Psyllid ID: psy5535

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MPTWNQIQSQLRNQNNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQCGQM
cccHHHHHHHHcccccccEEEEEEEccEEEcEEEEEEcccccccHHHHHHHHHcccccccccccccccccccEEEcccEEEccccccccccccccccccccccccccccccccccEEEccccccccccccEEEEcccccccccccEEEEEEEEcHHHHHHHHHccccccccccccEEEEEcccc
ccccHHHccccccccccEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHcccEEccEEccccccEccEEEcccEEEEccccccccccccccccEccEcccccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHcccEcccccEcccEEEEEEEEE
MPTWNQIQSQlrnqnnpvvfFDISVGATEIGRMIFELFAdvvpktsenFRQFCTgefrrdavpigfkgaSFHRVIKDFMIqggdfvngdgtglmsiygggtfadenftlkhdapgllsmansgkdtngcQFFITCaqcnfldgkhvvfGRVLDGLIVMRkienvptgpnnkpkipVIISQCGQM
MPTWNQIQSqlrnqnnpvVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKienvptgpnnkpkipviisqcgqm
MPTWNQIQSQLRNQNNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQCGQM
***************NPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENV********************
******************VFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMR****************VIISQCGQM
*********QLRNQNNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQCGQM
**************NNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQCGQM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTWNQIQSQLRNQNNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQCGQM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
O43447177 Peptidyl-prolyl cis-trans yes N/A 0.913 0.949 0.798 7e-79
Q0P5D0177 Peptidyl-prolyl cis-trans yes N/A 0.913 0.949 0.798 7e-79
P52018183 Peptidyl-prolyl cis-trans yes N/A 0.994 1.0 0.663 2e-72
P0C1I3178 Peptidyl-prolyl cis-trans N/A N/A 0.913 0.943 0.702 4e-69
Q9D868188 Peptidyl-prolyl cis-trans no N/A 0.793 0.776 0.789 4e-66
P0CP82179 Peptidyl-prolyl cis-trans yes N/A 0.923 0.949 0.666 7e-63
P0CP83179 Peptidyl-prolyl cis-trans N/A N/A 0.923 0.949 0.666 7e-63
Q4P6X6156 Peptidyl-prolyl cis-trans N/A N/A 0.847 1.0 0.694 3e-59
Q5AQL0183 Peptidyl-prolyl cis-trans yes N/A 0.918 0.923 0.637 8e-59
Q7SG06182 Peptidyl-prolyl cis-trans N/A N/A 0.945 0.956 0.610 3e-57
>sp|O43447|PPIH_HUMAN Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens GN=PPIH PE=1 SV=1 Back     alignment and function desciption
 Score =  292 bits (748), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 135/169 (79%), Positives = 156/169 (92%), Gaps = 1/169 (0%)

Query: 16  NPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVI 75
           NPVVFFD+S+G  E+GRM  ELFADVVPKT+ENFRQFCTGEFR+D VPIG+KG++FHRVI
Sbjct: 10  NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVI 69

Query: 76  KDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITC 135
           KDFMIQGGDFVNGDGTG+ SIY G  FADENF L+H APGLLSMANSG  TNGCQFFITC
Sbjct: 70  KDFMIQGGDFVNGDGTGVASIYRG-PFADENFKLRHSAPGLLSMANSGPSTNGCQFFITC 128

Query: 136 AQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQCGQM 184
           ++C++LDGKHVVFG+++DGL+VMRKIENVPTGPNNKPK+PV+ISQCG+M
Sbjct: 129 SKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex. May act as a chaperone.
Homo sapiens (taxid: 9606)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q0P5D0|PPIH_BOVIN Peptidyl-prolyl cis-trans isomerase H OS=Bos taurus GN=PPIH PE=2 SV=1 Back     alignment and function description
>sp|P52018|CYP11_CAEEL Peptidyl-prolyl cis-trans isomerase 11 OS=Caenorhabditis elegans GN=cyn-11 PE=2 SV=1 Back     alignment and function description
>sp|P0C1I3|PPIH_RHIO9 Peptidyl-prolyl cis-trans isomerase H OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp7 PE=3 SV=1 Back     alignment and function description
>sp|Q9D868|PPIH_MOUSE Peptidyl-prolyl cis-trans isomerase H OS=Mus musculus GN=Ppih PE=2 SV=1 Back     alignment and function description
>sp|P0CP82|PPIH_CRYNJ Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP3 PE=3 SV=1 Back     alignment and function description
>sp|P0CP83|PPIH_CRYNB Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP3 PE=3 SV=1 Back     alignment and function description
>sp|Q4P6X6|PPIH_USTMA Peptidyl-prolyl cis-trans isomerase H (Fragment) OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP3 PE=3 SV=2 Back     alignment and function description
>sp|Q5AQL0|PPIH_EMENI Peptidyl-prolyl cis-trans isomerase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp3 PE=3 SV=2 Back     alignment and function description
>sp|Q7SG06|PPIH_NEUCR Peptidyl-prolyl cis-trans isomerase H OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
389609995184 peptidyl-prolyl cis-trans isomerase h, p 1.0 1.0 0.896 2e-95
357609456184 hypothetical protein KGM_08223 [Danaus p 1.0 1.0 0.896 4e-95
242004770184 peptidyl-prolyl cis-trans isomerase H, p 1.0 1.0 0.891 9e-95
110755171184 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 1.0 0.891 3e-94
383848460184 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 1.0 0.885 7e-94
307175669184 Peptidyl-prolyl cis-trans isomerase H [C 1.0 1.0 0.885 8e-94
340711335184 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 1.0 0.885 2e-93
307209777184 Peptidyl-prolyl cis-trans isomerase H [H 1.0 1.0 0.880 3e-93
322795667184 hypothetical protein SINV_04316 [Solenop 1.0 1.0 0.880 1e-92
332375524184 unknown [Dendroctonus ponderosae] 1.0 1.0 0.875 2e-92
>gi|389609995|dbj|BAM18609.1| peptidyl-prolyl cis-trans isomerase h, ppih [Papilio xuthus] Back     alignment and taxonomy information
 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 165/184 (89%), Positives = 177/184 (96%)

Query: 1   MPTWNQIQSQLRNQNNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRD 60
           MPTWNQIQSQLRN NNPVVFFD++VG TEIGRMIFELFADVVPKTSENFR+FCTGE+RRD
Sbjct: 1   MPTWNQIQSQLRNPNNPVVFFDVTVGTTEIGRMIFELFADVVPKTSENFREFCTGEYRRD 60

Query: 61  AVPIGFKGASFHRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMA 120
            VP+G+KGA+FHRVIKDFMIQGGDFVNGDGTG+MSIYGG TFADENF LKHD+PGLLSMA
Sbjct: 61  GVPLGYKGATFHRVIKDFMIQGGDFVNGDGTGVMSIYGGSTFADENFALKHDSPGLLSMA 120

Query: 121 NSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQ 180
           NSGKDTNGCQFFITCA+CNFLD KHVVFGRV+DGL+VMRKIENVPTGPNNKPKIPV ISQ
Sbjct: 121 NSGKDTNGCQFFITCAKCNFLDNKHVVFGRVIDGLLVMRKIENVPTGPNNKPKIPVTISQ 180

Query: 181 CGQM 184
           CGQM
Sbjct: 181 CGQM 184

Source: Papilio xuthus

Species: Papilio xuthus

Genus: Papilio

Family: Papilionidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357609456|gb|EHJ66459.1| hypothetical protein KGM_08223 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242004770|ref|XP_002423251.1| peptidyl-prolyl cis-trans isomerase H, putative [Pediculus humanus corporis] gi|212506237|gb|EEB10513.1| peptidyl-prolyl cis-trans isomerase H, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|110755171|ref|XP_001120773.1| PREDICTED: peptidyl-prolyl cis-trans isomerase H-like [Apis mellifera] gi|380030322|ref|XP_003698798.1| PREDICTED: peptidyl-prolyl cis-trans isomerase H-like isoform 1 [Apis florea] gi|380030324|ref|XP_003698799.1| PREDICTED: peptidyl-prolyl cis-trans isomerase H-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|383848460|ref|XP_003699868.1| PREDICTED: peptidyl-prolyl cis-trans isomerase H-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307175669|gb|EFN65557.1| Peptidyl-prolyl cis-trans isomerase H [Camponotus floridanus] gi|332020896|gb|EGI61294.1| Peptidyl-prolyl cis-trans isomerase H [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340711335|ref|XP_003394232.1| PREDICTED: peptidyl-prolyl cis-trans isomerase H-like [Bombus terrestris] gi|350411923|ref|XP_003489491.1| PREDICTED: peptidyl-prolyl cis-trans isomerase H-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307209777|gb|EFN86591.1| Peptidyl-prolyl cis-trans isomerase H [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322795667|gb|EFZ18346.1| hypothetical protein SINV_04316 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332375524|gb|AEE62903.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
FB|FBgn0033089183 CG17266 [Drosophila melanogast 0.994 1.0 0.864 1.8e-87
UNIPROTKB|E1BXG0177 PPIH "Peptidyl-prolyl cis-tran 0.929 0.966 0.796 1.9e-76
UNIPROTKB|Q0P5D0177 PPIH "Peptidyl-prolyl cis-tran 0.913 0.949 0.798 2.1e-75
UNIPROTKB|E2R198177 PPIH "Peptidyl-prolyl cis-tran 0.913 0.949 0.798 2.1e-75
UNIPROTKB|O43447177 PPIH "Peptidyl-prolyl cis-tran 0.913 0.949 0.798 2.1e-75
UNIPROTKB|F1SF95177 PPIH "Peptidyl-prolyl cis-tran 0.913 0.949 0.792 9.3e-75
WB|WBGene00000887183 cyn-11 [Caenorhabditis elegans 0.994 1.0 0.663 4.9e-69
UNIPROTKB|I3L6I7188 PPIH "Peptidyl-prolyl cis-tran 0.836 0.819 0.761 4.7e-64
UNIPROTKB|C9JQD4144 PPIH "Peptidyl-prolyl cis-tran 0.782 1.0 0.806 6e-64
TAIR|locus:2064153199 AT2G38730 [Arabidopsis thalian 0.929 0.859 0.682 9.7e-64
FB|FBgn0033089 CG17266 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 874 (312.7 bits), Expect = 1.8e-87, P = 1.8e-87
 Identities = 159/184 (86%), Positives = 172/184 (93%)

Query:     1 MPTWNQIQSQLRNQNNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRD 60
             MP WNQIQSQLR+ NNPVVFFDI+VG TEIGRMIFELFAD VP+T+ENFRQFCTGE+R D
Sbjct:     1 MPNWNQIQSQLRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPD 60

Query:    61 AVPIGFKGASFHRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMA 120
              VPIG+KGASFHRVIKDFMIQGGDFV GDGTG+ SIYG  TF DENFTLKHD+PGLLSMA
Sbjct:    61 GVPIGYKGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGN-TFGDENFTLKHDSPGLLSMA 119

Query:   121 NSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQ 180
             NSGK+TNGCQFFITCA+CNFLDGKHVVFGRVLDGL++MRKIENVPTGPNNKPK+PV ISQ
Sbjct:   120 NSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQ 179

Query:   181 CGQM 184
             CGQM
Sbjct:   180 CGQM 183
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0006457 "protein folding" evidence=IEA
GO:0071011 "precatalytic spliceosome" evidence=IDA
UNIPROTKB|E1BXG0 PPIH "Peptidyl-prolyl cis-trans isomerase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0P5D0 PPIH "Peptidyl-prolyl cis-trans isomerase H" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R198 PPIH "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43447 PPIH "Peptidyl-prolyl cis-trans isomerase H" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SF95 PPIH "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00000887 cyn-11 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6I7 PPIH "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|C9JQD4 PPIH "Peptidyl-prolyl cis-trans isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2064153 AT2G38730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9D868PPIH_MOUSE5, ., 2, ., 1, ., 80.78910.79340.7765noN/A
Q39613CYPH_CATRO5, ., 2, ., 1, ., 80.54970.90760.9709N/AN/A
O43447PPIH_HUMAN5, ., 2, ., 1, ., 80.79880.91300.9491yesN/A
O74729PPIH_SCHPO5, ., 2, ., 1, ., 80.59300.92930.9884yesN/A
P0C1I3PPIH_RHIO95, ., 2, ., 1, ., 80.70230.91300.9438N/AN/A
Q26516PPIE_SCHJA5, ., 2, ., 1, ., 80.52220.94020.9664N/AN/A
Q4P6X6PPIH_USTMA5, ., 2, ., 1, ., 80.69420.84781.0N/AN/A
Q2UGK2PPIB_ASPOR5, ., 2, ., 1, ., 80.51080.96730.9270noN/A
Q7SG06PPIH_NEUCR5, ., 2, ., 1, ., 80.61010.94560.9560N/AN/A
Q38900CP19A_ARATH5, ., 2, ., 1, ., 80.54380.90760.9653noN/A
Q9SKQ0CP19B_ARATH5, ., 2, ., 1, ., 80.52900.91300.9655noN/A
Q0P5D0PPIH_BOVIN5, ., 2, ., 1, ., 80.79880.91300.9491yesN/A
P0C1H7PPIA1_RHIO95, ., 2, ., 1, ., 80.57640.88580.9939N/AN/A
P52018CYP11_CAEEL5, ., 2, ., 1, ., 80.66300.99451.0yesN/A
Q6CL78PPID_KLULA5, ., 2, ., 1, ., 80.54020.91840.4543yesN/A
P73789PPI2_SYNY35, ., 2, ., 1, ., 80.55350.89130.9590N/AN/A
Q8W171CYP1_SOYBN5, ., 2, ., 1, ., 80.56470.90210.9651noN/A
O49886CYPH_LUPLU5, ., 2, ., 1, ., 80.53480.91300.9767N/AN/A
Q5AQL0PPIH_EMENI5, ., 2, ., 1, ., 80.63740.91840.9234yesN/A
P0CP83PPIH_CRYNB5, ., 2, ., 1, ., 80.66660.92390.9497N/AN/A
P0CP82PPIH_CRYNJ5, ., 2, ., 1, ., 80.66660.92390.9497yesN/A
Q4WCM6PPIH_ASPFU5, ., 2, ., 1, ., 80.61450.96190.9779yesN/A
Q54SM3PPIA_DICDI5, ., 2, ., 1, ., 80.54970.90760.9329noN/A
Q6CBP4PPID_YARLI5, ., 2, ., 1, ., 80.56720.91300.4577yesN/A
Q2TZ33PPIH_ASPOR5, ., 2, ., 1, ., 80.62350.91300.9281yesN/A
Q5B4E7PPID_EMENI5, ., 2, ., 1, ., 80.58520.93470.4623yesN/A
Q4IPH4PPIH_GIBZE5, ., 2, ., 1, ., 80.59210.95650.9670yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.983
4th Layer5.2.1.80.979

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 1e-106
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 1e-102
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 2e-71
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 3e-59
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 2e-53
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 3e-53
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 4e-45
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 6e-45
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 3e-44
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 3e-37
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 1e-33
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 6e-33
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 5e-26
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 1e-18
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 3e-13
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 4e-13
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 3e-08
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information 
 Score =  299 bits (769), Expect = e-106
 Identities = 104/166 (62%), Positives = 127/166 (76%), Gaps = 2/166 (1%)

Query: 17  PVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIK 76
           P VFFDI++G    GR++ ELFADVVPKT+ENFR  CTGE  +   P G+KG++FHRVI 
Sbjct: 1   PKVFFDITIGGEPAGRIVMELFADVVPKTAENFRALCTGEKGKGGKPFGYKGSTFHRVIP 60

Query: 77  DFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCA 136
           DFMIQGGDF  G+GTG  SIY G  F DENF LKH  PGLLSMAN+G +TNG QFFIT  
Sbjct: 61  DFMIQGGDFTRGNGTGGKSIY-GEKFPDENFKLKHTGPGLLSMANAGPNTNGSQFFITTV 119

Query: 137 QCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQCG 182
           +  +LDGKHVVFG+V++G+ V++KIENV +G N KPK  V+I+ CG
Sbjct: 120 KTPWLDGKHVVFGKVVEGMDVVKKIENVGSG-NGKPKKKVVIADCG 164

This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. These enzymes have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. As cyclophilins, Human hCyP-A, human cyclophilin-B (hCyP-19), S. cerevisiae Cpr1 and C. elegans Cyp-3, are inhibited by the immunosuppressive drug cyclopsporin A (CsA). CsA binds to the PPIase active site. Cyp-3. S. cerevisiae Cpr1 interacts with the Rpd3 - Sin3 complex and in addition is a component of the Set3 complex. S. cerevisiae Cpr1 has also been shown to have a role in Zpr1p nuclear transport. Human cyclophilin H associates with the [U4/U6.U5] tri-snRNP particles of the splicesome. Length = 164
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
KOG0546|consensus 372 100.0
KOG0880|consensus217 100.0
KOG0879|consensus177 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
PTZ00221249 cyclophilin; Provisional 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PTZ00060183 cyclophilin; Provisional 100.0
KOG0111|consensus298 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
KOG0881|consensus164 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
KOG0883|consensus518 100.0
KOG0882|consensus558 100.0
KOG0884|consensus161 100.0
KOG0865|consensus167 100.0
KOG0885|consensus 439 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
KOG0415|consensus 479 100.0
PRK00969 508 hypothetical protein; Provisional 97.72
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 97.71
KOG0882|consensus 558 97.62
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 97.47
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 97.06
PRK00969508 hypothetical protein; Provisional 96.81
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 96.02
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 95.06
>KOG0546|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.7e-61  Score=392.38  Aligned_cols=170  Identities=61%  Similarity=1.021  Sum_probs=165.6

Q ss_pred             CCCCeEEEEEEeCCeeeeeEEEEEecCCChhhHHHHHHHhcCCCcC---CCccccccCCEEEEEEeCceeeeccccCCCC
Q psy5535          14 QNNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRR---DAVPIGFKGASFHRVIKDFMIQGGDFVNGDG   90 (184)
Q Consensus        14 ~~~~~v~~~~~~~~~~~G~ivieL~~~~aP~~~~nF~~L~~~~~~~---~~~~~~Y~~~~f~ri~~~~~iq~G~~~~~~~   90 (184)
                      ..+|+|||||+|++.+.|||+||||.|+||+||+||+.||+|..|.   .+++|+|+|+.||||+++|||||||++.++|
T Consensus         6 ~~~pr~ffDISI~ge~~GRIvfeLf~dv~PKTaENFraLCtGE~G~~~~~gk~L~YKG~~FHRViK~FMiQgGDfs~gnG   85 (372)
T KOG0546|consen    6 RTNPRVFFDISIGGEPAGRIVFELFNDVVPKTAENFRALCTGEKGGGLTTGKPLHYKGSRFHRVIKNFMIQGGDFSEGNG   85 (372)
T ss_pred             CCCceEEEEEEeCCcccceEEEEeecccCchhHHHHHHHhccccCCCCCCCCeeeecCchhheeeecceeeccccccCCC
Confidence            3789999999999999999999999999999999999999999974   3789999999999999999999999999999


Q ss_pred             CCcccccCCCcccCCCCCCCCCCCceEeeeccCCCCCcceEEEEeCCCCCCCCCceEEEEEEcCHHHHHHhhcCCCCCCC
Q psy5535          91 TGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNN  170 (184)
Q Consensus        91 ~~~~~~~~~~~~~~e~~~~~~~~~G~v~~~~~~~~~~~s~F~I~l~~~~~ld~~~~vfG~V~~G~~vl~~i~~~~~~~~~  170 (184)
                      +|++|||| ++|+||+|.++|+++++|+|||.|||+||||||||+.++|+||++|+|||+||+|++||+.|+.+.+++..
T Consensus        86 tGGeSIYG-~~FdDEnF~lKHdrpflLSMAN~GpNTNgSQFFITT~p~PHLdGkHVVFGqVI~G~~VVr~IEn~~~d~~s  164 (372)
T KOG0546|consen   86 TGGESIYG-EKFDDENFELKHDRPFLLSMANRGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGKEVVREIENLETDEES  164 (372)
T ss_pred             CCcccccc-cccccccceeccCcchhhhhhcCCCCCCCcceEEeCCCCCCcCCceeEEeeEeechhHHHHHhccccccCC
Confidence            99999999 99999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCeEEeeeeeC
Q psy5535         171 KPKIPVIISQCGQM  184 (184)
Q Consensus       171 ~P~~~i~I~~cG~L  184 (184)
                      +|..+|+|.+||+|
T Consensus       165 kP~~dV~I~dCGel  178 (372)
T KOG0546|consen  165 KPLADVVISDCGEL  178 (372)
T ss_pred             CCccceEecccccc
Confidence            99999999999997

>KOG0880|consensus Back     alignment and domain information
>KOG0879|consensus Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>KOG0881|consensus Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>KOG0883|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG0884|consensus Back     alignment and domain information
>KOG0865|consensus Back     alignment and domain information
>KOG0885|consensus Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 6e-80
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 2e-58
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 3e-49
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 3e-48
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 4e-48
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 6e-48
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 1e-47
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 5e-47
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 1e-46
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 7e-46
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 2e-45
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 4e-45
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 4e-45
1dyw_A173 Biochemical And Structural Characterization Of A Di 7e-45
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 9e-45
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 1e-44
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 1e-44
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 1e-44
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 1e-44
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 1e-44
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 3e-44
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 3e-44
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 8e-44
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 9e-44
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 1e-43
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 2e-43
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 2e-43
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 2e-43
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 3e-43
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 3e-43
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 3e-43
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 3e-43
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 5e-43
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 5e-43
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 6e-43
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 6e-43
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 6e-43
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 6e-43
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 8e-43
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 9e-43
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 1e-42
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 1e-42
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 1e-42
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 3e-42
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 3e-41
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 6e-41
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 1e-40
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 2e-40
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 2e-40
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 3e-40
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 6e-40
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 7e-40
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 1e-37
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 5e-35
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 1e-25
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 1e-25
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 2e-25
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 3e-25
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 1e-22
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 1e-22
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 3e-22
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 9e-22
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 3e-21
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 6e-21
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 6e-19
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 4e-18
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 1e-17
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 1e-12
2ose_A234 Crystal Structure Of The Mimivirus Cyclophilin Leng 6e-11
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 1e-10
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 1e-10
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 6e-09
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 7e-09
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 3e-08
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 6e-08
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure 
Iteration: 1

 Score =  292 bits (748), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 135/169 (79%), Positives = 156/169 (92%), Gaps = 1/169 (0%)
Query: 16  NPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVI 75
           NPVVFFD+S+G  E+GRM  ELFADVVPKT+ENFRQFCTGEFR+D VPIG+KG++FHRVI
Sbjct: 10  NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVI 69
Query: 76  KDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITC 135
           KDFMIQGGDFVNGDGTG+ SIY G  FADENF L+H APGLLSMANSG  TNGCQFFITC
Sbjct: 70  KDFMIQGGDFVNGDGTGVASIYRG-PFADENFKLRHSAPGLLSMANSGPSTNGCQFFITC 128
Query: 136 AQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQCGQM 184
           ++C++LDGKHVVFG+++DGL+VMRKIENVPTGPNNKPK+PV+ISQCG+M
Sbjct: 129 SKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|2OSE|A Chain A, Crystal Structure Of The Mimivirus Cyclophilin Length = 234 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 1e-112
1z81_A229 Cyclophilin; structural genomics, structural genom 1e-110
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 1e-109
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 1e-109
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 1e-109
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-105
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-104
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-103
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 1e-102
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 1e-101
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 1e-100
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 1e-100
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 1e-100
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 2e-98
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 5e-97
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 1e-95
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 1e-94
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 1e-93
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 7e-92
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 4e-70
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 4e-69
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-68
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 1e-67
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 2e-67
2b71_A196 Cyclophilin-like protein; structural genomics, str 1e-65
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 5e-62
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 2e-59
2hq6_A185 Serologically defined colon cancer antigen 10; pro 5e-58
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 1e-57
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 3e-55
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 6e-52
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 2e-38
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 1e-37
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 2e-36
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 6e-29
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
 Score =  315 bits (810), Expect = e-112
 Identities = 135/173 (78%), Positives = 157/173 (90%), Gaps = 1/173 (0%)

Query: 12  RNQNNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASF 71
            +  NPVVFFD+S+G  E+GRM  ELFADVVPKT+ENFRQFCTGEFR+D VPIG+KG++F
Sbjct: 6   SSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTF 65

Query: 72  HRVIKDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQF 131
           HRVIKDFMIQGGDFVNGDGTG+ SIY G  FADENF L+H APGLLSMANSG  TNGCQF
Sbjct: 66  HRVIKDFMIQGGDFVNGDGTGVASIYRG-PFADENFKLRHSAPGLLSMANSGPSTNGCQF 124

Query: 132 FITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQCGQM 184
           FITC++C++LDGKHVVFG+++DGL+VMRKIENVPTGPNNKPK+PV+ISQCG+M
Sbjct: 125 FITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
2nnz_A153 Hypothetical protein; beta-barrel, structural geno 94.39
3kop_A188 Uncharacterized protein; protein with A cyclophili 91.79
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
Probab=100.00  E-value=4.8e-57  Score=346.73  Aligned_cols=174  Identities=78%  Similarity=1.375  Sum_probs=165.6

Q ss_pred             hhccCCCCeEEEEEEeCCeeeeeEEEEEecCCChhhHHHHHHHhcCCCcCCCccccccCCEEEEEEeCceeeeccccCCC
Q psy5535          10 QLRNQNNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIKDFMIQGGDFVNGD   89 (184)
Q Consensus        10 ~~~~~~~~~v~~~~~~~~~~~G~ivieL~~~~aP~~~~nF~~L~~~~~~~~~~~~~Y~~~~f~ri~~~~~iq~G~~~~~~   89 (184)
                      ...++.+|+||||++++++++|+|+||||++.||++|+||++||+++++.++++++|+++.|||++|+|+||+||+..++
T Consensus         4 ~~~~~~~~~v~~di~i~~t~~G~i~ieL~~~~aP~t~~NF~~L~~~~~g~~g~~~~Y~g~~FhRvi~~f~iQgGd~~~~~   83 (177)
T 1mzw_A            4 ANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGD   83 (177)
T ss_dssp             -CCCCCCCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHTCCEETTEECSSTTCBCCEEETTTEEEECCTTTSS
T ss_pred             cccCCCCCEEEEEEEECCeeceeEEEEEcCCCCcHHHHHHHHHHhcccCCcCccceECCCEEEEEECCCEEEcCCcccCC
Confidence            34577899999999999999999999999999999999999999999877677788999999999999999999998788


Q ss_pred             CCCcccccCCCcccCCCCCCCCCCCceEeeeccCCCCCcceEEEEeCCCCCCCCCceEEEEEEcCHHHHHHhhcCCCCCC
Q psy5535          90 GTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPN  169 (184)
Q Consensus        90 ~~~~~~~~~~~~~~~e~~~~~~~~~G~v~~~~~~~~~~~s~F~I~l~~~~~ld~~~~vfG~V~~G~~vl~~i~~~~~~~~  169 (184)
                      +.++.++|+ ..+++|++.++|+++|+|+|++.+|++++|||||++.++++||++|+|||+|++|||||++|++++++.+
T Consensus        84 G~gg~si~g-~~f~dE~~~l~h~~~G~lsmAn~gp~tngSQFfIt~~~~~~LDg~~~VFG~Vv~G~dvv~~I~~~~t~~~  162 (177)
T 1mzw_A           84 GTGVASIYR-GPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPN  162 (177)
T ss_dssp             SCCCCCTTS-SCBCCCCCCSCCCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBCGG
T ss_pred             CCCCCccCC-CcccCcccccccCCCCEEEEccCCCCCcceEEEEECCCCCccCCCeeEEEEEeCCHHHHHHHHhCCcCCC
Confidence            899999998 8899999999999999999999999999999999999999999999999999999999999999999889


Q ss_pred             CCCCCCeEEeeeeeC
Q psy5535         170 NKPKIPVIISQCGQM  184 (184)
Q Consensus       170 ~~P~~~i~I~~cG~L  184 (184)
                      ++|.++|+|.+||+|
T Consensus       163 ~~P~~~v~I~~cG~l  177 (177)
T 1mzw_A          163 NKPKLPVVISQCGEM  177 (177)
T ss_dssp             GCBSSCEEEEEEEEC
T ss_pred             CCCCCCEEEEeceeC
Confidence            999999999999997
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 1e-53
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 3e-51
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 6e-51
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 2e-50
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 4e-50
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 1e-49
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 8e-49
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 6e-46
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 2e-45
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 3e-45
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 1e-44
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 3e-44
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 5e-43
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 1e-42
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 8e-42
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 2e-35
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 4e-34
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 8e-33
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 3e-31
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 1e-28
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 9e-25
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-24
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]

 Score =  166 bits (421), Expect = 1e-53
 Identities = 135/169 (79%), Positives = 156/169 (92%), Gaps = 1/169 (0%)

Query: 16  NPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVI 75
           NPVVFFD+S+G  E+GRM  ELFADVVPKT+ENFRQFCTGEFR+D VPIG+KG++FHRVI
Sbjct: 6   NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVI 65

Query: 76  KDFMIQGGDFVNGDGTGLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITC 135
           KDFMIQGGDFVNGDGTG+ SIY G  FADENF L+H APGLLSMANSG  TNGCQFFITC
Sbjct: 66  KDFMIQGGDFVNGDGTGVASIYRG-PFADENFKLRHSAPGLLSMANSGPSTNGCQFFITC 124

Query: 136 AQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNKPKIPVIISQCGQM 184
           ++C++LDGKHVVFG+++DGL+VMRKIENVPTGPNNKPK+PV+ISQCG+M
Sbjct: 125 SKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 173
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1x7fa1117 Outer surface protein, C-terminal domain {Bacillus 83.51
d1zx8a1124 Hypothetical protein TM1367 {Thermotoga maritima [ 82.68
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]

Probab=100.00  E-value=1.5e-50  Score=308.25  Aligned_cols=172  Identities=78%  Similarity=1.397  Sum_probs=158.3

Q ss_pred             ccCCCCeEEEEEEeCCeeeeeEEEEEecCCChhhHHHHHHHhcCCCcCCCccccccCCEEEEEEeCceeeeccccCCCCC
Q psy5535          12 RNQNNPVVFFDISVGATEIGRMIFELFADVVPKTSENFRQFCTGEFRRDAVPIGFKGASFHRVIKDFMIQGGDFVNGDGT   91 (184)
Q Consensus        12 ~~~~~~~v~~~~~~~~~~~G~ivieL~~~~aP~~~~nF~~L~~~~~~~~~~~~~Y~~~~f~ri~~~~~iq~G~~~~~~~~   91 (184)
                      +++.||+||||++++++++|+|+|+||.+.||++|+||++||+.++....+.++|+++.|||++|++++|+|+...+.+.
T Consensus         2 ~~~~np~v~~di~i~~~~~G~i~ieL~~~~aP~tv~nF~~L~~~~~~~~~~~~~y~~~~f~rv~~~~~~q~G~~~~~~~~   81 (173)
T d1qoia_           2 SSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGT   81 (173)
T ss_dssp             CSCCCCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHSCCEETTEECSSTTCBCCEEETTTEEEECCTTTSSSC
T ss_pred             CCCCCCEEEEEEEECCEeCeEEEEEEcCCCCcHHHHHHHHhhcccccccCCCCCcCCcccceeccceeeccCCcccCCcc
Confidence            46789999999999999999999999999999999999999999886666677799999999999999999998766555


Q ss_pred             CcccccCCCcccCCCCCCCCCCCceEeeeccCCCCCcceEEEEeCCCCCCCCCceEEEEEEcCHHHHHHhhcCCCCCCCC
Q psy5535          92 GLMSIYGGGTFADENFTLKHDAPGLLSMANSGKDTNGCQFFITCAQCNFLDGKHVVFGRVLDGLIVMRKIENVPTGPNNK  171 (184)
Q Consensus        92 ~~~~~~~~~~~~~e~~~~~~~~~G~v~~~~~~~~~~~s~F~I~l~~~~~ld~~~~vfG~V~~G~~vl~~i~~~~~~~~~~  171 (184)
                      .....+. ..++++.+...|+++|+|+|+++++++++|||||++++.++||++|+|||+|++|||||++|++++++++++
T Consensus        82 ~~~~~~~-~~~~~~~~~~~~~~~G~l~ma~~~~~s~~sqFfI~~~~~~~ldg~~tvFG~Vi~G~dvl~~I~~~~t~~~~~  160 (173)
T d1qoia_          82 GVASIYR-GPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNK  160 (173)
T ss_dssp             CCCCTTS-SCBCCCCCCSCCCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBCGGGC
T ss_pred             eeecccC-CcccccccccccCCCcEEEeeecCCCCCCceeeeeccCCccCCcceeEEEEEechHHHHHHHHhCCcCCCCc
Confidence            5555555 667888888899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCeEEeeeeeC
Q psy5535         172 PKIPVIISQCGQM  184 (184)
Q Consensus       172 P~~~i~I~~cG~L  184 (184)
                      |.++|+|.+||+|
T Consensus       161 P~~~i~I~~cGel  173 (173)
T d1qoia_         161 PKLPVVISQCGEM  173 (173)
T ss_dssp             BSSCEEEEEEEEC
T ss_pred             CCCCEEEEcccCC
Confidence            9999999999997
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x7fa1 b.62.1.2 (A:245-361) Outer surface protein, C-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zx8a1 b.62.1.3 (A:1-124) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure