVVKLLLEAGA 125
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-55
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-52
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-51
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-50
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-49
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-41
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-30
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-52
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-49
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-45
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-27
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-51
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-48
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-42
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-34
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-30
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-51
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-41
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-32
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-28
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-50
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-49
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-34
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-30
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-23
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-15
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-50
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-43
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-33
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-26
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-19
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-49
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-48
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-47
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-33
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-26
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-47
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-40
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-39
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-34
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-47
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-43
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-46
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-46
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-45
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-34
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-46
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-44
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-36
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-23
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-46
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-38
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-27
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-46
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-42
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-28
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-45
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-44
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-33
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-29
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-27
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-45
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-33
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-44
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-44
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-37
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-37
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-33
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-38
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-31
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-43
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-39
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-43
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-41
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-28
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-25
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-43
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-38
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-26
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-43
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-39
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-38
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-34
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-29
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-23
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-43
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-43
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-42
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-41
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-34
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-25
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-22
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-43
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-28
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-42
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-36
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-28
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-42
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-39
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-37
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-32
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-30
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-29
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-41
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-38
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-36
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-31
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-29
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-20
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-41
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-33
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-20
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-41
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-41
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-41
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-32
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-41
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-40
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-37
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-34
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-23
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-40
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-28
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-28
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-39
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-34
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-33
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-38
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-33
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-15
2rfa_A232 Transient receptor potential cation channel subfa 6e-38
2rfa_A232 Transient receptor potential cation channel subfa 1e-31
2rfa_A232 Transient receptor potential cation channel subfa 2e-22
2rfa_A232 Transient receptor potential cation channel subfa 9e-20
2rfa_A232 Transient receptor potential cation channel subfa 2e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-37
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-29
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-37
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-26
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-35
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-24
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-35
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-28
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-23
2etb_A256 Transient receptor potential cation channel subfam 6e-34
2etb_A256 Transient receptor potential cation channel subfam 3e-25
2etb_A256 Transient receptor potential cation channel subfam 1e-24
2etb_A256 Transient receptor potential cation channel subfam 3e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-33
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-30
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-27
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-22
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-17
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-30
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-29
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-08
2pnn_A273 Transient receptor potential cation channel subfa 8e-30
2pnn_A273 Transient receptor potential cation channel subfa 2e-25
2pnn_A273 Transient receptor potential cation channel subfa 9e-16
2pnn_A273 Transient receptor potential cation channel subfa 1e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-29
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-26
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-25
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-24
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-22
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-28
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-28
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-29
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-27
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-26
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-25
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-21
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-08
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  185 bits (472), Expect = 4e-55
 Identities = 63/192 (32%), Positives = 88/192 (45%), Gaps = 20/192 (10%)

Query: 8   SPLTLAACGGH-------------VNMPTDSFESPLTLAACGGHVDLALLLIERGANIEE 54
           +PL +AA  GH                 T    +PL +AA  G V +A LL+ER A+   
Sbjct: 115 TPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHP-- 172

Query: 55  VNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNDEGYTPLMEAAREGHEEMVCVL 114
            N    +  +PL +A    ++D+  LL+ RG +       GYTPL  AA++   E+   L
Sbjct: 173 -NAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSL 231

Query: 115 LQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIELGAS---TPLMEAAQEGH 171
           LQ G   NA + +   T L LA   G  ++   LL   AN  LG     TPL   AQEGH
Sbjct: 232 LQYGGSANAESVQ-GVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGH 290

Query: 172 LELVRYLLDSGA 183
           + +   L+  G 
Sbjct: 291 VPVADVLIKHGV 302


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1awc_B153 Protein (GA binding protein beta 1); complex (tran 100.0
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.98
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.98
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.93
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.93
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.92
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.91
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.9
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.9
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.87
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.86
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.82
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.8
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 88.62
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 84.21
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
Probab=100.00  E-value=4.8e-38  Score=281.32  Aligned_cols=198  Identities=27%  Similarity=0.273  Sum_probs=172.1

Q ss_pred             CCCCCCccHHHHHHcCCC----------------CCCCCCCCChHHHHHHHcCCHHHHHHHHHcCCCCCCcCCCCCCCCh
Q psy5490           1 MPTDSFESPLTLAACGGH----------------VNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFES   64 (352)
Q Consensus         1 ~~~~~g~t~L~lA~~~~~----------------~n~~d~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~n~~~~~g~t   64 (352)
                      ++|.+|+|+||+|+..|+                +|..|..|+||||+|+..|+.+++++|+++|+++   +..+..|+|
T Consensus         4 ~~d~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~---~~~~~~g~t   80 (282)
T 1oy3_D            4 YVTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGV---LVAERGGHT   80 (282)
T ss_dssp             CCCTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCS---SCCCTTSCC
T ss_pred             ccCCCCCcHHHHHHHcCCHHHHHHHHhcCCCcccccccCCCCCCHHHHHHHcCCHHHHHHHHHcCCCC---CCCCCCCCC
Confidence            468999999999997664                5667889999999999999999999999999995   667789999


Q ss_pred             HHHHHHHcCCHHHHHHHHHcCCC-----------------------------------------------CCCcCCCCCh
Q psy5490          65 PLTLAACGGHVDLALLLIERGAN-----------------------------------------------IEEVNDEGYT   97 (352)
Q Consensus        65 ~Lh~A~~~g~~~~v~~Ll~~g~~-----------------------------------------------~~~~d~~G~t   97 (352)
                      |||+|+..|+.+++++|+++|++                                               ++.++..|+|
T Consensus        81 pL~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~t  160 (282)
T 1oy3_D           81 ALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHT  160 (282)
T ss_dssp             HHHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCC
T ss_pred             HHHHHHHcCCcchhHhhhccCCCCchhhHHHHhhcccccCcchhcchhhhccccccchhhhhhhhhhhhcCCCcCCCCcC
Confidence            99999999999999999998765                                               6778899999


Q ss_pred             HHHHHHHcCcHHHHHHHHhcCCCcccccccccCcHHHHHHHcCCHHHHHHHHHcCCCCCC---CCCCHHHHHHHcCCHHH
Q psy5490          98 PLMEAAREGHEEMVCVLLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIEL---GASTPLMEAAQEGHLEL  174 (352)
Q Consensus        98 ~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~---~g~t~L~~A~~~~~~~~  174 (352)
                      |||+|+..|+.+++++|+++|++++...+..|+||||+|+..|+.+++++|+++|++++.   .|+||||+|+..|+.++
T Consensus       161 ~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~tpL~~A~~~~~~~~v~~Ll~~gad~~~~d~~g~tpL~~A~~~~~~~~  240 (282)
T 1oy3_D          161 PLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPIL  240 (282)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcCHHHHHHHcCCHHHHHHHHHcCCCCcccccCCCCHHHHHHHcCCcHH
Confidence            999999999999999999999999986555699999999999999999999999999865   68999999999999999


Q ss_pred             HHHHHHcCCCccccccccHHHHHHHhh
Q psy5490         175 VRYLLDSGAQEMQTKHIDILEFKKRKQ  201 (352)
Q Consensus       175 v~~Ll~~ga~~~~~~~~~~~~~~~~~~  201 (352)
                      +++|+++|++....+..+.+++.....
T Consensus       241 v~~Ll~~ga~~~~~~~~g~tpl~~a~~  267 (282)
T 1oy3_D          241 ARLLRAHGAPEPEDGGDKLSPCSSSGS  267 (282)
T ss_dssp             HHHHHHTTCCCCCCC------------
T ss_pred             HHHHHHcCCCcCcCCCcccccccccCC
Confidence            999999999999999888888765543



>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 352
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-31
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-24
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-24
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-21
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-21
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-25
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-24
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-16
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-25
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-24
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-23
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-18
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-22
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-14
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-21
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-16
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-16
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-15
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-15
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-14
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-13
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-13
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 9e-11
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-12
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-11
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-08
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 7e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.003
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 1e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 6e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  120 bits (302), Expect = 1e-31
 Identities = 53/190 (27%), Positives = 81/190 (42%), Gaps = 38/190 (20%)

Query: 29  PLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESPLTLAACGGHVDLALLLIERGANI 88
           PL +A+  GH+ +   L++RGA+    N+     E+PL +AA  GH ++A  L++  A +
Sbjct: 3   PLHVASFMGHLPIVKNLLQRGAS---PNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKV 59

Query: 89  EEVNDEGYTPLMEAAREGHEEMVCVLLQKGAKINAHTE---------------------- 126
                +  TPL  AAR GH  MV +LL+  A  N  T                       
Sbjct: 60  NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALL 119

Query: 127 ----------ETQETALTLACCGGFLDVADFLLKNGANIELGAS---TPLMEAAQEGHLE 173
                     +   T L +A   G + VA+ LL+  A+         TPL  A    +L+
Sbjct: 120 EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLD 179

Query: 174 LVRYLLDSGA 183
           +V+ LL  G 
Sbjct: 180 IVKLLLPRGG 189


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.98
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.95
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.92
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.91
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.87
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.87
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=2.5e-36  Score=264.52  Aligned_cols=182  Identities=30%  Similarity=0.307  Sum_probs=162.8

Q ss_pred             CCCCCccHHHHHHcCCC----------------CCCCCCCCChHHHHHHHcCCHHHHHHHHHcCCCCCCcCCCCCCCChH
Q psy5490           2 PTDSFESPLTLAACGGH----------------VNMPTDSFESPLTLAACGGHVDLALLLIERGANIEEVNMPTDSFESP   65 (352)
Q Consensus         2 ~~~~g~t~L~lA~~~~~----------------~n~~d~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~n~~~~~g~t~   65 (352)
                      -|++|+||||+||..++                +|..|..|+||||+||..|+.+++++|+++|+++   +.+|..|+||
T Consensus         5 i~~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i---~~~d~~g~tp   81 (255)
T d1oy3d_           5 VTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGV---LVAERGGHTA   81 (255)
T ss_dssp             CCTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCS---SCCCTTSCCH
T ss_pred             CCcCCCCHHHHHHHcCCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhcccccccccccccccc---cccccccchh
Confidence            38899999999997665                3455789999999999999999999999999995   6677999999


Q ss_pred             HHHHHHcCCHHHHHHHHHcCC-----------------------------------------------CCCCcCCCCChH
Q psy5490          66 LTLAACGGHVDLALLLIERGA-----------------------------------------------NIEEVNDEGYTP   98 (352)
Q Consensus        66 Lh~A~~~g~~~~v~~Ll~~g~-----------------------------------------------~~~~~d~~G~t~   98 (352)
                      ||+|+..++.+++++|++.+.                                               +++.+|.+|+||
T Consensus        82 L~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~Tp  161 (255)
T d1oy3d_          82 LHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTP  161 (255)
T ss_dssp             HHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCH
T ss_pred             hhhhhccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCccc
Confidence            999999999999999876432                                               134567889999


Q ss_pred             HHHHHHcCcHHHHHHHHhcCCCcccccccccCcHHHHHHHcCCHHHHHHHHHcCCCCCC---CCCCHHHHHHHcCCHHHH
Q psy5490          99 LMEAAREGHEEMVCVLLQKGAKINAHTEETQETALTLACCGGFLDVADFLLKNGANIEL---GASTPLMEAAQEGHLELV  175 (352)
Q Consensus        99 L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~---~g~t~L~~A~~~~~~~~v  175 (352)
                      ||+|+..++.+++++|++++++.+...+..|.||||+|+..|+.+++++|+++|++++.   .|+||||+|+..++.+++
T Consensus       162 Lh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~~~i~  241 (255)
T d1oy3d_         162 LHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILA  241 (255)
T ss_dssp             HHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHHH
T ss_pred             ccccccccccccccchhcccccccccccccccccccccccccHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHH
Confidence            99999999999999999999999876778899999999999999999999999999865   688999999999999999


Q ss_pred             HHHHHcCCCcc
Q psy5490         176 RYLLDSGAQEM  186 (352)
Q Consensus       176 ~~Ll~~ga~~~  186 (352)
                      ++|+++||+..
T Consensus       242 ~~Ll~~Ga~~~  252 (255)
T d1oy3d_         242 RLLRAHGAPEP  252 (255)
T ss_dssp             HHHHHTTCCCC
T ss_pred             HHHHHcCCCCC
Confidence            99999999743



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure