Psyllid ID: psy5665

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MIGGTLKKVQWTITFALAHCVSSARNYSSVHILENAFSNGFLFRQLFDSISYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGLQDGVPIEP
cccccHHHHHHHHHHHHHHHccccccccHHHHHHcccccccEEEEcccccccEEEEEEEccccccEEEEccccccHHHHHHHHHHccccHHHEHHcccccHHccccHHHHHHHccccccccccccHHHHHHHHHccccHHHcccccccccEEcccccEEEccccEEEEEEcccccccccEEEcccccccccccEEccccccccEEEEcccEEEEEcccccccccEEEEEcccccEEEccccccccccccccccccHHHHHHHHHHHHcccccccEEEEcccccccccccHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHHHHHHccccccccccc
cccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEcccccccEEEEEEEccccccEEEEccHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHccccEEEcccccHHHHHHHHcccccccccccccccHccEEEccccEEEEccEEEEEEEcccccccEEEEEEccccEEEEccEEEEccccccccccccccEEEEEcccccccEEEEEEccccEEEEccccccccccccccccccHHHHHHHHHHHHHccccccEEEEcccccccccccHHHHHHHcccccccccHHHHHHHHHHcccccccHccccccHHHHccccccccccc
MIGGTLKKVQWTITFALAHCVSSARNYSSVHILENAFSNGFLFRQLFDSISYTHTYILAdklskecviidpvleqadRDVTLINQLGLTLKYVINTHvhadhitgtgkIKTMYVINTHvhadhitgtgKIKTMVNNVQSIIskesgaqadihvthgdtidfgdqqlevratpghtdgcvtyvnqgegmaftgdtllirgcgrtdfqqggsgvpvratpghtdgcvtyvnqgegmaftgdtllirgcgrtdfqqgdshKLFQSVRKEIfslpdhfrvypahdyhgfshstvgeeklynprlgeqisEEKFVEIMNNLKlslpkkidvavpanmkcglqdgvpiep
MIGGTLKKVQWTITFALAHCVSSARNYSSVHILENAFSNGFLFRQLFDSISYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMYVINTHVHadhitgtgkIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMkcglqdgvpiep
MIGGTLKKVQWTITFALAHCVSSARNYSSVHILENAFSNGFLFRQLFDSISYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGLQDGVPIEP
****TLKKVQWTITFALAHCVSSARNYSSVHILENAFSNGFLFRQLFDSISYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGL********
*******KVQWTITFALAHCVSSAR***************FLFRQLFDSISYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCG*********
MIGGTLKKVQWTITFALAHCVSSARNYSSVHILENAFSNGFLFRQLFDSISYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGLQDGVPIEP
MIGGTLKKVQWTITFALAHCVSSARNYSSVHILENAFSNGFLFRQLFDSISYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGLQD******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGGTLKKVQWTITFALAHCVSSARNYSSVHILENAFSNGFLFRQLFDSISYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGLQDGVPIEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query344 2.2.26 [Sep-21-2011]
Q9DCM0254 Protein ETHE1, mitochondr yes N/A 0.683 0.925 0.447 4e-68
O95571254 Protein ETHE1, mitochondr yes N/A 0.662 0.897 0.461 1e-67
Q3T094254 Protein ETHE1, mitochondr yes N/A 0.659 0.893 0.449 2e-65
Q9C8L4294 Hydroxyacylglutathione hy yes N/A 0.662 0.775 0.462 2e-63
Q9PFB0431 Beta-lactamase hydrolase- yes N/A 0.688 0.549 0.280 8e-19
Q8UAA9431 Beta-lactamase hydrolase- yes N/A 0.694 0.554 0.269 2e-18
Q87AD6431 Beta-lactamase hydrolase- yes N/A 0.688 0.549 0.277 7e-18
Q54EJ5292 Glyoxylase B2 OS=Dictyost yes N/A 0.671 0.791 0.238 2e-15
P64262224 Uncharacterized protein M no N/A 0.447 0.687 0.319 2e-11
P64261224 Uncharacterized protein R no N/A 0.447 0.687 0.319 2e-11
>sp|Q9DCM0|ETHE1_MOUSE Protein ETHE1, mitochondrial OS=Mus musculus GN=Ethe1 PE=1 SV=2 Back     alignment and function desciption
 Score =  258 bits (659), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 136/304 (44%), Positives = 181/304 (59%), Gaps = 69/304 (22%)

Query: 34  ENAFSNGFLFRQLFDSISYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYV 93
           ++A     L RQ+F+  S T+TY+L D+ S+E V+IDPVLE A RD  LI +LGL     
Sbjct: 16  QSASGAPVLLRQMFEPKSCTYTYLLGDRESREAVLIDPVLETAHRDAQLIKELGL----- 70

Query: 94  INTHVHADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHV 153
                           K +Y +NTH HADHITGTG +++++   QS+IS+ SGAQAD+H+
Sbjct: 71  ----------------KLLYAVNTHCHADHITGTGVLRSLLPGCQSVISRLSGAQADLHI 114

Query: 154 THGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVP 213
             GD+I FG   LE RA+PGHT GCVT+V   + MAFTGD LLIRGCGRTDFQQ      
Sbjct: 115 GEGDSIRFGRFALETRASPGHTPGCVTFVLNDQSMAFTGDALLIRGCGRTDFQQ------ 168

Query: 214 VRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDH 273
                                          GC +T         L+ SV ++IF+LP +
Sbjct: 169 -------------------------------GCAKT---------LYHSVHEKIFTLPGN 188

Query: 274 FRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMK 333
             +YPAHDYHG + STV EE+  NPRL   +S E+F+++M+NL L  P++ID+AVPANM+
Sbjct: 189 CLIYPAHDYHGLTVSTVEEERTLNPRL--TLSCEEFIKVMDNLNLPKPQQIDIAVPANMR 246

Query: 334 CGLQ 337
           CG+Q
Sbjct: 247 CGVQ 250
Probably plays an important role in metabolic homeostasis in mitochondria. May function as a nuclear-cytoplasmic shuttling protein that binds transcription factor RELA/NFKB3 in the nucleus and exports it to the cytoplasm. Suppresses p53-induced apoptosis by preventing nuclear localization of RELA.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: -EC: .EC: -EC: .EC: -
>sp|O95571|ETHE1_HUMAN Protein ETHE1, mitochondrial OS=Homo sapiens GN=ETHE1 PE=1 SV=2 Back     alignment and function description
>sp|Q3T094|ETHE1_BOVIN Protein ETHE1, mitochondrial OS=Bos taurus GN=ETHE1 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8L4|GLO2O_ARATH Hydroxyacylglutathione hydrolase 3, mitochondrial OS=Arabidopsis thaliana GN=GLY3 PE=1 SV=3 Back     alignment and function description
>sp|Q9PFB0|BLH_XYLFA Beta-lactamase hydrolase-like protein OS=Xylella fastidiosa (strain 9a5c) GN=blh PE=2 SV=1 Back     alignment and function description
>sp|Q8UAA9|BLH_AGRT5 Beta-lactamase hydrolase-like protein OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=blh PE=2 SV=1 Back     alignment and function description
>sp|Q87AD6|BLH_XYLFT Beta-lactamase hydrolase-like protein OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=blh PE=3 SV=1 Back     alignment and function description
>sp|Q54EJ5|GLOB2_DICDI Glyoxylase B2 OS=Dictyostelium discoideum GN=gloB2 PE=3 SV=1 Back     alignment and function description
>sp|P64262|Y2612_MYCBO Uncharacterized protein Mb2612c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2612c PE=3 SV=1 Back     alignment and function description
>sp|P64261|Y2581_MYCTU Uncharacterized protein Rv2581c/MT2658 OS=Mycobacterium tuberculosis GN=Rv2581c PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
428171446236 hypothetical protein GUITHDRAFT_96377 [G 0.671 0.978 0.5 5e-71
239790554274 ACYPI007982 [Acyrthosiphon pisum] 0.706 0.886 0.445 7e-70
242025339244 ETHE1 protein, putative [Pediculus human 0.671 0.946 0.48 8e-70
193690773274 PREDICTED: protein ETHE1, mitochondrial- 0.706 0.886 0.445 2e-69
54020924255 ethylmalonic encephalopathy 1 [Xenopus ( 0.709 0.956 0.459 2e-69
145351499258 predicted protein [Ostreococcus lucimari 0.680 0.906 0.483 3e-69
327276313314 PREDICTED: protein ETHE1, mitochondrial- 0.694 0.761 0.480 5e-69
158292918311 AGAP003337-PA [Anopheles gambiae str. PE 0.75 0.829 0.427 8e-69
308808500 602 Glyoxylase (ISS) [Ostreococcus tauri] gi 0.712 0.406 0.459 1e-68
89268876236 ethylmalonic encephalopathy 1 [Xenopus ( 0.680 0.991 0.468 4e-68
>gi|428171446|gb|EKX40363.1| hypothetical protein GUITHDRAFT_96377 [Guillardia theta CCMP2712] Back     alignment and taxonomy information
 Score =  274 bits (700), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 150/300 (50%), Positives = 179/300 (59%), Gaps = 69/300 (23%)

Query: 39  NGFLFRQLFDSISYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHV 98
            G L RQLF+  S+T+TYILAD+ +KE VIIDPVLE  +RDVTLI  LGL          
Sbjct: 6   EGLLLRQLFEGASFTYTYILADEATKEAVIIDPVLETVERDVTLIKDLGL---------- 55

Query: 99  HADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDT 158
                      K +Y INTH HADHITGTGK+K ++  ++S+IS +SGA+AD H+ HGD 
Sbjct: 56  -----------KVLYGINTHCHADHITGTGKMKQLLPEMKSVISGKSGAKADQHIQHGDV 104

Query: 159 IDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATP 218
           I FG  +LEVR+TPGHTDGCVTYV     M FTGD LLIRGCGRTDFQQ           
Sbjct: 105 IKFGRHKLEVRSTPGHTDGCVTYVLNDGVMCFTGDALLIRGCGRTDFQQ----------- 153

Query: 219 GHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYP 278
                                              GD   L+ SV KE+FSLPD+  VYP
Sbjct: 154 -----------------------------------GDPSLLYDSVHKEVFSLPDNCIVYP 178

Query: 279 AHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGLQD 338
           AHDY G   STV EEK  NPRL +  S+E+FVE+MNNL L  PK+ID A+P N+ CG+QD
Sbjct: 179 AHDYKGLMSSTVLEEKTLNPRLTK--SKEEFVELMNNLGLPYPKQIDKALPMNLVCGIQD 236

Source: Guillardia theta CCMP2712

Species: Guillardia theta

Genus: Guillardia

Family: Geminigeraceae

Order: Pyrenomonadales

Class: Cryptophyta

Phylum:

Superkingdom: Eukaryota
>gi|239790554|dbj|BAH71831.1| ACYPI007982 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242025339|ref|XP_002433082.1| ETHE1 protein, putative [Pediculus humanus corporis] gi|212518609|gb|EEB20344.1| ETHE1 protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|193690773|ref|XP_001951642.1| PREDICTED: protein ETHE1, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|54020924|ref|NP_001005706.1| ethylmalonic encephalopathy 1 [Xenopus (Silurana) tropicalis] gi|49522304|gb|AAH75280.1| ethylmalonic encephalopathy 1 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|145351499|ref|XP_001420113.1| predicted protein [Ostreococcus lucimarinus CCE9901] gi|144580346|gb|ABO98406.1| predicted protein [Ostreococcus lucimarinus CCE9901] Back     alignment and taxonomy information
>gi|327276313|ref|XP_003222914.1| PREDICTED: protein ETHE1, mitochondrial-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|158292918|ref|XP_314233.3| AGAP003337-PA [Anopheles gambiae str. PEST] gi|157016948|gb|EAA09645.4| AGAP003337-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|308808500|ref|XP_003081560.1| Glyoxylase (ISS) [Ostreococcus tauri] gi|116060025|emb|CAL56084.1| Glyoxylase (ISS) [Ostreococcus tauri] Back     alignment and taxonomy information
>gi|89268876|emb|CAJ81741.1| ethylmalonic encephalopathy 1 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
ZFIN|ZDB-GENE-040426-2503279 ethe1 "ethylmalonic encephalop 0.357 0.440 0.656 6.1e-64
FB|FBgn0050022279 CG30022 [Drosophila melanogast 0.462 0.569 0.520 1.8e-62
MGI|MGI:1913321254 Ethe1 "ethylmalonic encephalop 0.372 0.503 0.576 4.2e-59
UNIPROTKB|O95571254 ETHE1 "Protein ETHE1, mitochon 0.372 0.503 0.6 6.9e-59
RGD|1311034254 Ethe1 "ethylmalonic encephalop 0.372 0.503 0.576 2.9e-58
UNIPROTKB|Q3T094254 ETHE1 "Protein ETHE1, mitochon 0.377 0.511 0.575 6.1e-58
UNIPROTKB|E2RFL0254 ETHE1 "Uncharacterized protein 0.372 0.503 0.576 1.4e-56
WB|WBGene00007886237 ethe-1 [Caenorhabditis elegans 0.366 0.531 0.585 4.2e-53
TAIR|locus:2024922294 GLY3 "AT1G53580" [Arabidopsis 0.360 0.421 0.644 1.3e-38
UNIPROTKB|F1RMV5129 F1RMV5 "Uncharacterized protei 0.351 0.937 0.609 1.7e-36
ZFIN|ZDB-GENE-040426-2503 ethe1 "ethylmalonic encephalopathy 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 437 (158.9 bits), Expect = 6.1e-64, Sum P(2) = 6.1e-64
 Identities = 82/125 (65%), Positives = 99/125 (79%)

Query:   214 VRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDH 273
             VR TPGHTDGCVTYV   + MAFTGD LLIRGCGRTDFQQG  H+L++SV ++IFSLP H
Sbjct:   156 VRETPGHTDGCVTYVTGDQRMAFTGDALLIRGCGRTDFQQGSPHRLYESVHQKIFSLPGH 215

Query:   274 FRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMK 333
               +YPAHDY G + STV EEK +NPRL + +  E+FV+IM+NL L  PKKID++VPAN+ 
Sbjct:   216 CFIYPAHDYKGQTVSTVDEEKKFNPRLTKTV--EEFVKIMDNLNLPKPKKIDISVPANLV 273

Query:   334 CGLQD 338
             CGL D
Sbjct:   274 CGLHD 278
GO:0016787 "hydrolase activity" evidence=IEA
FB|FBgn0050022 CG30022 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1913321 Ethe1 "ethylmalonic encephalopathy 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O95571 ETHE1 "Protein ETHE1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1311034 Ethe1 "ethylmalonic encephalopathy 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T094 ETHE1 "Protein ETHE1, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFL0 ETHE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00007886 ethe-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2024922 GLY3 "AT1G53580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMV5 F1RMV5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O95571ETHE1_HUMAN3, ., -, ., -, ., -0.46120.66270.8976yesN/A
Q9DCM0ETHE1_MOUSE3, ., -, ., -, ., -0.44730.68310.9251yesN/A
Q9C8L4GLO2O_ARATH3, ., 1, ., 2, ., 60.46250.66270.7755yesN/A
Q3T094ETHE1_BOVIN3, ., -, ., -, ., -0.44930.65980.8937yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.20.921
3rd Layer3.1.2.60.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
PLN02962251 PLN02962, PLN02962, hydroxyacylglutathione hydrola 1e-105
COG0491252 COG0491, GloB, Zn-dependent hydrolases, including 5e-26
smart00849177 smart00849, Lactamase_B, Metallo-beta-lactamase su 1e-24
TIGR03413248 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrol 2e-23
pfam00753148 pfam00753, Lactamase_B, Metallo-beta-lactamase sup 3e-14
PLN02398329 PLN02398, PLN02398, hydroxyacylglutathione hydrola 2e-13
PLN02469258 PLN02469, PLN02469, hydroxyacylglutathione hydrola 2e-12
PLN02398329 PLN02398, PLN02398, hydroxyacylglutathione hydrola 6e-10
PRK10241251 PRK10241, PRK10241, hydroxyacylglutathione hydrola 5e-08
PRK10241251 PRK10241, PRK10241, hydroxyacylglutathione hydrola 7e-06
>gnl|CDD|178547 PLN02962, PLN02962, hydroxyacylglutathione hydrolase Back     alignment and domain information 
 Score =  309 bits (794), Expect = e-105
 Identities = 150/302 (49%), Positives = 178/302 (58%), Gaps = 65/302 (21%)

Query: 42  LFRQLFDSISYTHTYILAD--KLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVH 99
           LFRQLF+  S T+TY+LAD     K  ++IDPV +  DRD++L+ +LGL           
Sbjct: 12  LFRQLFEKESSTYTYLLADVSHPDKPALLIDPVDKTVDRDLSLVKELGL----------- 60

Query: 100 ADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTI 159
                     K +Y +NTHVHADH+TGTG +KT +  V+SIISK SG++AD+ V  GD I
Sbjct: 61  ----------KLIYAMNTHVHADHVTGTGLLKTKLPGVKSIISKASGSKADLFVEPGDKI 110

Query: 160 DFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATPG 219
            FGD  LEVRATPGHT GCVTYV        TG+               G   P    P 
Sbjct: 111 YFGDLYLEVRATPGHTAGCVTYV--------TGE---------------GPDQP---QP- 143

Query: 220 HTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPA 279
                         MAFTGD LLIRGCGRTDFQ G S +L++SV  +IF+LP    +YPA
Sbjct: 144 -------------RMAFTGDALLIRGCGRTDFQGGSSDQLYKSVHSQIFTLPKDTLIYPA 190

Query: 280 HDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGLQDG 339
           HDY GF+ STVGEE LYNPRL +   EE F  IM NL L  PK IDVAVPANM CGLQD 
Sbjct: 191 HDYKGFTVSTVGEEMLYNPRLTK--DEETFKTIMENLNLPYPKMIDVAVPANMVCGLQDP 248

Query: 340 VP 341
             
Sbjct: 249 PA 250

Length = 251
>gnl|CDD|223565 COG0491, GloB, Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>gnl|CDD|214854 smart00849, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|234201 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|216099 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|215223 PLN02398, PLN02398, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|178088 PLN02469, PLN02469, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|215223 PLN02398, PLN02398, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|182327 PRK10241, PRK10241, hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|182327 PRK10241, PRK10241, hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 344
PLN02962251 hydroxyacylglutathione hydrolase 100.0
KOG0814|consensus237 100.0
PLN02469258 hydroxyacylglutathione hydrolase 100.0
PLN02398329 hydroxyacylglutathione hydrolase 99.97
TIGR03413248 GSH_gloB hydroxyacylglutathione hydrolase. Members 99.96
PRK10241251 hydroxyacylglutathione hydrolase; Provisional 99.96
KOG0813|consensus265 99.92
COG0491252 GloB Zn-dependent hydrolases, including glyoxylase 99.83
PRK11921394 metallo-beta-lactamase/flavodoxin domain-containin 99.81
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 99.8
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 99.79
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 99.75
COG0426388 FpaA Uncharacterized flavoproteins [Energy product 99.71
PRK11539755 ComEC family competence protein; Provisional 99.47
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 99.45
PF14597199 Lactamase_B_5: Metallo-beta-lactamase superfamily; 99.43
TIGR00361662 ComEC_Rec2 DNA internalization-related competence 99.4
COG2333293 ComEC Predicted hydrolase (metallo-beta-lactamase 99.32
COG1237259 Metal-dependent hydrolases of the beta-lactamase s 99.12
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 99.06
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 98.99
PRK04286298 hypothetical protein; Provisional 98.99
PRK11244250 phnP carbon-phosphorus lyase complex accessory pro 98.95
PRK02113252 putative hydrolase; Provisional 98.92
TIGR02651299 RNase_Z ribonuclease Z. Processing of the 3-prime 98.92
PRK05184302 pyrroloquinoline quinone biosynthesis protein PqqB 98.91
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary 98.91
PRK02126334 ribonuclease Z; Provisional 98.9
TIGR02649303 true_RNase_BN ribonuclease BN. Members of this pro 98.89
TIGR03307238 PhnP phosphonate metabolism protein PhnP. This fam 98.88
TIGR02108302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 98.86
PRK00685228 metal-dependent hydrolase; Provisional 98.82
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 98.77
PF12706194 Lactamase_B_2: Beta-lactamase superfamily domain; 98.62
PRK00055270 ribonuclease Z; Reviewed 98.57
COG1782 637 Predicted metal-dependent RNase, consists of a met 98.49
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 98.41
KOG4736|consensus302 98.37
KOG1136|consensus 501 98.37
COG2248304 Predicted hydrolase (metallo-beta-lactamase superf 98.25
PRK11709355 putative L-ascorbate 6-phosphate lactonase; Provis 98.04
TIGR02650277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 97.99
COG1234292 ElaC Metal-dependent hydrolases of the beta-lactam 97.97
COG2220258 Predicted Zn-dependent hydrolases of the beta-lact 97.9
COG1235269 PhnP Metal-dependent hydrolases of the beta-lactam 97.82
KOG1137|consensus 668 97.78
PLN02469258 hydroxyacylglutathione hydrolase 97.47
PLN02398329 hydroxyacylglutathione hydrolase 97.36
KOG1135|consensus 764 97.27
COG0491252 GloB Zn-dependent hydrolases, including glyoxylase 97.08
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 96.82
KOG0813|consensus265 96.54
TIGR03413248 GSH_gloB hydroxyacylglutathione hydrolase. Members 96.3
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 96.2
KOG2121|consensus746 96.01
PLN02962251 hydroxyacylglutathione hydrolase 95.85
COG0426 388 FpaA Uncharacterized flavoproteins [Energy product 94.66
PRK10241251 hydroxyacylglutathione hydrolase; Provisional 94.64
PF02112335 PDEase_II: cAMP phosphodiesterases class-II; Inter 93.51
KOG0814|consensus237 93.48
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 92.93
PF1369163 Lactamase_B_4: tRNase Z endonuclease 92.07
KOG1361|consensus 481 91.35
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 89.3
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information 
Probab=100.00  E-value=2.6e-39  Score=285.45  Aligned_cols=237  Identities=60%  Similarity=0.954  Sum_probs=185.2

Q ss_pred             ccCCeeEEEEEecCcceEEEEEEeCC--CCeEEEEeCCCCChHHHHHHHHHcCCcccEEEecCCchhhhcChhhhhhhh-
Q psy5665          37 FSNGFLFRQLFDSISYTHTYILADKL--SKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMY-  113 (344)
Q Consensus        37 ~~~~~~~~~~~~~~~~~~~~li~~~~--~~~~iLIDtG~~~~~~~~~~l~~~~~~i~~Vi~TH~H~DH~gg~~~~~~~~-  113 (344)
                      .+..|+++|++.+..++|||++.+++  +++++|||||....+.+++.+++.+.+|++|++||.|.||++|+..+++++ 
T Consensus         7 ~~~~m~~~~~~~~~~~~~~Yll~d~~~~~~~avlIDP~~~~~~~~l~~l~~~g~~i~~Il~TH~H~DHigg~~~l~~~~~   86 (251)
T PLN02962          7 SSSKLLFRQLFEKESSTYTYLLADVSHPDKPALLIDPVDKTVDRDLSLVKELGLKLIYAMNTHVHADHVTGTGLLKTKLP   86 (251)
T ss_pred             CCCceEEEEeecCCceeEEEEEEeCCCCCCEEEEECCCCCcHHHHHHHHHHCCCeeEEEEcCCCCchhHHHHHHHHHHCC
Confidence            34458999999999999999998752  468999999965568888999999999999999999999999977776543 


Q ss_pred             eeccccccccccchhHHHhhhhhhHHhhhcccccccceEccCCCeeEeCCeeEEEEeCCCCCCCceEEEeCCCceeeecc
Q psy5665         114 VINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGD  193 (344)
Q Consensus       114 ~v~~~~~~d~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~i~~~~~pght~~~~~~~~~~~~iL~~GD  193 (344)
                      .+.++.                      ........+..+.+++.+.+|+..++++++||||+++++++.++..     |
T Consensus        87 ~a~v~~----------------------~~~~~~~~d~~l~~g~~i~~g~~~l~vi~tPGHT~g~v~~~~~d~~-----~  139 (251)
T PLN02962         87 GVKSII----------------------SKASGSKADLFVEPGDKIYFGDLYLEVRATPGHTAGCVTYVTGEGP-----D  139 (251)
T ss_pred             CCeEEe----------------------ccccCCCCCEEeCCCCEEEECCEEEEEEECCCCCcCcEEEEeccCC-----C
Confidence            222221                      1111111233344555555555555555555555555555443200     0


Q ss_pred             eeeeccCCCccccCCCCCceeecCCCCCCCceeeeecCcceeEecceeeccCcccccCCCCCHHHHHHHHHHHHhcCCCc
Q psy5665         194 TLLIRGCGRTDFQQGGSGVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDH  273 (344)
Q Consensus       194 ~~~~~~~~~~~~~~~~~~~~~~~~pGHt~g~~~~~~~~~~~lf~GD~l~~~~~~~~~~~~~~~~~~~~sl~~~l~~l~~~  273 (344)
                                                         .+..+++|+||++|.++++++++++++..++++|+++++..++++
T Consensus       140 -----------------------------------~~~~~~lftGD~Lf~~g~Gr~d~~~g~~~~l~~Sl~~~l~~L~~~  184 (251)
T PLN02962        140 -----------------------------------QPQPRMAFTGDALLIRGCGRTDFQGGSSDQLYKSVHSQIFTLPKD  184 (251)
T ss_pred             -----------------------------------CCccceEEECCeeccCCcCCCCCCCCCHHHHHHHHHHHHHcCCCC
Confidence                                               012468999999999999999999999999999997789999999


Q ss_pred             eEEeeCCCCCCCccccHHHHHHcCCCCCCCCCHHHHHHHhhhCCCCCCcccchhhHhhhhcCCC
Q psy5665         274 FRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGLQ  337 (344)
Q Consensus       274 ~~v~pgHg~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~  337 (344)
                      ++|+|||||...+.++++++++.|+++..  +.++|++.+.+..++.|+.+...++.||.+|++
T Consensus       185 ~~i~PGHg~~~~~~tti~~e~~~n~~l~~--~~~~fv~~~~~~~~~~p~~~~~~~~~n~~~~~~  246 (251)
T PLN02962        185 TLIYPAHDYKGFTVSTVGEEMLYNPRLTK--DEETFKTIMENLNLPYPKMIDVAVPANMVCGLQ  246 (251)
T ss_pred             eEEECCCCCCCCCCcCHHHHHhhCcccCC--CHHHHHHHHhhCCCCCchHHHHHHHHHHHcCCC
Confidence            88999999987788999999999999986  999999999999999999999999999999987

>KOG0814|consensus Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>KOG0813|consensus Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>PF14597 Lactamase_B_5: Metallo-beta-lactamase superfamily; PDB: 2P97_B Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>KOG4736|consensus Back     alignment and domain information
>KOG1136|consensus Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>KOG1137|consensus Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>KOG1135|consensus Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>KOG0813|consensus Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>KOG2121|consensus Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3 Back     alignment and domain information
>KOG0814|consensus Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>PF13691 Lactamase_B_4: tRNase Z endonuclease Back     alignment and domain information
>KOG1361|consensus Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
2gcu_A245 X-Ray Structure Of Gene Product From Arabidopsis Th 2e-63
4efz_A298 Crystal Structure Of A Hypothetical Metallo-Beta-La 2e-18
3r2u_A 466 2.1 Angstrom Resolution Crystal Structure Of Metall 1e-11
1xm8_A254 X-Ray Structure Of Glyoxalase Ii From Arabidopsis T 4e-10
1xm8_A254 X-Ray Structure Of Glyoxalase Ii From Arabidopsis T 9e-06
3tp9_A 474 Crystal Structure Of Alicyclobacillus Acidocaldariu 6e-09
1qh3_A260 Human Glyoxalase Ii With Cacodylate And Acetate Ion 1e-08
2xf4_A210 Crystal Structure Of Salmonella Enterica Serovar Ty 2e-08
2p18_A311 Crystal Structure Of The Leishmania Infantum Glyoxa 3e-07
2zwr_A207 Crystal Structure Of Ttha1623 From Thermus Thermoph 2e-06
2qed_A258 Crystal Structure Of Salmonella Thyphimurium Lt2 Gl 1e-05
2gmn_A274 Crystal Structure Of Bjp-1, A Subclass B3 Metallo-b 2e-05
3lvz_A294 New Refinement Of The Crystal Structure Of Bjp-1, A 2e-05
4ad9_A289 Crystal Structure Of Human Lactb2. Length = 289 4e-05
2zo4_A317 Crystal Structure Of Metallo-Beta-Lactamase Family 9e-05
3vpe_A262 Crystal Structure Of Metallo-beta-lactamase Smb-1 L 2e-04
>pdb|2GCU|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At1g53580 Length = 245 Back     alignment and structure 
Iteration: 1

 Score =  239 bits (609), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 174/307 (56%), Gaps = 79/307 (25%)
Query: 41  FLFRQLFDSISYTHTYILAD--KLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHV 98
            LFRQLF++ S T TY+LAD     K  ++IDPV +  DRD+ LI++LGL          
Sbjct: 3   LLFRQLFENESSTFTYLLADVSHPDKPALLIDPVDKTVDRDLKLIDELGL---------- 52
Query: 99  HADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDT 158
                      K +Y +NTHVHADH+TGTG +KT +  V+S+ISK SG++AD+ +  GD 
Sbjct: 53  -----------KLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKASGSKADLFLEPGDK 101
Query: 159 IDFGDQQLEVRATPGHTDGCVTYVNQGEG-------MAFTGDTLLIRGCGRTDFQQGGSG 211
           +  GD  LEVRATPGHT GCVTYV  GEG       MAFTGD +LIRGCGRTDFQ+G   
Sbjct: 102 VSIGDIYLEVRATPGHTAGCVTYVT-GEGADQPQPRMAFTGDAVLIRGCGRTDFQEGS-- 158
Query: 212 VPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLP 271
                                                       S +L++SV  +IF+LP
Sbjct: 159 --------------------------------------------SDQLYESVHSQIFTLP 174
Query: 272 DHFRVYPAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPAN 331
               +YPAHDY GF  STVGEE  +NPRL +   +E F  IM+NL LS PK IDVAVPAN
Sbjct: 175 KDTLIYPAHDYKGFEVSTVGEEMQHNPRLTKD--KETFKTIMSNLNLSYPKMIDVAVPAN 232
Query: 332 MKCGLQD 338
           M  GLQD
Sbjct: 233 MVXGLQD 239
>pdb|4EFZ|A Chain A, Crystal Structure Of A Hypothetical Metallo-Beta-Lactamase From Burkholderia Pseudomallei Length = 298 Back     alignment and structure
>pdb|3R2U|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp. Aureus Col Length = 466 Back     alignment and structure
>pdb|1XM8|A Chain A, X-Ray Structure Of Glyoxalase Ii From Arabidopsis Thaliana Gene At2g31350 Length = 254 Back     alignment and structure
>pdb|1XM8|A Chain A, X-Ray Structure Of Glyoxalase Ii From Arabidopsis Thaliana Gene At2g31350 Length = 254 Back     alignment and structure
>pdb|3TP9|A Chain A, Crystal Structure Of Alicyclobacillus Acidocaldarius Protein With Beta-Lactamase And Rhodanese Domains Length = 474 Back     alignment and structure
>pdb|1QH3|A Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions Present In The Active Site Length = 260 Back     alignment and structure
>pdb|2XF4|A Chain A, Crystal Structure Of Salmonella Enterica Serovar Typhimurium Ycbl Length = 210 Back     alignment and structure
>pdb|2P18|A Chain A, Crystal Structure Of The Leishmania Infantum Glyoxalase Ii Length = 311 Back     alignment and structure
>pdb|2ZWR|A Chain A, Crystal Structure Of Ttha1623 From Thermus Thermophilus Hb8 Length = 207 Back     alignment and structure
>pdb|2QED|A Chain A, Crystal Structure Of Salmonella Thyphimurium Lt2 Glyoxalase Ii Length = 258 Back     alignment and structure
>pdb|2GMN|A Chain A, Crystal Structure Of Bjp-1, A Subclass B3 Metallo-beta-lactamase Of Bradyrhizobium Japonicum Length = 274 Back     alignment and structure
>pdb|3LVZ|A Chain A, New Refinement Of The Crystal Structure Of Bjp-1, A Subclass B3 Metallo-Beta-Lactamase Of Bradyrhizobium Japonicum Length = 294 Back     alignment and structure
>pdb|4AD9|A Chain A, Crystal Structure Of Human Lactb2. Length = 289 Back     alignment and structure
>pdb|2ZO4|A Chain A, Crystal Structure Of Metallo-Beta-Lactamase Family Protein Ttha1429 From Thermus Thermophilus Hb8 Length = 317 Back     alignment and structure
>pdb|3VPE|A Chain A, Crystal Structure Of Metallo-beta-lactamase Smb-1 Length = 262 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethyl 1e-110
4efz_A298 Metallo-beta-lactamase family protein; structural 1e-87
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 2e-58
3r2u_A 466 Metallo-beta-lactamase family protein; structural 2e-56
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 1e-53
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 4e-39
1xm8_A254 Glyoxalase II; structural genomics, protein struct 1e-30
1qh5_A260 Glyoxalase II, protein (hydroxyacylglutathione hyd 9e-30
3m8t_A294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 3e-29
2qed_A258 Hydroxyacylglutathione hydrolase; metallo-B- super 3e-27
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 3e-26
2p18_A311 Glyoxalase II; metalloprotein, beta sandwich, alph 5e-26
4ad9_A289 Lactb2, beta-lactamase-like protein 2; hydrolase, 3e-20
3adr_A261 Putative uncharacterized protein ST1585; quorum se 7e-20
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, a 2e-18
2vw8_A303 PA1000, PQSE; quinolone signal response protein, s 1e-16
2p97_A201 Hypothetical protein; putative metal-dependent hyd 7e-16
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 2e-14
4ax1_B303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 4e-14
2zo4_A317 Metallo-beta-lactamase family protein; hydrolase; 8e-13
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 3e-12
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 4e-12
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 3e-11
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 2e-10
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 3e-10
1ztc_A221 Hypothetical protein TM0894; structural genomics, 2e-08
1ztc_A221 Hypothetical protein TM0894; structural genomics, 2e-05
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 2e-08
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 1e-04
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 4e-07
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 5e-07
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 8e-07
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 6e-06
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 9e-06
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 1e-05
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 4e-05
3aj3_A274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 1e-04
3aj3_A274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 6e-04
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 2e-04
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A { 3e-04
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A { 7e-04
1vme_A410 Flavoprotein; TM0755, structural genomics, JCSG, p 5e-04
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Length = 245 Back     alignment and structure
 Score =  320 bits (823), Expect = e-110
 Identities = 141/299 (47%), Positives = 174/299 (58%), Gaps = 65/299 (21%)

Query: 42  LFRQLFDSISYTHTYILAD--KLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVH 99
           LFRQLF++ S T TY+LAD     K  ++IDPV +  DRD+ LI++LGL L Y +NTHVH
Sbjct: 4   LFRQLFENESSTFTYLLADVSHPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTHVH 63

Query: 100 ADHITGTGKIKTMYVINTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTI 159
           A                     DH+TGTG +KT +  V+S+ISK SG++AD+ +  GD +
Sbjct: 64  A---------------------DHVTGTGLLKTKLPGVKSVISKASGSKADLFLEPGDKV 102

Query: 160 DFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGSGVPVRATPG 219
             GD  LEVRATPGHT GCVTYV        TG+                          
Sbjct: 103 SIGDIYLEVRATPGHTAGCVTYV--------TGEGAD----------------------- 131

Query: 220 HTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPA 279
                         MAFTGD +LIRGCGRTDFQ+G S +L++SV  +IF+LP    +YPA
Sbjct: 132 ---------QPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPA 182

Query: 280 HDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGLQD 338
           HDY GF  STVGEE  +NPRL +   +E F  IM+NL LS PK IDVAVPANM CGLQD
Sbjct: 183 HDYKGFEVSTVGEEMQHNPRLTK--DKETFKTIMSNLNLSYPKMIDVAVPANMVCGLQD 239
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Length = 298 Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Length = 210 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Length = 207 Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Length = 254 Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Length = 260 Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Length = 294 Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Length = 258 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Length = 263 Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Length = 311 Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Length = 289 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Length = 261 Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Length = 269 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Length = 303 Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Length = 201 Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Length = 228 Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Length = 303 Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Length = 317 Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Length = 223 Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} Length = 219 Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Length = 232 Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Length = 265 Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Length = 227 Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Length = 221 Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Length = 221 Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Length = 270 Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Length = 270 Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Length = 233 Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Length = 246 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Length = 404 Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A Length = 227 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Length = 402 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414 Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Length = 276 Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Length = 274 Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Length = 274 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Length = 331 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Length = 331 Back     alignment and structure
>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein STR initiative, PSI, joint center for structural genomics, ELEC transport; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Length = 410 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethyl 100.0
4efz_A298 Metallo-beta-lactamase family protein; structural 100.0
3r2u_A 466 Metallo-beta-lactamase family protein; structural 99.98
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.98
1qh5_A260 Glyoxalase II, protein (hydroxyacylglutathione hyd 99.97
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 99.97
1xm8_A254 Glyoxalase II; structural genomics, protein struct 99.97
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 99.96
2qed_A258 Hydroxyacylglutathione hydrolase; metallo-B- super 99.96
2p18_A311 Glyoxalase II; metalloprotein, beta sandwich, alph 99.96
2zo4_A317 Metallo-beta-lactamase family protein; hydrolase; 99.93
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 99.93
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 99.92
3m8t_A294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 99.92
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 99.92
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 99.92
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 99.91
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 99.91
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 99.91
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein 99.91
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 99.9
4ax1_B303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 99.9
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 99.9
4ad9_A289 Lactb2, beta-lactamase-like protein 2; hydrolase, 99.9
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 99.9
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 99.9
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 99.9
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, a 99.89
2vw8_A303 PA1000, PQSE; quinolone signal response protein, s 99.87
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 99.86
4dik_A410 Flavoprotein; TM0755, electron transport, DI-iron 99.86
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 99.84
3esh_A280 Protein similar to metal-dependent hydrolase; stru 99.84
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 99.83
2p97_A201 Hypothetical protein; putative metal-dependent hyd 99.83
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.83
3adr_A261 Putative uncharacterized protein ST1585; quorum se 99.82
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 99.82
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.82
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 99.7
3aj3_A274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 99.8
1ztc_A221 Hypothetical protein TM0894; structural genomics, 99.8
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A { 99.79
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 99.77
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, 99.55
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 99.53
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 99.44
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 99.43
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.41
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 99.41
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural 99.39
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.37
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 99.35
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 99.34
2e7y_A280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 99.33
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 99.33
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 99.29
2cbn_A306 Ribonuclease Z; phosphodiesterase beta lactamase t 99.24
2az4_A429 Hypothetical protein EF2904; structural genomics, 99.23
1y44_A320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 99.2
2p4z_A284 Metal-dependent hydrolases of the beta-lactamase s 99.15
3kl7_A235 Putative metal-dependent hydrolase; structural gen 99.11
3jxp_A321 Coenzyme PQQ synthesis protein B; alpha-beta prote 99.05
3zwf_A368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 98.93
3rpc_A264 Possible metal-dependent hydrolase; structural gen 98.8
4b87_A367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 98.78
3bv6_A379 Metal-dependent hydrolase; metallo protein, beta-l 98.74
2wyl_A360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 98.67
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase s 98.6
3h3e_A267 Uncharacterized protein TM1679; structural genomic 98.6
3zdk_A336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 98.56
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein 98.24
4ax1_B303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 97.2
1xm8_A254 Glyoxalase II; structural genomics, protein struct 97.03
3r2u_A 466 Metallo-beta-lactamase family protein; structural 96.88
4efz_A298 Metallo-beta-lactamase family protein; structural 96.68
4ad9_A289 Lactb2, beta-lactamase-like protein 2; hydrolase, 96.58
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 96.5
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 96.29
2vw8_A303 PA1000, PQSE; quinolone signal response protein, s 96.18
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 96.04
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 95.91
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 95.85
3m8t_A294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 95.81
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 95.73
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 95.7
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 94.68
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 95.48
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 95.33
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 95.3
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 95.24
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 95.05
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 94.97
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 94.87
3esh_A280 Protein similar to metal-dependent hydrolase; stru 94.34
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 94.0
1qh5_A260 Glyoxalase II, protein (hydroxyacylglutathione hyd 93.3
2zo4_A317 Metallo-beta-lactamase family protein; hydrolase; 92.87
2p97_A201 Hypothetical protein; putative metal-dependent hyd 92.77
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 92.39
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 92.2
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethyl 92.14
2p18_A311 Glyoxalase II; metalloprotein, beta sandwich, alph 91.93
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 91.88
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 91.2
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 90.61
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, a 90.37
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 89.77
3aj3_A274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 89.56
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, 89.4
2qed_A258 Hydroxyacylglutathione hydrolase; metallo-B- super 88.99
3adr_A261 Putative uncharacterized protein ST1585; quorum se 87.72
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 86.91
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 86.9
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 86.24
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 85.84
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 85.67
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 84.69
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 84.34
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 82.36
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 80.94
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A { 80.55
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=2.7e-37  Score=273.58  Aligned_cols=236  Identities=56%  Similarity=0.913  Sum_probs=185.3

Q ss_pred             eeEEEEEecCcceEEEEEEeCC--CCeEEEEeCCCCChHHHHHHHHHcCCcccEEEecCCchhhhcChhhhhhh-heecc
Q psy5665          41 FLFRQLFDSISYTHTYILADKL--SKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTM-YVINT  117 (344)
Q Consensus        41 ~~~~~~~~~~~~~~~~li~~~~--~~~~iLIDtG~~~~~~~~~~l~~~~~~i~~Vi~TH~H~DH~gg~~~~~~~-~~v~~  117 (344)
                      |.+++++....++|||+|.+++  +++++|||||.+..+.+.+.+++.+.+|++|++||.|.||++|+..|.+. ..+.+
T Consensus         3 m~~~~~~~~~~~~~~yli~~~~~~~~~~ilID~g~~~~~~~~~~l~~~g~~i~~Il~TH~H~DH~gg~~~l~~~~~~~~v   82 (245)
T 2gcu_A            3 LLFRQLFENESSTFTYLLADVSHPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKS   82 (245)
T ss_dssp             EEEEEEEETTTTEEEEEEEETTSTTCEEEEESCBGGGHHHHHHHHHHHTCEEEEEECSSCCSSSCBSHHHHHHHSTTCEE
T ss_pred             cEEEEeecCCCceEEEEEEcCCCCCCcEEEEeCCCchHHHHHHHHHHCCCeeeEEEeCCCChhhhhhHHHHHHhCCCCeE
Confidence            6788999999999999999864  46899999997656788899999999999999999999999997777652 22223


Q ss_pred             ccccccccchhHHHhhhhhhHHhhhcccccccceEccCCCeeEeCCeeEEEEeCCCCCCCceEEEeCCCceeeecceeee
Q psy5665         118 HVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLI  197 (344)
Q Consensus       118 ~~~~d~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~i~~~~~pght~~~~~~~~~~~~iL~~GD~~~~  197 (344)
                      +.+...                      .......+.+++.+.+|+..++++++||||++++++++++..    |+    
T Consensus        83 ~~~~~~----------------------~~~~~~~~~~g~~~~~g~~~i~v~~tpGHt~g~~~~~~~~~~----~~----  132 (245)
T 2gcu_A           83 VISKAS----------------------GSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGA----DQ----  132 (245)
T ss_dssp             EEEGGG----------------------CCCCSEEECTTCEEEETTEEEEEEECCSSSTTCEEEEECCST----TS----
T ss_pred             Eecccc----------------------cccCCEEcCCCCEEEECCEEEEEEECCCCCCCCEEEEECCcc----cc----
Confidence            322211                      111334455666666666666666666666666666655310    00    


Q ss_pred             ccCCCccccCCCCCceeecCCCCCCCceeeeecCcceeEecceeeccCcccccCCCCCHHHHHHHHHHHHhcCCCceEEe
Q psy5665         198 RGCGRTDFQQGGSGVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVY  277 (344)
Q Consensus       198 ~~~~~~~~~~~~~~~~~~~~pGHt~g~~~~~~~~~~~lf~GD~l~~~~~~~~~~~~~~~~~~~~sl~~~l~~l~~~~~v~  277 (344)
                                                      +..+++|+||+++.+.++++++++++..++++|+++++..++++++++
T Consensus       133 --------------------------------~~~~~lftGD~~~~~~~~~~d~~~~~~~~~~~sl~~~l~~l~~~~~v~  180 (245)
T 2gcu_A          133 --------------------------------PQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIY  180 (245)
T ss_dssp             --------------------------------CSSCEEEEETTSBTTBCCCCSSTTCCHHHHHHHHHHHTTTSCTTCEEE
T ss_pred             --------------------------------ccccEEEECCccccCCccCCCCCCCCHHHHHHHHHHHHHhCCCCEEEE
Confidence                                            001688899998888888888888899999999967899999887799


Q ss_pred             eCCCCCCCccccHHHHHHcCCCCCCCCCHHHHHHHhhhCCCCCCcccchhhHhhhhcCCCCCC
Q psy5665         278 PAHDYHGFSHSTVGEEKLYNPRLGEQISEEKFVEIMNNLKLSLPKKIDVAVPANMKCGLQDGV  340 (344)
Q Consensus       278 pgHg~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~  340 (344)
                      ||||+.....++++.++++|++++.  +.++|++.++++.++.|+.+.+.++.|++||..+-.
T Consensus       181 pgHg~~~~~~sti~~e~~~n~~l~~--~~~~f~~~~~~~~~~~p~~~~~~~~~n~~~g~~~~~  241 (245)
T 2gcu_A          181 PAHDYKGFEVSTVGEEMQHNPRLTK--DKETFKTIMSNLNLSYPKMIDVAVPANMVCGLQDVP  241 (245)
T ss_dssp             ESBCSSSCCCEEHHHHHHHCTTTTS--CHHHHHHHHHTCCCCCCTTHHHHHHHHHTTTCCSSC
T ss_pred             CCCCCCCCCCcCHHHHHhhCcccCC--CHHHHHHHHHhCCCCCChhHHHHHHHHHHhCCCCCC
Confidence            9999877778999999999999995  899999999999999999999999999999998743
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 344
d1xm8a_254 d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathio 6e-23
d1qh5a_260 d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathio 4e-18
d1k07a_262 d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoriba 3e-16
d2gmna1264 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Br 2e-15
d2qeda1251 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglut 2e-14
d2aioa1266 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xa 5e-12
d2q0ia1298 d.157.1.14 (A:1-298) Quinolone signal response pro 7e-12
d1jjta_220 d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomo 8e-11
d1e5da2249 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreducta 2e-10
d1ycga2249 d.157.1.3 (A:2-250) Nitric oxide reductase N-termi 5e-10
d2p97a1200 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 2e-09
d1vmea2250 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, 3e-09
d1ko3a_230 d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomo 4e-08
d1ko3a_230 d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomo 2e-07
d1mqoa_221 d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus 1e-07
d1znba_230 d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroi 3e-07
d1x8ha_228 d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromona 1e-06
d1x8ha_228 d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromona 5e-06
d2az4a1183 d.157.1.10 (A:56-238) Hypothetical protein EF2904 8e-06
d1ztca1207 d.157.1.11 (A:1-207) Hypothetical protein TM0894 { 1e-05
d1m2xa_219 d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseob 5e-05
d2cfua2 505 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudo 0.001
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Glyoxalase II (hydroxyacylglutathione hydrolase)
domain: Glyoxalase II (hydroxyacylglutathione hydrolase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 93.8 bits (232), Expect = 6e-23
 Identities = 58/268 (21%), Positives = 98/268 (36%), Gaps = 51/268 (19%)

Query: 55  TYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMYV 114
            YIL D+ +    ++DP   +A+  +  + + G  L Y++NTH H DH  G  ++K  Y 
Sbjct: 14  AYILHDEDTGTVGVVDPS--EAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYG 71

Query: 115 INTHVHADHITGTGKIKTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGH 174
                 A                     K+     D+ +  GD   F   ++ V  TPGH
Sbjct: 72  AKVIGSAMD-------------------KDRIPGIDMALKDGDKWMFAGHEVHVMDTPGH 112

Query: 175 TDGCVTYVNQGEGMAFTGDTLLIRGCGRTD----FQQGGSGVPVRATPGHTDGCVTYVNQ 230
           T G ++    G    FTGDT+    CG+       Q   S   + + P       T +  
Sbjct: 113 TKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDD-----TSIYC 167

Query: 231 GEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPAHDYHGFSHSTV 290
           G     +     +      +  Q  +  + +   K++ ++P                +TV
Sbjct: 168 GHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIP----------------TTV 211

Query: 291 GEEKLYNPRLGEQISEEKFVEIMNNLKL 318
             EK  NP L  + S     +I   L++
Sbjct: 212 KMEKACNPFL--RSSNT---DIRRALRI 234
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 260 Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Length = 262 Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Length = 264 Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Length = 251 Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Length = 266 Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Length = 298 Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Length = 220 Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Length = 249 Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Length = 249 Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Length = 200 Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 250 Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Length = 230 Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Length = 230 Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Length = 221 Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Length = 230 Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Length = 228 Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Length = 228 Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Length = 183 Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Length = 207 Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Length = 219 Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Length = 505 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
d1xm8a_254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 100.0
d1qh5a_260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 100.0
d2qeda1251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.98
d2gmna1264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 99.93
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 99.92
d1k07a_262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 99.92
d1x8ha_228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 99.92
d2aioa1266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 99.9
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 99.89
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 99.89
d1ko3a_230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 99.89
d2q0ia1298 Quinolone signal response protein PqsE {Pseudomona 99.89
d1znba_230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 99.88
d1ycga2249 Nitric oxide reductase N-terminal domain {Moorella 99.87
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 99.86
d1e5da2249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 99.85
d2p97a1200 Hypothetical protein Ava3068 {Anabaena variabilis 99.84
d1vmea2250 ROO-like flavoprotein TM0755, N-terminal domain {T 99.83
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 99.79
d1p9ea_294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 99.75
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 99.31
d1wraa1305 Teichoic acid phosphorylcholine esterase Pce (LytD 99.3
d1zkpa1244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 99.25
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 99.2
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 99.12
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 99.07
d1y44a1307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 98.76
d2cbna1305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 98.75
d1xtoa_304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 98.33
d1vjna_209 Hypothetical protein TM0207 {Thermotoga maritima [ 98.22
d2e7ya1280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 98.14
d2gmna1264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 98.0
d1k07a_262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 97.94
d2aioa1266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 97.89
d1xm8a_254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 97.75
d2qeda1251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 97.11
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 96.72
d1qh5a_260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 96.68
d2q0ia1298 Quinolone signal response protein PqsE {Pseudomona 96.63
d1x8ha_228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 96.33
d1e5da2249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 95.48
d1ycga2249 Nitric oxide reductase N-terminal domain {Moorella 95.22
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 93.82
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 91.78
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 87.4
d1p9ea_294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 85.05
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 83.57
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Glyoxalase II (hydroxyacylglutathione hydrolase)
domain: Glyoxalase II (hydroxyacylglutathione hydrolase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=9.9e-34  Score=248.33  Aligned_cols=193  Identities=30%  Similarity=0.446  Sum_probs=144.4

Q ss_pred             cceEEEEEEeCCCCeEEEEeCCCCChHHHHHHHHHcCCcccEEEecCCchhhhcChhhhhhhheeccccccccccchhHH
Q psy5665          51 SYTHTYILADKLSKECVIIDPVLEQADRDVTLINQLGLTLKYVINTHVHADHITGTGKIKTMYVINTHVHADHITGTGKI  130 (344)
Q Consensus        51 ~~~~~~li~~~~~~~~iLIDtG~~~~~~~~~~l~~~~~~i~~Vi~TH~H~DH~gg~~~~~~~~~v~~~~~~d~~~~~~~l  130 (344)
                      ..|++|+|.+++++++++||||.  .+.+++.+++.+.++++|++||.|+||++|+..+.+.+...++.+....      
T Consensus        10 ~dNy~Yli~d~~t~~avvIDPg~--~~~i~~~l~~~~~~l~~Il~TH~H~DH~~g~~~l~~~~~~~v~~~~~~~------   81 (254)
T d1xm8a_          10 KDNYAYILHDEDTGTVGVVDPSE--AEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDK------   81 (254)
T ss_dssp             TTEEEEEEECTTTCCEEEECCSS--HHHHHHHHHHHTCCCCEEECSSCCHHHHTTHHHHHHHHCCEEEEEGGGG------
T ss_pred             ccEEEEEEEECCCCEEEEECCCC--cHHHHHHHHHCCCceeEEecccCcccccCchHHHHhhcCCcEEeccccc------
Confidence            34679999998788899999983  6888999999999999999999999999998888887765555443221      


Q ss_pred             HhhhhhhHHhhhcccccccceEccCCCeeEeCCeeEEEEeCCCCCCCceEEEeCCCceeeecceeeeccCCCccccCCCC
Q psy5665         131 KTMVNNVQSIISKESGAQADIHVTHGDTIDFGDQQLEVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGGS  210 (344)
Q Consensus       131 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~i~~~~~pght~~~~~~~~~~~~iL~~GD~~~~~~~~~~~~~~~~~  210 (344)
                       .            .....+..+.+|+.+.+|+..+++++|||||++|++++.++                         
T Consensus        82 -~------------~~~~~~~~l~dgd~i~lg~~~i~vl~TPGHT~ghi~~~~~~-------------------------  123 (254)
T d1xm8a_          82 -D------------RIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPG-------------------------  123 (254)
T ss_dssp             -G------------GSTTEEEEECTTCEEEETTEEEEEEECCSSSSSCEEEEEGG-------------------------
T ss_pred             -c------------cCCCCCEEecCCCeeeecCcEEEEeeccCCCCCceEEEEcc-------------------------
Confidence             0            01124556677777777766666666666555555555544                         


Q ss_pred             CceeecCCCCCCCceeeeecCcceeEecceeeccCcccccCCCCCHHHHHHHHHHHHhcCCCceEEeeCCCCCCC-----
Q psy5665         211 GVPVRATPGHTDGCVTYVNQGEGMAFTGDTLLIRGCGRTDFQQGDSHKLFQSVRKEIFSLPDHFRVYPAHDYHGF-----  285 (344)
Q Consensus       211 ~~~~~~~pGHt~g~~~~~~~~~~~lf~GD~l~~~~~~~~~~~~~~~~~~~~sl~~~l~~l~~~~~v~pgHg~~~~-----  285 (344)
                                           ++++|+||+||.+++|++  +++++.++++|+ ++|..|+++++|+|||+|...     
T Consensus       124 ---------------------~~~lftGDtLf~~g~Gr~--~~g~~~~~~~sl-~kl~~Lpd~t~v~~gH~y~~~n~~f~  179 (254)
T d1xm8a_         124 ---------------------SRAIFTGDTMFSLSCGKL--FEGTPKQMLASL-QKITSLPDDTSIYCGHEYTLSNSKFA  179 (254)
T ss_dssp             ---------------------GTEEEEETTEETTEECCC--SSSCHHHHHHHH-HHHHTSCTTCEEEESBCCHHHHHHHH
T ss_pred             ---------------------cceEEeCCEEEeecCCcc--ccccHHHHHHHH-HHHHhCCcccEEeccCCccchhhhhh
Confidence                                 678899999999999985  678999999999 599999999999999997531     


Q ss_pred             ---------------------------ccccHHHHHHcCCCCCCCCCHHHHHHHhhh
Q psy5665         286 ---------------------------SHSTVGEEKLYNPRLGEQISEEKFVEIMNN  315 (344)
Q Consensus       286 ---------------------------~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~  315 (344)
                                                 .+++++.++++|+||+.  ...++.+.++.
T Consensus       180 ~~~~~~n~~l~~~~~~~~~~~~~~~~tvPstl~~E~~~Npflr~--~~~~i~~~l~~  234 (254)
T d1xm8a_         180 LSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRS--SNTDIRRALRI  234 (254)
T ss_dssp             HHHCTTCHHHHHHHHHHHHHHHTTCCCCCEEHHHHHHHCGGGCT--TCHHHHHHHTC
T ss_pred             hhhCCcchhhhhHHHHHHHHHhcCCCcccccHHHHHHhCccccC--CCHHHHHHhCC
Confidence                                       23666777777777765  44455555543
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure